Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My Public Portal
About
Project Development Report-Volume3
March 2021 Addendum Originally Approved December 17, 2014 Project Development Report Village of Plainfield 143RD STREET EXTENSION (FAU 0380) IL ROUTE 59 TO IL ROUTE 126 SECTION 06-00040-00-FP PROJECT M-9003(273) Prepared by: CMT, Inc. 550 N Commons Drive Suite 116 Aurora, IL 60504 Prepared for: Village of Plainfield 14400 Coil Plus Drive Plainfield, IL 60544 Volume 3 of 8 Appendix 18 Section 06‐00040‐00‐FP Village of Plainfield – 143rd Street Extension Project M‐9003(273) Project Development Report Volumes Volume 1 Narrative Appendix 1 – Location Map and Functional Classification Map Appendix 2 – Existing Typical Sections and Plan and Profile Appendix 3 – Structure Master Report and BCR Approval Letter Appendix 4 – Proposed Purpose and Need, Typical Sections, and Plan and Profile Appendix 5 – Preliminary Bridge Design and Hydraulic Report Approval Cover Letter Appendix 6 – Intersection Design Studies Appendix 7 – Bass & Gill Club Alternative Memorandum Appendix 8 – Type, Size, and Location (TS&L) Plans Volume 2 Appendix 9 – BDE 3100 Design Exception Request Forms Appendix 10 – Project Cost Estimate Appendix 11 – Complete Streets Memorandum Appendix 12 – Crash Analysis Appendix 13 – Land Acquisition Summary Appendix 14 – Urbanized Area Map Appendix 15 – FEMA Maps Appendix 16 – 404 Permit Correspondence Appendix 17 – PESA Volume 3 Appendix 18 – Environmental Survey Volume 4 Appendix 19 – Section 4(f) Appendix 20 – COSIM Pre‐Screen Analysis Appendix 21 – Noise Analysis Volume 5 Appendix 22 – Public Information Meeting Volume 6 Appendix 23 – Other Public Involvement Volume 7 Appendix 24 – LA‐IDOT‐FHWA Coordination Meetings and Bimonthly Coordination Meeting Minutes Volume 8 Appendix 25 – IDOT Approval Memorandums Appendix 26 – Other Coordination APPENDIX 18 Environmental Survey 1 ‐2 3 ‐13 14 ‐20 21 ‐29 30 ‐31 32 ‐57 58 ‐237 238 ‐240 241 ‐291 292 ‐474 143rd Street Extension Village of Plainfield Appendix 18 Environmental Survey Section 06‐00040‐00‐FP Natural Resources Review Approval and Memo Project Overview IDOT Correspondence ‐ No ESR Addendum for IL 59 Required Wetlands Clearance Approval and WIE Form IDNR Wetlands Approval WIE Submittal and Supplemental Information Conceptual Compensation Plan ‐ Fletcher Lake Cultural Resources Approval and Memo Tree Survey Report Wetland Delineation Report Project Overview Submittal Date:08/07/2006 Sequence No:13370 Plainfield Contract #: Route:143rd Street Marked: Street:143rd Street Extension Section:06-00040-00-FP District:1 Counties:Will Municipality(ies):Village of Plainfield 1 FromTo (At):Illinois Route 59 to Illinois Route 126 Quadrangle:Plainfield Township-Range-Section:T36N-R9E-Sec 2,3,4,9,10,11 Project Length:km miles Anticipated Design Appr.:04/01/2007 1.6093 Anticipated Processing:ECAD Funding:Federal State TBP MFT Local Non-MFT Consultant: PTB No.:Item No.:PTB Date: Requesting Agency:Local Job No.: Prequal Level: Project No:Project Identifier: Survey Target Date: Entered By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE BDE 2/8/2010 2/8/2010 3/3/2021 3/3/2021 10/23/2006 10/23/2006 BDE Sequence No:13370 Resubmittal 12/08/2014 ResubmittalCleared 12/8/2014 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.: Entered By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE 2/8/2010 2/8/2010 1/22/2007 1/22/2007 BDE Sequence No:13370 A Resubmittal 12/08/2014 ResubmittalCleared 12/8/2014 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.: Entered By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE Sequence No:13370 B Resubmittal ResubmittalCleared 91-200-08 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.:P- Entered By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste 11/26/2013 BDE Sequence No:13370 C Resubmittal ResubmittalCleared 91-200-08 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.:P- Entered By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE BDE 11/5/2020 12/5/2020 3/3/2021 3/3/2021 4/1/2020 4/1/2020 7/31/2019 BDE Sequence No:13370 D Resubmittal ResubmittalCleared 91-200-08 FromTo (At):IL Route 59 to IL Route 126 Section:06-00040-00-FP Job No.:P- Page 1 Project Phase Comments: Project Initiation Ltr to FHWA Notice of Intent Notice of Availability Draft Final Public Info Meeting(s) 1st 2nd Public Hearing Draft ROD/FONSI Approved Date In Office: 12/26/2019 Date Out Of Office: 02/21/2020 Comments: Few minor edits. Technical Reports: Noise Page 2 1 Jeremy Metz From:Romiti-Johnson, Irma G. <Irma.Romiti-Johnson@Illinois.gov> Sent:Friday, February 19, 2021 4:00 PM To:Tice 'Charles' Cole Cc:Salley, Jason R; Ruiz, Vanessa V; McCammack, Craig; Alexandra Zelles; Mike Wittkop; Jeremy Metz Subject:RE: ESR Addendum along IL 59 south of DuPage River & 143rd St Question ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. HiTice, SincenosoilexcavationisanticipatedfortheproposedmedianremovalworklocatedbetweenapproximatelySta. 3393+00to3394+00alongUS30/IL59,ESUconcursthatanAddendumESRisnotrequired. Thanks, Irma IrmaRomitiǦJohnson IllinoisDepartmentofTransportation ConsultantͲAECOM ESUͲSpecialWaste Ph:847Ͳ705Ͳ4122 ESUSchedule:Tues&Fri From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Tuesday,February16,20214:00PM To:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov> Cc:Salley,JasonR<Jason.Salley@illinois.gov>;McCammack,Craig<Craig.McCammack@illinois.gov>;RomitiͲJohnson, IrmaG.<Irma.RomitiͲJohnson@Illinois.gov>;AlexandraZelles<azelles@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;JeremyMetz<jmetz@cmtengr.com> Subject:[External]RE:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Vanessa, PleasefindattacheddocumentationregardingthescopeofmedianworkproposedoutsideoftheESRlimitsonIL59and thedispositionregardingthePESAworktodate. Jason–uponenvironmentalconcurrencewiththeapproachtothisparticularlocation,wewillmakealltheIDS,PNPand DErevisionsandresubmitpercomment. Thanks, Tice Charles“Tice”Cole|Crawford,Murphy&Tilly|w630.907.7059 ProjectEngineer Page 3 2 From:Salley,JasonR<Jason.Salley@illinois.gov> Sent:Thursday,February11,20211:33PM To:Tice'Charles'Cole<ccole@cmtengr.com> Subject:FW:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Thanks, Jason ChatWithMeOnTeams From:RomitiͲJohnson,IrmaG.<Irma.RomitiͲJohnson@Illinois.gov> Sent:Thursday,February11,20211:22PM To:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov>;McCammack,Craig<Craig.McCammack@illinois.gov>;Salley,JasonR <Jason.Salley@illinois.gov> Cc:Williams,JeffreyJ.<Jeffrey.Williams@Illinois.gov> Subject:RE:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Thanks, Irma IrmaRomitiǦJohnson IllinoisDepartmentofTransportation ConsultantͲAECOM ESUͲSpecialWaste Ph:847Ͳ705Ͳ4122 ESUSchedule:Tues&Fri From:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov> Sent:Thursday,February11,202112:59PM To:McCammack,Craig<Craig.McCammack@illinois.gov>;RomitiͲJohnson,IrmaG.<Irma.RomitiͲJohnson@Illinois.gov> Cc:Williams,JeffreyJ.<Jeffrey.Williams@Illinois.gov>;Palmer,DonaldH.<Donald.Palmer@illinois.gov> Subject:RE:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Importance:High ThanksCraig!Irma,wouldyoumindloopingmeinonaherewaycallwithCraig? From:McCammack,Craig<Craig.McCammack@illinois.gov> Sent:Thursday,February11,202112:57PM To:RomitiͲJohnson,IrmaG.<Irma.RomitiͲJohnson@Illinois.gov> Cc:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov>;Williams,JeffreyJ.<Jeffrey.Williams@Illinois.gov>;Palmer,DonaldH. <Donald.Palmer@illinois.gov> Subject:RE:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Page 4 3 Irma– Pleasecallmyhomenumberandwalkmethroughthedetailsandanswerquestions.847Ͳ277Ͳ7903 Thanks, Craig CraigA.McCammack,PG Consultant–V3Companies WasteAssessmentSpecialist IDOTDistrictOne O:847Ͳ705Ͳ5184 M:630Ͳ936Ͳ0332 From:RomitiͲJohnson,IrmaG.<Irma.RomitiͲJohnson@Illinois.gov> Sent:Thursday,February11,202112:19PM To:Palmer,DonaldH.<Donald.Palmer@illinois.gov>;McCammack,Craig<Craig.McCammack@illinois.gov> Cc:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov>;Williams,JeffreyJ.<Jeffrey.Williams@Illinois.gov> Subject:FW:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion HiDonandCraig, WereceivedaquestionregardingSeq13370D(IL59and143rdStreetinPlainfield).Thedesignerisproposingto removethemountablemediansouthofthestructurecarryingIL59overDuPageRiver.Thedesignerstatedthat theareaisbeingincreasedapproximately~100ͲftNorthͲSouth(downtothedrivewayssouthoftheriver)along ILͲ59. APESAresponseforthisworkwaspreviouslysubmittedtoSWU.IwantedtocheckwithSWUwhetherthe addedexcavationareacouldberiskͲmanagediftheexcavationvolumeislessthan200CY?Or,istheonly alternativetohaveaPESAaddendumtaskedandthisarealateraddedtothecurrentPSIscopeviaanupdated PESAresponse? Thanks, Irma IrmaRomitiǦJohnson IllinoisDepartmentofTransportation ConsultantͲAECOM ESUͲSpecialWaste Ph:847Ͳ705Ͳ4122 ESUSchedule:Tues&Fri From:Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov> Sent:Thursday,February11,202111:35AM To:RomitiͲJohnson,IrmaG.<Irma.RomitiͲJohnson@Illinois.gov> Subject:FW:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Thursday,February11,202110:21AM To:Salley,JasonR<Jason.Salley@illinois.gov> Page 5 4 Cc:Ferguson,Dwayne<Dwayne.Ferguson@illinois.gov>;Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov> Subject:RE:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Jason – Any ESR addendum would be for special waste. There is nothing that triggers reviews for cultural or biological resources. If an ESR for special waste is required, can the D1 environmental unit handle it? William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT From:Salley,JasonR<Jason.Salley@illinois.gov> Sent:Thursday,February11,202110:18AM To:Raffensperger,William<William.Raffensperger@illinois.gov> Cc:Ferguson,Dwayne<Dwayne.Ferguson@illinois.gov>;Ruiz,VanessaV<Vanessa.Ruiz@illinois.gov> Subject:ESRAddendumalongIL59southofDuPageRiver&143rdStQuestion Bill, Here’sascreenshotofthelimitsoftheESRaroundthesouthlegofIL59at143rdSt. Page 6 5 InordertoremovethemountablemediansouthofthestructurecarryingIL59overDuPageRiver(MAP)would requireanESRAddendumof~100ͲftdimensionNorthͲSouth(downtothedrivewayssouthoftheriver). IsthisESRaddendumsomethingwethinkcanbeprocessedquicklysinceit’sforworkwithinpavement(remove corrugatedmedianandreplacewithaflushmedianandpavementmarkings)? Attachedisthelatestschedulefortheproject. IwouldhateforthisentireprojecttobeheldupwithanESRaddendum~100Ͳftindepthforaturnlane. Page 7 6 Notdisagreeingthatitwouldn’tbenicetohavetheturnlanelengthened,butnotattheexpenseofaturnlane whichcanonlybelengthenedmarginally. Insteadwe’llgrindthemediandownandmodifytheleftͲturnlane’sgeometry. Ifneedbe,I’llsetupaWebExMeetingtodiscussinperson. Thanks, Jason ChatWithMeOnTeams From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Thursday,February11,20217:17AM To:Salley,JasonR<Jason.Salley@illinois.gov> Subject:RE: Jason – Didn’t get your email until now. Please call when you are available. William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT From:Salley,JasonR<Jason.Salley@illinois.gov> Sent:Wednesday,February10,20215:15PM To:Raffensperger,William<William.Raffensperger@illinois.gov> Subject: Ifyouhavetimerightnow,pleasecallmeat847Ͳ705Ͳ4085. Thankyou. Sincerely, JasonSalley,P.E. GeometricStudiesUnitHead IDOT–D1 W:847/705Ͳ4085 M:224/567Ͳ2856 jason.salley@illinois.gov ChatWithMeOnTeams State of Illinois - CONFIDENTIALITY NOTICE: The information contained in this communication is confidential, Page 8 7 may be attorney-client privileged or attorney work product, may constitute inside information or internal deliberative staff communication, and is intended only for the use of the addressee. Unauthorized use, disclosure or copying of this communication or any part thereof is strictly prohibited and may be unlawful. If you have received this communication in error, please notify the sender immediately by return e-mail and destroy this communication and all copies thereof, including all attachments. Receipt by an unintended recipient does not waive attorney-client privilege, attorney work product privilege, or any other exemption from disclosure. Page 9 Seq 13370D (IL 59 and 143rd Street in Plainfield) Extended Project Area – Median Work for Left Turn Lane Extension The project is proposing to remove the existing mountable median south of the structure carrying IL 59 over DuPage River to extend the northbound left turn lane at IL 59 and US 30/W. 143rd Street. The new median will be flush pavement. A portion of the median is located within the ESR Addendum D limits; however, the area required to complete the median work extends south beyond the ESR limits approximately 100 feet (see attached exhibits). A PESA was completed by IGS on July 23, 2019 and a PESA response was submitted to SWU on December 18, 2019. The property that this work would be completed on and all adjoining properties were included in the PESA. The PESA indicates that Site 8 (ROW at 14200-14300 blocks of S IL 59, intersection of Division Street and 143rd Street), located approximately 300 feet north of the median work, contains a recognized environmental condition (REC) due to a potential spill of approximately 20 gallons of diesel in 1983. Because Site 8 is located across the DuPage River from the proposed median work area, it is unlikely that any potential contamination from this spill would be present at the median work area. This site will not be impacted by the proposed median work. The adjoining Sites 7 and 13 contain de minimis conditions only; neither of these sites will be impacted by the proposed median work. The adjoining Site E (Performance Gear Systems Inc.) was identified on the BOL and UST databases, but likely does not present an environmental concern to the proposed median work; this site will not be impacted by the proposed median work. Additionally, the proposed median work will not require excavation beyond the existing subgrade. Based on the information presented above, the additional proposed median work, in and outside of the ESR Addendum D limits, for the northbound left turn lane extension is already covered by the PESA. Therefore, an ESR addendum and additional PESA investigation is not required for this work. Page 10 !!!!!!!!!!!!!!!!! ! ! !!!!!!! !!!! 1 Attachment 2, page 1. Site location map, Sites 1809A-1 through 1809A-13. All site boundaries are approximate and should not be used as actual parcel boundaries. 0200400100 Meters 0 500 1,000250 Feet ± 2 B 3 3 4 6 7 8 9 10 11 12Norman DrainUS 30 / W. 143rd St.S. IL 59 / N. Division St.US 30 / S. IL 59 / N. Division St.W. Riverwalk Ct. W. Hazelcrest Dr.DuPage River5 A E 4 12 13 CExtended project area for mountable median removal Village of Plainfield - 143rd Street Extended NBL Turn Lane Storage Page 11 Page 12 Page 13 1 Alexandra Zelles From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Thursday, March 4, 2021 11:16 PM To:Tice 'Charles' Cole Cc:DavisD1, Michelle L.; Mike Wittkop; Alexandra Zelles; Jeremy Metz; Randy Jessen; Scott Threewitt; Allen Persons Subject:FW: seq. 13370/A/D, 143rd Street Extension, Plainfield, Will Co - NRR limits Attachments:signed NRR update 2020.pdf; Aerial ESR Limits History.pdf ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, Plainfield/143rdSt.Extension,sec.06Ͳ00040Ͳ00ͲFP Pleaseseethemessagebelowandattacheddocumentationforthesubjectproject.Pleasecomplyandtakenote. Thanks, Kevin From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Wednesday,March3,20218:46AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:seq.13370/A/D,143rdStreetExtension,Plainfield,WillCoͲNRRlimits Kevin – Please see below. A copy of the attached documents and this email are to be included in the PDR as evidence that the NRR addendum D covers the entire project area. The final wetland coordination is still outstanding and must be completed for this project to be granted design approval. The BDE Natural Resources Unit has initiated coordination with IDNR for the wetland mitigation issues. William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT From:Hargrove,SusanDees<Susan.Hargrove@Illinois.gov> Sent:Tuesday,March2,20212:27PM To:Raffensperger,William<William.Raffensperger@illinois.gov> Subject:seq.13370/A/D,143rdStreetExtension,Plainfield,WillCoͲNRRlimits Page 14 2 HiBill, PleasenotethattheNRRdated11/2/20,attached,coverstheentireprojectofseq.13370/A/Dasdepictedinthe attachedmapoftheproject’shistoryforAdd.D.Letmeknowifyouneedanythingfurtherregardingthis. Thanks, SusanDeesHargrove BiologicalResourcesSpecialist IllinoisDepartmentofTransportation BureauofDesignandEnvironment 2300SouthDirksenParkway,Room330 Springfield,Illinois62764 Susan.Hargrove@illinois.gov State of Illinois - CONFIDENTIALITY NOTICE: The information contained in this communication is confidential, may be attorney-client privileged or attorney work product, may constitute inside information or internal deliberative staff communication, and is intended only for the use of the addressee. Unauthorized use, disclosure or copying of this communication or any part thereof is strictly prohibited and may be unlawful. If you have received this communication in error, please notify the sender immediately by return e-mail and destroy this communication and all copies thereof, including all attachments. Receipt by an unintended recipient does not waive attorney-client privilege, attorney work product privilege, or any other exemption from disclosure. Page 15 To: Greg S. Lupton From: Jack A. Elston By: Thomas C. Brooks Subject: Natural Resources Review Date: November 2, 2020 143rd Street Extension Addendum D Sec. 06-00040-00-FP T36N/R9E/S 2 Seq. No.: 13370D Will County The proposed project involves construction of a new road on new alignment (extension of 143rd Street). It is anticipated as a four-lane cross-section with four- foot medians, from IL 59 to IL 126. Signalization will occur at intersections. There will be a new bridge over the DuPage River. Addendum D was submitted because the project limits have moved due to the inability to acquire right of way from Commonwealth Edison. There are 41.9 acres of new land acquisition for the project. There will be in stream work in the DuPage River for the project. There will be 11.4 acres of trees removed for the project. The land cover in the vicinity of the project is urban, wetlands (including former gravel pit or strip mine lakes), and wooded. Review for Illinois Endangered Species Protection and Illinois Natural Areas Preservation – Part 1075 The Illinois Natural Heritage Database contains a record of State-listed threatened or endangered black-crowned night heron two miles south of the project. The project is mainly residential and urban and does not contain suitable habitat for this wetland-nesting species. There will be no adverse effect by the project on this species. Therefore, consultation under Part 1075 is terminated. This review for compliance with 17 Ill. Adm. Code Part 1075 is valid for two years unless new information becomes available that was not previously considered; the proposed improvement is modified; or additional species, essential habitat, or Natural Areas are identified in the vicinity. If the proposed improvement has not been implemented within two years of the date of this memorandum, or any of the above listed conditions develop, a new review will be necessary. Memorandum Page 16 Review for Illinois Interagency Wetland Policy Act – Part 1090 The proposed improvement was surveyed for wetlands. We reviewed the wetland survey report and the Wetlands Impact Evaluation form and approve both. There are eleven wetlands and one stream (DuPage River) located within the ESR limits. There will be permanent impacts to 7 wetlands totaling 3.787 acres and temporary impacts of 2.031 acres. Temporary impacts shall be mitigated via restoring original contours and re-seeding with native wetland species. Because this project occurs on new alignment, it shall be processed as a Standard Review Action with respect to wetlands. As such, coordination and approval of IDNR is necessary before this project can be cleared for wetlands, and mitigation ratios are higher. Mitigation is proposed at Gray Willow, Prairie Green, or Mill Creek Wetland Mitigation Sites. The project occurs in the Des Plaines and Lake Michigan Tributaries IWPA drainage basin, as does the Mill Creek Wetland mitigation site. The other two mitigation banks are in the Fox River IWPA Drainage Basin, which is out of basin. The mitigation acreage for an in basin bank would be 14.072 acres with a mitigation ratio of 2:1 or 4:1 per wetland. The latter ratio is applied to those wetlands impacted in the amount of 0.5 acres or more per wetland (i.e., Wetland Sites 1 and FL). The mitigation acreage for an out of basin bank would be 19.4835 acres with mitigation ratios of 3:1 or 5.5:1.0. Our review for compliance under Part 1090 shall be complete upon concurrence from the IDNR Wetlands Program. Review for Endangered Species Act - Section 7 The proposed improvement was reviewed in fulfillment of our obligation under Section 7(a)(2) of the Endangered Species Act. Our review included use of the US Fish and Wildlife Service’s Information for Planning and Conservation (IPaC) web-based review tool. Through IPaC, an official species list was received and is saved to the project folder. The list contains the endangered, threatened, proposed and candidate species and proposed and designated critical habitat that may be present within or in the vicinity of the proposed improvement. The following species are listed in Will County: Northern long-eared bat (NLEB), Eastern massasauga, sheepnose mussel, Hine’s emerald dragonfly, lakeside daisy, leafy prairie-clover, Mead’s milkweed, and Eastern prairie fringed orchid (EPFO). There is no Critical Habitat in the project vicinity. Under 50 CFR 402.12(e), the accuracy of the species list is limited to 90 days. Northern long-eared bat Northern long-eared bat suitable summer habitat consists of a wide variety of forested or wooded habitats where they roost, forage, and travel and may also include some adjacent and interspersed non-forested habitats such as emergent wetlands and adjacent edges of agricultural fields, old fields and pastures. This includes forests and woodlots containing potential roosts (i.e., live trees or snags LQFKHVGEKWKDWKDYHH[IROLDWLQJEDUNFUDFNVFUHYLFHVRUKROORZV DVZHOODV linear features such as fencerows, riparian forests, and other wooded corridors. These wooded areas may be dense or loose aggregates of trees with variable amounts of canopy closure. Individual trees may be considered suitable habitat when they exhibit characteristics of suitable roost trees and are within 1,000 feet of other forested or wooded habitat. Trees found in highly-developed urban areas Page 17 (e.g., street trees, downtown areas) are extremely unlikely to be suitable NLEB habitat. There will be 11.4 acres of trees removed as a result of this project. The land cover in the vicinity of the project is urban, wetlands (including former gravel pit or strip mine lakes), and wooded. There are no records of maternity roost trees, maternity colonies or hibernacula in the vicinity of the project corridor. We assessed the potential for adverse impacts to the NLEB in accordance with the Programmatic Biological Opinion on Final 4(d) Rule for the Northern Long- Eared Bat and Activities Excepted from Take Prohibitions. We determined that the proposed improvement may affect the NLEB but will not cause prohibited incidental take. We consulted with the USFWS via the Northern Long-Eared Bat 4(d) Rule IPaC Determination Key. The USFWS did not respond to our submittal within 30 days; thus, we presume our responsibilities under 7(a)(2) with respect to the NLEB are fulfilled through the USFWS 02-05-2018 Programmatic BO. No restrictions or discretionary conservation measures for this species have been placed on the proposed improvement. Our assessment determination for the NLEB is valid for one year from the date on the Northern Long-Eared Bat 4(d) Rule Verification Letter. Eastern prairie fringed orchid Eastern prairie fringed orchid occurs in a wide variety of habitats, from mesic prairie to wetland communities such as sedge meadows, marsh edges and even bogs. It requires full sunlight for optimum growth and flowering, which restricts it to grass- and sedge-dominated plant communities. The substrate of the sites where it occurs ranges from neutral to mildly calcareous. Occasionally the orchid colonizes successional habitats or recolonizes previously occupied areas. We evaluated the limits of the proposed improvement for the presence of potentially suitable EPFO habitat. Our evaluation included the use of EPFO guidance from the US Fish and Wildlife Service, Chicago Ecological Services Field Office. There are no prairies or high-quality wetlands in the project corridor. We determined there would be no effect to EPFO from the proposed improvement. Other Federally Listed Species We cross-referenced the preferred habitat of each of the remaining listed species with our knowledge of the project area and determined that there are no suitable habitats present. We have determined that the proposed improvement will have no effect on any of the remaining listed species. We have determined that the proposed improvement is not likely to jeopardize the continued existence of any endangered species or threatened species or result in the destruction or adverse modification of any critical habitat. Page 18 Should the proposed improvement be modified or new information indicate listed or proposed species may be affected, consultation or additional coordination should be initiated. Cc: Shawn Cirton (USFWS) Bradley Hayes (IDNR) Attachment — USFWS species list MA NLEB 4(d) Verification Letter SDH Page 19 143rd Street Extension ENVIRONMENTAL SURVEY REQUEST LIMIT HISTORY -, 0 390 780195 Feet Legend ESR Original 2006 ESR Addendum A 2007 ESR Addendum B 2013 ESR Addendum C Draft 2016 ESR Addendum C Final 2018 N Division StreetNaperville RoadState Route 126 £¤30 £¤30 D u P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community D Page 20 1 Alexandra Zelles From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Wednesday, March 3, 2021 10:57 AM To:Tice 'Charles' Cole Cc:DavisD1, Michelle L.; Mike Wittkop; Alexandra Zelles; Jeremy Metz; Randy Jessen; Scott Threewitt; Allen Persons Subject:FW: PMA Seq. #13370/A/D , 'Cleared for Design Approval' - Wetlands Form Attachments:WIE Form.pdf; IDNR IWPA_Concurrence letter.pdf; aerial with ESR limits.pdf; 13370 Revised WIE Feb 2021.pdf; RE: AESR 13370D - D1 - Will Co - Plainfield Sec 06-00040-00-FP; Wetlands Mitigation ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, Plainfield/143rdSt.Extension,sec.06Ͳ00040Ͳ00ͲFP PleaseseethemessagebelowandattacheddocumentsfromourCentralOffice,andproceedaccordingly. Thanks, Kevin From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Wednesday,March3,202110:33AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:PMASeq.#13370/A/D,'ClearedforDesignApproval'ͲWetlandsForm Mr. Stallworth – Please see below and attached. A copy of this email, conceptual wetland compensation plan, and the attachments must be included in the final PDR as evidence of the final wetland impact coordination. The LPA must complete the purchase of the wetland mitigation credits prior to letting. Additional information will follow concerning the additional steps needed for the on-site wetland mitigation. William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT From:Hargrove,SusanDees<Susan.Hargrove@Illinois.gov> Sent:Wednesday,March3,20219:57AM To:Raffensperger,William<William.Raffensperger@illinois.gov> Subject:PMASeq.#13370/A/D,'ClearedforDesignApproval'ͲWetlandsForm Page 21 2 A'ClearedforDesignApproval'datehasbeenenteredontheWetlandsformforthefollowingPMArecord: IDNRconcursvialetterthisdatewiththeFebruary2021WIEandmitigationonsiteviacompensationplan. Sequence#:13370/A/D District:1 Route:143rdStreet MarkedRoute: County: Will State of Illinois - CONFIDENTIALITY NOTICE: The information contained in this communication is confidential, may be attorney-client privileged or attorney work product, may constitute inside information or internal deliberative staff communication, and is intended only for the use of the addressee. Unauthorized use, disclosure or copying of this communication or any part thereof is strictly prohibited and may be unlawful. If you have received this communication in error, please notify the sender immediately by return e-mail and destroy this communication and all copies thereof, including all attachments. Receipt by an unintended recipient does not waive attorney-client privilege, attorney work product privilege, or any other exemption from disclosure. Page 22 Wetlands Cleared for Design Approval:11/05/2020 Cleared for Letting:11/05/2020 Mitigation Completed: Submittal Date:08/07/2006 Sequence No:13370 Plainfield Contract #: Project Length:km miles District:1 Counties:Will Route:143rd Street Marked: Street:143rd Street Extension Section:06-00040-00-FP Municipality(ies):Village of Plainfield 1.6093 1 FromTo (At):Illinois Route 59 to Illinois Route 126 Quadrangle:Plainfield Township-Range-Section:T36N-R9E-Sec 2,3,4,9,10,11 Anticipated Design Approval:04/01/2007 Requesting Agency:Local Job No.: Wetland Impacts Evaluation Project No: Mitigation:Yes Submittal Date:12/04/2007 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Wetlands are located on either side of the river and for long distances along both banks. To construct the river crossing, wetland impacts are unavoidable. Bridging avoids some areas of wetland. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:wetland bank site Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Much of the wetland will be bridged, and 0.44 acres are only shaded and not filled. Bridging of this wetland minimizes the need for embankment. Roadway cross section along the West Norman Drain is minimized to avoid additional impacts. Submitted By: Submittal Date:12/04/2007 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Wetlands are located on either side of the river and for long distances along both banks. To construct the river crossing, wetland impacts are unavoidable. Bridging avoids some areas of wetland. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Much of the wetland will be bridged, and 0.15 acres are only shaded and not filled. Bridging of this wetland minimizes the need for embankment. Submitted By: Submittal Date:02/23/2009 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Wetlands are located on either side of the river and for long distances along both banks. To construct the river crossing, wetland impacts are unavoidable. Bridging avoids some areas of wetland. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Much of the wetland will be bridged. Of the 0.475 acres to be impacted, 0.201 acres will be shaded and 0.274 acres will be filled. Bridging of this wetland minimizes the need for embankment. Submitted By: Submittal Date:02/23/2009 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Widening of the West Norman Drain is required to account for roadway construction within the DuPage River Flood Plain. Documentation of this is provided in the Location Drainage Study. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: The West Norman Drain is an open water stream component of Site 1. The West Norman Drain will be widened and realigned to account for the hydraulics of this proposed project. Submitted By: Page 23 Submittal Date:02/23/2009 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Wetlands are located on either side of the river and for long distances along both banks. To construct the river crossing, wetland impacts are unavoidable. Bridging avoids some areas of wetland. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Much of the wetland will be bridged. Of the 0.489 acres to be impacted, 0.168 acres will be shaded and 0.321 acres will be filled. Bridging of this wetland minimizes the need for embankment. Submitted By: Submittal Date:02/23/2009 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Wetland is avoided. Does the project have wetland impacts?No Type: Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: This appears to be a constructed wetland/detention basin, and is adjacent to the compensatory storage area. This wetland will not be impacted by the project. Submitted By: Submittal Date:02/23/2009 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Bridge abutment stabilization will be necessary on the east and west bank of the DuPage River for the roadway crossing over the river. Therefore, impacts to the DuPage River are unavoidable. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: A portion of the open water areas of the DuPage River will be impacted for bridge abutment stabilization. To construct the river crossing, stabilization over the river, and therefore, impacts to the DuPage River, are unavoidable. Submitted By: Submittal Date:12/19/2019 Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Other alternatives do not meet purpose and need. Does the project have wetland impacts?Yes Type:Both Wetland mitigation is being proposed:wetland bank site Reviewed Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Steepened sloped and retaining wall. Submitted By: Memo Date:03/03/2021 Memo:A revised WIE was received 2/23/21. Fletcher Lake impacts are now proposed in part to be mitigated on site. A conceptual mitigation plan was received and reviewed by this office. Please note that impacts to Fletcher Lake are noted as follows on the attached: FO = on site impacts and mitigation and FB = impacts to be banked. The remaining wetland impacts are noted as attached, with T appended to each impacted wetland site name for temporary impacts. Wetland Sites 2, A, and C have the same impacts as noted in the 2020 WIE. Impacts to the other wetlands (i.e., Sites 1, Fletcher Lake, and P) have changed per attached. Temporary impacts total 2.005 ac. and shall be mitigated via restoring original contours and re-seeding with native wetland species. Permanent wetland impacts total 3.55 ac. On site mitigation for permanent impacts to Fletcher Lake totals 2.71 ac. In-basin banking mitigation for the remaining permanent impacts to Fletcher Lake plus permanent impacts to the other wetlands totals 5.917 ac. The in basin banks proposed to be used are Neal Marsh Wetland Mitigation Bank and/or Mill Creek Wetland Mitigation Bank, both in the Des Plaines River and Lake Michigan Tributaries IWPA drainage basin, as is the project. Total wetland mitigation is 8.627 ac. The revised WIE, response, and conceptual mitigation plan are being coordinated with IDNR for their review and concurrence. The Will County Highway Department (or Village of Plainfield, responsible for monitoring) is requested to transmit pdf copies of the five year-end monitoring reports for our coordination with the IDNR per the IDOT Wetlands Action Plan. These reports and coordination Memo By:Susan Hargrove Page 24 with the IDNR will also be kept in the project file. Once IDNR concurrence is received regarding this WIE response and conceptual mitigation plan, this project will be cleared with respect to wetlands. Memo Date:11/02/2020 Memo:A revised WIE was received. There will be permanent impacts to 7 wetlands totaling 3.787 acres and temporary impacts of 2.031 acres. Please see attached for further details. Temporary impacts shall be mitigated via restoring original contours and re-seeding with native wetland species. Because this project occurs on new alignment, it shall be processed as a Standard Review Action with respect to wetlands. As such, coordination and approval of IDNR is necessary before this project can be cleared for wetlands, and mitigation ratios are higher. Mitigation is proposed at Gray Willow, Prairie Green, or Mill Creek Wetland Mitigation Sites. The project occurs in the Des Plaines and Lake Michigan Tributaries IWPA drainage basin, as does the Mill Creek Wetland mitigation site. The other two mitigation banks are in the Fox River IWPA Drainage Basin, which is out of basin. The mitigation acreage for an in basin bank would be 14.072 ac with a mitigation ratio of 2:1 or 4:1 per wetland. The latter ratio is applied to those wetlands impacted in the amount of 0.5 ac or more per wetland (i.e., Wetland Sites 1 and FL). The mitigation acreage for an out of basin bank would be 19.4835 ac with mitigation ratios of 3:1 or 5.5:1.0. This project will be cleared for construction for wetlands upon concurrence from IDNR's Wetlands Program. Memo By:Susan Hargrove Memo Date:12/03/2009 Memo:This office has received the Wetland Delineation report prepared by Huff & Huff, Inc. and the Wetland Impact Evaluation (WIE) form submitted for this project and finds the information to be satisfactory with regard to the Interagency Wetlands Policy Act (IWPA) and department policy. Based on the information submitted, two wetlands will be impacted as a result of this project. Wetland Site 1 is a marsh located on the west side of the DuPage River along the floodplain and the West Norman Drainage Ditch floodplain. This wetland has an FQI of 8.0, indicating low natural quality. An anticipated 1.25 acre of this wetland will be permanently impacted by fill. Wetland Site 2 is a wet meadow located on the east side of the DuPage River. This wetland has an FQI of 3.5, indicating very low natural quality. An anticipated 0.31 acre of this wetland will be temporarily impacted by vegetation removal. Mitigation for the permanent impacts has been proposed to occur at an in-basin wetland mitigation bank, Cedar Creek Wetland Mitigation Bank site. This office concurs with that form of mitigation. According to the Implementing Rules of the IWPA, a mitigation ratio of 4.0:1.0 will be applied to Wetland Site 1, requiring 5.04 acres of credits to be purchased. Mitigation for the temporary impacts will occur on-site. A ratio of 1.0:1.0 will be applied, requiring 0.31 acre to be restored to original grade and re-seeded with Agrostis alba @ 5 lbs/acre. This project occurs on new alignment and therefore qualifies to be processed as Standard Review Action in accordance with the IDOT Wetlands Action Plan. As such, the highest mitigation ratios apply and coordination with IDNR is required. IDNR is being notified via a copy of this memo. Their concurrence or comments will be coordinated with your office by separate memo. Memo By:Janel Veile Memo Date:02/23/2009 Memo:Fill will occur as a result of bridge construction and compensatory storage basin along the west bank of the DuPage River. The project is parallel to the West Norman Drain and perpendicular to the DuPage River. Bridging minimizes the need for embankments and additional fill. Memo By:Jim Novak Memo Date:02/23/2009 Memo:Fill will occur as a result of bridge construction along the east bank of the DuPage River. Approximately 0.168 acres will be shaded and vegetation removal will occur, but no fill will be placed under the bridge. Bridging minimizes the need for embankments and additional fill. Memo By:Jim Novak Memo Date:12/04/2007 Memo:Fill will occur as a result of bridge construction and compensatory storage basin along the west bank of the DuPage River. The project is parallel to the West Norman Drain and perpendicular to the DuPage River. About 0.176 acres will be filled on the south side of the bridge, 0.545 acres on the north including the compensatory storage area. About 0.09 acres of fill will occur in the DuPage River to stabilize the west bank and prevent the collapse of the ComEd high tension tower. About 0.44 acres will be shaded under the bridge but not permanently filled. Bridging minimizes the need for embankments and additional fill. Jim Novak, Huff & Huff, Inc. Memo By:Jim Novak Memo Date:12/04/2007 Memo By:Jim Novak Page 25 Wetland Impacts and Mitigation Required Memo:Fill will occur as a result of bridge construction along the east bank of the DuPage River. Approximately 0.15 acres will be shaded and vegetation removal will occur, but no fill will be placed under the bridge. Approximately 0.15 acres will be filled to construct the bridge. Bridging minimizes the need for embankments and additional fill. Jim Novak, Huff & Huff, Inc. Site No. Type T&E Nature Preserve Natural Area Essential Habitat Size (acres) Acres of Impact Ratio Acres of Compensation RP1 0.225 NA .225 2.0 .450 Basin Quadrangle FQI Pond No No No No Plainfield07120004 Describe the work:Excavation P1 2.4 NA .263 2.0 .526 Basin Quadrangle FQI Pond No No No No Plainfield07120004 Describe the work:Fill A 0.064 3 .021 2.0 .042 Basin Quadrangle FQI Marsh No No No No Plainfield07120004 Describe the work:Fill FB 11.3 .691 4.0 2.764 Basin Quadrangle FQI Pond No No No No Describe the work: C 0.003 4.9 .003 2.0 .006 Basin Quadrangle FQI Forested No No No No Plainfield07120004 Describe the work:Excavation FO 11.3 NA 1.807 1.5 2.711 Basin Quadrangle FQI Pond No No No No Plainfield07120004 Describe the work:Fill P1T 2.4 NA .840 .0 .000 Basin Quadrangle FQI Pond No No No No Plainfield07120004 Describe the work:Excavation AT 0.064 3 .014 .0 .000 Basin Quadrangle FQI Marsh No No No No Plainfield07120004 Describe the work:Fill 1 9.2 13.9 .519 4.0 2.076 Basin Quadrangle FQI Wet Mead No No No No Plainfield07120004 Describe the work:Fill 1T 9.2 13.9 1.151 .0 .000 Basin Quadrangle FQI Wet Mead No No No No Plainfield07120004 Describe the work:Fill 2 0.026 4.6 .026 2.0 .052 Basin Quadrangle FQI Forested No No No No Plainfield07120004 Describe the work:Excavation 5.560 8.627Total Page 26 DDDD Page 27 DDDDDDDDDDDDDDDDDD Page 28 DDD Page 29 November 5, 2020 Susan Dees Hargrove Biological Resources Specialist Illinois Department of Transportation Bureau of Design and Environment 2300 South Dirksen Parkway, Room 330 Springfield, Illinois 62764 RE: Seq. 13370D, 143rd Street, Plainfield, Will Co Dear Ms. Hargrove: The Illinois Department of Natural Resources has reviewed the above-mentioned project and has no objections. The Department concurs with the mitigation ratios and use of any of the listed mitigation banks indicated in the signed Natural Resource Review dated November 2, 2020. Please contact me if you have any questions regarding this review. Bradley Hayes Resource Planner Office of Realty & Capital Planning Illinois Dept. of Natural Resources One Natural Resources Way Springfield, IL 62702-1271 bradley.hayes@illinois.gov Phone: (217) 782-0031 Bradley Hayes Page 30 3 March 2021 Susan Dees Hargrove Biological Resources Specialist Illinois Department of Transportation Bureau of Design and Environment 2300 South Dirksen Parkway, Room 330 Springfield, Illinois 62764 RE: Seq. 13370D, 143rd Street, Plainfield, Will Co Dear Ms. Hargrove: The Illinois Department of Natural Resources has reviewed the Revised Wetland Impact Evaluation (WIE) for the above-mentioned project and has no objections. The Department approves of onsite mitigation at Fletcher Lake, as indicated in the Conceptual Compensation Plan Fletcher Lake dated February 19, 2021; and with the mitigation ratios and use of Neal Marsh and/or Mill Creek Mitigation Bank for the remaining mitigation as indicated in the revised WIE. Please contact me if you have any questions regarding this review. Bradley Hayes Resource Planner Office of Realty & Capital Planning Illinois Dept. of Natural Resources One Natural Resources Way Springfield, IL 62702-1271 Bradley.Hayes@Illinois.gov Phone: (217) 782-0031 Bradley Hayes Page 31 550N CommonsDrive Suite116 Aurora,Illinois60504 phone 630.820.1022 FAX 630.820.0350 cmtengr.com Engineers and Consultants Crawford, Murphy & Tilly Centered in Value February 2021 Kevin Stallworth, P.E. Illinois Department of Transportation Bureau of Local Roads and Streets Re: Revised Wetland Impact Evaluation for the Plainfield 143rd Street Extension Project Dear Mr. Stallworth: Below is updated information for a Wetland Impact Evaluation (WIE) for the Plainfield 143rd Street Extension project located in Plainfield, Will County, Illinois. A WIE was previously submitted for this project on December 19, 2019 and updated on June 15, 2020 following project refinement. Since the June 2020 submittal, additional project refinement has resulted in revised impact acreages. The project is also proposing to mitigate a portion of impacts to Fletcher Lake (isolated) by on-site compensation. A conceptual compensation plan for Fletcher Lake is attached, as requested by IDOT on January 20, 2021. All temporary impacts will be mitigated by re-seeding any disturbed areas with a proper native wetland seed mix, as appropriate for the site, and removing any temporary fill, to restore the wetland to pre-construction conditions. Impacts and mitigation requirements are detailed in the table below. SiteTypeUSACE Jurisdictional TemporaryImpactsPermanentImpacts Impact Area (ac) Mitigation Ratio** Impact Area (ac) Mitigation Ratio* OnͲSite Compensation InͲBasin Mitigation (credits) Site1WetmeadowYes1.1511:10.5194:102.076 Site2 Forested wetlandNo0 Ͳ0.0262:100.052 WetlandAMarshYes0.0141:10.0212:100.042 WetlandC Forested wetlandNo0 Ͳ0.0032:100.006 Pond1PondYes0.841:10.2632:100.526 Fletcher Lake***PondNo0Ͳ2.4981.5:12.710.000 Ͳ4:102.765 Retention Pond1PondNo0 Ͳ0.2252:100.450 Total2.005Ͳ3.555Ͳ2.7105.917 *MitigationratiosareassumedbasedondraftWIEresponsefromIDOT(Feb.2020)ontheIWPAcompensationratiosandaresubjectto change. **TemporaryimpactswillbemitigatedonsitebyrestoringtemporarilyimpactedwetlandareastopreͲconstructionconditions(includes gradingandseeding). ***1.8acwillbemitigatedonͲsitewithnewpondareaandaquatichabitatimprovements,and0.69acofimpactsmitigatedbypurchaseof credits. Page 32 Wetland Impact Evaluation Plainfield 143rd Street Extensionȱ February 19, 2021 ȱ ȱ ȱ 550N CommonsDrive Suite116 Aurora,Illinois60504phone630.820.1022FAX630.820.0350cmtengr.com Engineers and Consultants Crawford, Murphy & Tilly Centered in Value District: 1 Requesting Agency: Local 1.Does this project have wetland impacts? Yes Type: Both 2. Identify each wetland site being affected and acreage from each expected to be converted to other use(s). WetlandImpactsandMitigationRequired Site No. Type T&E Nature Preserve Natural Area Essential Habitat Size (acres) Acres of Impact Permanent Temporary Total 1* Wet Meadow; Forested; MarshNoNoNoNo9.200.5191.1511.67 Basin: 07120004Quadrangle: Plainfield,ILFQI:13.9 Describe the work: Permanentfillandexcavationforroadandbridgeconstruction,and compensatorystorage(0.519ac);temporaryconstructionaccess(1.151ac) 2 Forested; Seasonal depressionalNoNoNoNo0.0260.02600.026 Basin: 07120004Quadrangle: Plainfield,ILFQI:4.6 Describe the work: Excavationforcompensatorystorage A* Marsh; PondNoNoNoNo0.060.0210.0140.035 Basin: 07120004Quadrangle: Plainfield,ILFQI:3.0 Describe the work: Permanentfillandexcavationforbridgeconstruction(0.021ac);temporary constructionaccessanddewatering(0.014ac) C Forested; Seasonal depressionalNoNoNoNo0.0030.00300.003 Page 33 Wetland Impact Evaluation Plainfield 143rd Street Extensionȱ February 19, 2021 ȱ ȱ ȱ 550N CommonsDrive Suite116 Aurora,Illinois60504phone630.820.1022FAX630.820.0350cmtengr.com Engineers and Consultants Crawford, Murphy & Tilly Centered in Value WetlandImpactsandMitigationRequired Site No. Type T&E Nature Preserve Natural Area Essential Habitat Size (acres) Acres of Impact Permanent Temporary Total Basin: 07120004Quadrangle: Plainfield,ILFQI:4.9 Describe the work: Excavationforcompensatorystorage Pond1 (P1)*PondNoNoNoNo2.40.2630.841.103 Basin: 07120004Quadrangle: Plainfield,ILFQI:NA Describe the work: Permanentfillandexcavationforbridgeconstruction(0.263ac);temporary constructionaccessanddewatering(0.84ac) Fletcher Lake (FL)PondNoNoNoNo11.32.49802.498 Basin: 07120004Quadrangle: Plainfield,ILFQI:NA Describe the work: Fillandexcavationforroadconstruction RP1PondNoNoNoNo0.2250.22500.225 Basin: 07120004Quadrangle: Plainfield,ILFQI:NA Describe the work: Excavationforcompensatorystorage *UnderjurisdictionoftheUSACE 3. Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: Reasonable alternatives were evaluated in accordance with NEPA. The proposed alignment was modified to minimize wetland impacts to the greatest extent practicable: steepened embankment fill front slopes and selected a combination slope/retaining wall. Cont. in Section 8. 4. Summarize briefly why there are no practicable alternatives to the use of the wetland(s): Alternatives that would avoid all wetland impacts would not meet the project purpose and need to reduce significant traffic congestion along Route 59, Route 126, and US Route 30 through the downtown limits of Plainfield. Cont. in Section 8. 5. Mitigation site: Wetland Bank Site & On-site (Fletcher Lake) 6. Mitigation basin: In basin Page 34 Wetland Impact Evaluation Plainfield 143rd Street Extensionȱ February 19, 2021 ȱ ȱ ȱ 550N CommonsDrive Suite116 Aurora,Illinois60504 phone 630.820.1022 FAX 630.820.0350 cmtengr.com Engineers and Consultants Crawford, Murphy & Tilly Centered in Value 7. Local Contact Person: Charles Cole, P.E.Telephone #: 630-907-7059 ext. Title: Project Manager E-mail: ccole@cmtengr.com Company: Crawford, Murphy & Tilly, Inc. 8. Additional Information: 2.Site 1 – Also lesser areas of forested and marsh types. Other work includes excavation for floodway compensatory storage, and temporary construction access impact. Fletcher Lake – Other work includes excavation for floodway compensatory storage and mitigation of lake fill below the normal water level. 3.Alternative 2 – Alignment to the South Although this alignment would limit permanent ROW from residential properties and fill to existing mining ponds, it would have resulted in the greatest amount of wetland impact. Therefore, Alt. 2 was eliminated from further consideration. No Action Alternative This alternative did not meet the purpose and need of reducing traffic congestion and improving safety through the limits of downtown Plainfield. 4. Given the location of the DuPage River and the West Norman Drain along the proposed route, there were no practicable alternatives to completely avoid wetlands. Of the alternatives, the north alignment (preferred) has the least amount of wetland impacts. 5. A portion of impact to Fletcher Lake will be mitigated on site. Credits are planned to be purchased from Mill Creek Mitigation Bank to mitigate for the remaining impact to Fletcher Lake and impact to all other wetland resources. The conceptual compensation plan for Fletcher Lake is attached. The wetland delineation has been provided previously. The AJD is attached. Please contact me at (630) 907- 7072 or via email at azelles@cmtengr.com if you have any questions or need any additional information. Sincerely, Crawford, Murphy & Tilly, Inc. Alexandra Zelles Environmental Scientist Page 35 Illinois Department of TransportationOmer Osman, Acting Secretary State of IllinoisGovernor JB Pritzker × View up to date information on how Illinois is handling the Coronavirus Disease 2019 (COVID-19) from the Illinois Department of Public Health WETLANDS IMPACT EVALUATION Note: Internet Explorer 5.0 (or higher) Browser required for submittal. Javascript must be enabled. Submittal Date: Sequence No.:District:ዩ Requesting Agency: /RFDO ዩ 1. Does the project have wetland impacts?<HV ዩ Type:%RWK ዩ 2. Identify each wetland site being affected and acreage from each expected to be converted to other use(s). Wetland Impacts and Mitigation Required $GG6LWH Site No.Type T&E Nature Preserve Natural Area Essential Habitat Size(acres) Acres of Impact :HW0HDG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI: Describe the work: )LOO ዩ )RUHVWHG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI: Describe the work: ([FDYDWLRQ ዩ $0DUVK ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI: Describe the work: )LOO ዩ &)RUHVWHG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI: Describe the work: ([FDYDWLRQ ዩ 33RQG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI:1$ Describe the work: )LOO ዩ )/3RQG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Page 1 of 2Illinois Department of Transportation 2/21/2021https://apps.dot.illinois.gov/environment/wetlands.asp Page 36 3. Briefly describe the measures considered to avoid and minimize adverse impacts to the wetlands: ᄞᄟ 5HDVRQDEOHDOWHUQDWLYHVZHUHHYDOXDWHGLQDFFRUGDQFHZLWK1(3$7KH SURSRVHGDOLJQPHQWZDVPRGLILHGWRPLQLPL]HZHWODQGLPSDFWVWRWKH JUHDWHVWH[WHQWSUDFWLFDEOH VWHHSHQHGHPEDQNPHQWILOOIURQWVORSHVDQG 4. Summarize briefly why there are no practicable alternatives to the use of the wetland(s): ᄞᄟ $OWHUQDWLYHVWKDWZRXOGDYRLGDOOZHWODQGLPSDFWVZRXOGQRWPHHWWKH SURMHFWSXUSRVHDQGQHHGWRUHGXFHVLJQLILFDQWWUDIILFFRQJHVWLRQDORQJ 5RXWH 5RXWHDQG865RXWHWKURXJKWKHGRZQWRZQOLPLWVRI 5. Mitigation site: $W6LWHRI,PSDFW RQVLWH ዩ 6. Mitigation basin: ,Q%DVLQ ዩ 7. Local Contact Person:&KDUOHV&ROH3(Telephone #: () - ext. Title:3URMHFW0DQDJHU E-Mail:FFROH#FPWHQJUFRP Company:&UDZIRUG0XUSK\ 7LOO\,QF 8. Additional Information: Memo By:$OH[DQGUD=HOOHV&07 Submitted By: $OH[DQGUD=HOOHV&07 ᄞ ᄟ 6LWH±$OVROHVVHUDUHDVRIIRUHVWHGDQGPDUVKW\SHV2WKHUZRUNLQFOXGHVH[FDYDWLRQIRU IORRGZD\FRPSHQVDWRU\VWRUDJHDQGWHPSRUDU\FRQVWUXFWLRQDFFHVVLPSDFW )/±2WKHUZRUNLQFOXGHVH[FDYDWLRQIRUIORRGZD\FRPSHQVDWRU\VWRUDJHDQGPLWLJDWLRQRIODNH ILOOEHORZWKHQRUPDOZDWHUOHYHO $OW6RXWK $OWKRXJKWKLVDOLJQPHQWZRXOGOLPLWSHUPDQHQW52:IURPUHVLGHQWLDOSURSHUWLHVDQGILOOWR H[LVWLQJPLQLQJSRQGVLWZRXOGKDYHUHVXOWHGLQWKHJUHDWHVWDPRXQWRIZHWODQGLPSDFW 7KHUHIRUH$OWZDVHOLPLQDWHGIURPIXUWKHUFRQVLGHUDWLRQ (65+RPH3DJH &OHDU)RUP 6XEPLW)RUP Basin: Quadrangle: 3ODLQILHOG,/FQI:1$ Describe the work: )LOO ዩ 533RQG ዩ 1R ዩ 1R ዩ 1R ዩ 1R ዩ Basin: Quadrangle: 3ODLQILHOG,/FQI:1$ Describe the work: ([FDYDWLRQ ዩ © 2017 Illinois Department of Transportation Page 2 of 2Illinois Department of Transportation 2/21/2021https://apps.dot.illinois.gov/environment/wetlands.asp Page 37 DEPARTMENT OF THE ARMY CHICAGO DISTRICT, CORPS OF ENGINEERS 231 SOUTH LASALLE STREET CHICAGO, ILLINOIS 60604-1437 REPLY TO ATTENTION OF: April 29, 2020 Operations Division Regulatory Branch LRC-2018-00901 SUBJECT: Jurisdictional Determination for the 143rd Street Extension Project in Plainfield, Will County, Illinois (Latitude 41.623292, Longitude -88.198571) Scott Threewitt Village of Plainfield Department of Public Works 14400 Coil Plus Drive Plainfield, Illinois 60544 Dear Mr. Threewitt: This is in response to your request that the U.S. Army Corps of Engineers complete a jurisdictional determination for the above-referenced site submitted on your behalf by CMT, Inc. The subject project has been assigned number LRC-2018-00901. Please reference this number in all future correspondence concerning this project. Following a review of the information you submitted, this office has determined that the subject property contains "waters of the United States". Site 1, Pond 1, Mining Pond 2 & Mining Pond 3, and Wetlands W1, W2, W3, A & E, have been determined to be under the jurisdiction of this office and therefore, subject to Federal regulation. Site 3, RP2, Mining Ponds 1 & 4, and Wetlands B, C & D have been determined to be isolated and therefore not subject to Federal regulation. Please be informed that this office does not concur with the boundaries of waters not under the jurisdiction of this office. Site 2, RP1, RD1, RD2 & the Gully, are water features Exempt from Federal regulation. Please be informed that this office does not concur with the boundaries of waters not subject to Federal regulation. In the event an application is submitted for work within jurisdictional areas, a concurrence of the wetland boundaries and/or a professional survey of the identified wetland and water features stamped by a professional surveyor will need to be prepared and shall accompany the approved wetland delineation. Page 38 For a detailed description of our determination please refer to the enclosed decision document. This determination covers only your project as depicted in the Wetland and WOUS Investigation Report dated October 2016, prepared by Huff & Huff. This determination is valid for a period of five (5) years from the date of the letter, unless new information warrants revision of the determination before the expiration date or a District Commander has identified, after public notice and comment, that specific geographic areas with rapidly changing environmental conditions merit re-verification on a more frequent basis. This letter is considered an approved jurisdictional determination for your subject site. If you object to this determination, you may appeal, according to 33 CFR Part 331. Enclosed you will find a Notification of Appeal Process (NAP) fact sheet and a Request for Appeal (RFA) form. If you request to appeal the above determination, you must submit a completed RFA form to the Great Lakes/Ohio River Division Office at the following address: Jacob Siegrist Regulatory Appeals Review Officer US Army Corps of Engineers Great Lakes and Ohio River Division 550 Main Street, Room 10-714 Cincinnati, Ohio 45202-3222 Phone: (513) 684-2699 Fax: (513) 684-2460 In order to be accepted, your RFA must be complete, meet the criteria for appeal and be received by the Division Office within sixty (60) days of the date of the NAP. If you concur with the determination in this letter, submittal of the RFA form to the Division office is not necessary. This determination has been conducted to identify the limits of the Corps Clean Water Act jurisdiction for the particular site identified in this request. This determination may not be valid for the wetland conservation provisions of the Food Security Act of 1985, as amended. If you or your tenant are USDA program participants, or anticipate participation in USDA programs, you should request a certified wetland determination from the local office of the Natural Resources Conservation Service prior to starting work. It is your responsibility to obtain any required state, county, or local approvals for impacts to wetland areas not under the Department of the Army jurisdiction. Pursuant to Section 404 of the Clean Water Act, the U.S. Army Corps of Engineers regulates the discharge of dredged or fill material into waters of the United States, including wetlands. A Department of the Army permit is required for any proposed work involving the discharge of dredged or fill material within the jurisdiction of this office. To initiate the permit process, please submit a joint permit application form along with detailed plans of the proposed work. Information concerning our program, including the application form and an application checklist, can be found at and downloaded from our website: http://www.lrc.usace.army.mil/Missions/Regulatory.aspx Page 39 If you have any questions, please contact Mr. Michael J. Machalek of my staff by telephone at (312) 846-5534 or email at Mike.J.Machalek@usace.army.mil. Sincerely, Diedra L. McLaurin Team Leader, West Section Regulatory Branch Enclosures Copy Furnished w/out Enclosures Will County Land Use Department (Jim Song) CMT, Inc. (Patrick VerHalen) MCLAURIN.DIED RA.L.1230340362 Digitally signed by MCLAURIN.DIEDRA.L.12303403 62 Date: 2020.04.29 12:35:15 -05'00' Page 40 NOTIFICATION OF ADMINISTRATIVE APPEAL OPTIONS AND PROCESS AND REQUEST FOR APPEAL Applicant: Scott Threewitt, Village of Plainfield, Dept of Public Works File Number: LRC-2018-00901 Date: April 29, 2020 Attached is:See Section below INITIAL PROFFERED PERMIT (Standard Permit or Letter of Permission) A PROFFERED PERMIT (Standard Permit or Letter of Permission) B PERMIT DENIAL C X APPROVED JURISDICTIONAL DETERMINATION D PRELIMINARY JURISDICTIONAL DETERMINATION E SECTION I - The following identifies your rights and options regarding an administrative appeal of the above decision. Additional information may be found at http://www.usace.army.mil/CECW/Pages/reg_materials.aspx or Corps regulations at 33 CFR Part 331. A. INITIAL PROFFERED PERMIT: You may accept or object to the permit. x ACCEPT: If you received a Standard Permit or a Letter of Permission (LOP), you may sign the permit document and return it to the district commander for final authorization. Your signature on the Standard Permit or acceptance of the LOP means that you accept the permit in its entirety, and waive all rights to appeal the permit, including its terms and conditions, and approved jurisdictional determinations associated with the permit. x OBJECT: If you object to the permit (Standard or LOP) because of certain terms and conditions therein, you may request that the permit be modified accordingly. You must complete Section II of this form and return the form to the district commander. Your objections must be received by the district commander within 60 days of the date of this notice, or you will forfeit your right to appeal the permit in the future. Upon receipt of your letter, the district commander will evaluate your objections and may: (a) modify the permit to address all of your concerns, (b) modify the permit to address some of your objections, or (c) not modify the permit having determined that the permit should be issued as previously written. After evaluating your objections, the district commander will send you a proffered permit for your reconsideration, as indicated in Section B below. B. PROFFERED PERMIT: You may accept or appeal the permit x ACCEPT: If you received a Standard Permit or a Letter of Permission (LOP), you may sign the permit document and return it to the district commander for final authorization. Your signature on the Standard Permit or acceptance of the LOP means that you accept the permit in its entirety, and waive all rights to appeal the permit, including its terms and conditions, and approved jurisdictional determinations associated with the permit. x APPEAL: If you choose to decline the proffered permit (Standard or LOP) because of certain terms and conditions therein, you may appeal the declined permit under the Corps of Engineers Administrative Appeal Process by completing Section II of this form and sending the form to the division commander. This form must be received by the division commander within 60 days of the date of this notice. C. PERMIT DENIAL: You may appeal the denial of a permit under the Corps of Engineers Administrative Appeal Process by completing Section II of this form and sending the form to the division commander. This form must be received by the division commander within 60 days of the date of this notice. D. APPROVED JURISDICTIONAL DETERMINATION: You may accept or appeal the approved JD or provide new information. x ACCEPT: You do not need to notify the Corps to accept an approved JD. Failure to notify the Corps within 60 days of the date of this notice, means that you accept the approved JD in its entirety, and waive all rights to appeal the approved JD. x APPEAL: If you disagree with the approved JD, you may appeal the approved JD under the Corps of Engineers Administrative Appeal Process by completing Section II of this form and sending the form to the division commander. This form must be received by the division commander within 60 days of the date of this notice. Page 41 E. PRELIMINARY JURISDICTIONAL DETERMINATION: You do not need to respond to the Corps regarding the preliminary JD. The Preliminary JD is not appealable. If you wish, you may request an approved JD (which may be appealed), by contacting the Corps district for further instruction. Also you may provide new information for further consideration by the Corps to reevaluate the JD. SECTION II - REQUEST FOR APPEAL or OBJECTIONS TO AN INITIAL PROFFERED PERMIT REASONS FOR APPEAL OR OBJECTIONS: (Describe your reasons for appealing the decision or your objections to an initial proffered permit in clear concise statements. You may attach additional information to this form to clarify where your reasons or objections are addressed in the administrative record.) ADDITIONAL INFORMATION: The appeal is limited to a review of the administrative record, the Corps memorandum for the record of the appeal conference or meeting, and any supplemental information that the review officer has determined is needed to clarify the administrative record. Neither the appellant nor the Corps may add new information or analyses to the record. However, you may provide additional information to clarify the location of information that is already in the administrative record. POINT OF CONTACT FOR QUESTIONS OR INFORMATION: If you have questions regarding this decision and/or the appeal process you may contact: Regulatory Branch Chicago District Corps of Engineers 231 South LaSalle Street, Suite 1500 Chicago, IL 60604-1437 Phone: (312) 846-5530 Fax: (312) 353-4110 If you only have questions regarding the appeal process you may also contact: Jacob Siegrist Regulatory Appeals Review Officer US Army Corps of Engineers Great Lakes and Ohio River Division 550 Main Street, Room 10524 Cincinnati, Ohio 45202-3222 Phone: (513) 684-2699 Fax: (513) 684-2460 RIGHT OF ENTRY: Your signature below grants the right of entry to Corps of Commanders personnel, and any government consultants, to conduct investigations of the project site during the course of the appeal process. You will be provided a 15-day notice of any site investigation, and will have the opportunity to participate in all site investigations. ______________ _________________ Signature of appellant or agent. Date: Telephone number: Page 42 1 APPROVED JURISDICTIONAL DETERMINATION FORM U.S. Army Corps of Engineers This form should be completed by following the instructions provided in Section IV of the JD Form Instructional Guidebook. SECTION I: BACKGROUND INFORMATION A. REPORT COMPLETION DATE FOR APPROVED JURISDICTIONAL DETERMINATION (JD): March 17, 2020 B. DISTRICT OFFICE, FILE NAME, AND NUMBER: Chicago District, Village of Plainfield, LRC-2018-901 C. PROJECT LOCATION AND BACKGROUND INFORMATION: Rt. 126 & Rt. 59 State: Illinois County/parish/borough: Will City: Plainfield Center coordinates of site (lat/long in degree decimal format): Lat. 41.623292°N, Long. -88.198571° W. Universal Transverse Mercator: Zone 16 Name of nearest waterbody: DuPage River Name of nearest Traditional Navigable Water (TNW) into which the aquatic resource flows: Des Plaines River Name of watershed or Hydrologic Unit Code (HUC): Des Plaines (07120004) Check if map/diagram of review area and/or potential jurisdictional areas is/are available upon request. Check if other sites (e.g., offsite mitigation sites, disposal sites, etc…) are associated with this action and are recorded on a different JD form. D. REVIEW PERFORMED FOR SITE EVALUATION (CHECK ALL THAT APPLY): Office (Desk) Determination. Date: March 17, 2020 Field Determination. Date(s): March 10, 2020 SECTION II: SUMMARY OF FINDINGS A. RHA SECTION 10 DETERMINATION OF JURISDICTION. There Are no “navigable waters of the U.S.” within Rivers and Harbors Act (RHA) jurisdiction (as defined by 33 CFR part 329) in the review area. [Required] B. CWA SECTION 404 DETERMINATION OF JURISDICTION. There Are no “waters of the U.S.” within Clean Water Act (CWA) jurisdiction (as defined by 33 CFR part 328) in the review area. [Required] 2. Non-regulated waters/wetlands (check if applicable):1 Potentially jurisdictional waters and/or wetlands were assessed within the review area and determined to be not jurisdictional. Explain: Mining Pond 1 and Mining Pond 4 are historic ponds created by mining in upland areas, and have no outlet or connection to the DuPage River, and are therefore isolated. RP2, Wetland B, Wetland C and Site 3 are all small deep isolated depressional holes left over from historic mining activities, and never fill up or spill over to the nearby mining pond, which is also isolated. Wetland D is on the shore of Mining Pond 1, which is isolated, so the wetland is also isolated. SECTION III: CWA ANALYSIS E. ISOLATED [INTERSTATE OR INTRA-STATE] WATERS, INCLUDING ISOLATED WETLANDS, THE USE, DEGRADATION OR DESTRUCTION OF WHICH COULD AFFECT INTERSTATE COMMERCE, INCLUDING ANY SUCH WATERS (CHECK ALL THAT APPLY):2 which are or could be used by interstate or foreign travelers for recreational or other purposes. from which fish or shellfish are or could be taken and sold in interstate or foreign commerce. which are or could be used for industrial purposes by industries in interstate commerce. Interstate isolated waters. Explain: . Other factors. Explain: . Identify water body and summarize rationale supporting determination: . Provide estimates for jurisdictional waters in the review area (check all that apply): Tributary waters: linear feet width (ft). Other non-wetland waters: acres. Identify type(s) of waters: . Wetlands: acres. 1 Supporting documentation is presented in Section III.F. 2 Prior to asserting or declining CWA jurisdiction based solely on this category, Corps Districts will elevate the action to Corps and EPA HQ for review consistent with the process described in the Corps/EPA Memorandum Regarding CWA Act Jurisdiction Following Rapanos. Page 43 2 F. NON-JURISDICTIONAL WATERS, INCLUDING WETLANDS (CHECK ALL THAT APPLY): If potential wetlands were assessed within the review area, these areas did not meet the criteria in the 1987 Corps of Engineers Wetland Delineation Manual and/or appropriate Regional Supplements. Review area included isolated waters with no substantial nexus to interstate (or foreign) commerce. Prior to the Jan 2001 Supreme Court decision in “SWANCC,” the review area would have been regulated based solely on the “Migratory Bird Rule” (MBR). Waters do not meet the “Significant Nexus” standard, where such a finding is required for jurisdiction. Explain: . Other: (explain, if not covered above): . Provide acreage estimates for non-jurisdictional waters in the review area, where the sole potential basis of jurisdiction is the MBR factors (i.e., presence of migratory birds, presence of endangered species, use of water for irrigated agriculture), using best professional judgment (check all that apply): Non-wetland waters (i.e., rivers, streams): linear feet width (ft). Lakes/ponds: acres. Other non-wetland waters: acres. List type of aquatic resource: . Wetlands: 13 acres. Provide acreage estimates for non-jurisdictional waters in the review area that do not meet the “Significant Nexus” standard, where such a finding is required for jurisdiction (check all that apply): Non-wetland waters (i.e., rivers, streams): linear feet, width (ft). Lakes/ponds: acres. Other non-wetland waters: acres. List type of aquatic resource: . Wetlands: acres. SECTION IV: DATA SOURCES. A. SUPPORTING DATA. Data reviewed for JD (check all that apply - checked items shall be included in case file and, where checked and requested, appropriately reference sources below): Maps, plans, plots or plat submitted by or on behalf of the applicant/consultant: USACE Approved Jurisdictional Detemination Request dated February 22, 2019, prepared by CMT, Inc.. Data sheets prepared/submitted by or on behalf of the applicant/consultant. Office concurs with data sheets/delineation report. Office does not concur with data sheets/delineation report. Data sheets prepared by the Corps: . Corps navigable waters’ study: . U.S. Geological Survey Hydrologic Atlas:Plainfield HA 228, 1966, . USGS NHD data. USGS 8 and 12 digit HUC maps. U.S. Geological Survey map(s). Cite scale & quad name: Plainfield 7.5", 1993, Pick List, Pick List, Pick List, . USDA Natural Resources Conservation Service Soil Survey. Citation: Soil Survey of Will County, Illinois (1962). National wetlands inventory map(s). Cite name: Plainfield, . State/Local wetland inventory map(s): Pick List, . FEMA/FIRM maps: . 100-year Floodplain Elevation is: (National Geodetic Vertical Datum of 1929) Photographs: Aerial (Name & Date): . or Other (Name & Date): . Previous determination(s). File no. and date of response letter: . Applicable/supporting case law: . Applicable/supporting scientific literature: . Other information (please specify): . B. ADDITIONAL COMMENTS TO SUPPORT JD: Site visit on March 10, 2020 to walk all site boundaries over 3-4 hours to check for any possible connections. Area(s) are geographically isolated. Closed isolated depressions. Area(s) do not have a hydrologic nexus. Water does not leave site. Area(s) do not have an ecological nexus. . Area(s) do not have evidence of a subsurface flow connection to a jurisdictional water. . Area(s) do not have evidence of surface overland sheet flow. . Area(s) are not located within the flood plain. . Page 44 1 APPROVED JURISDICTIONAL DETERMINATION FORM U.S. Army Corps of Engineers This form should be completed by following the instructions provided in Section IV of the JD Form Instructional Guidebook. SECTION I: BACKGROUND INFORMATION A. REPORT COMPLETION DATE FOR APPROVED JURISDICTIONAL DETERMINATION (JD): March 17, 2020 B. DISTRICT OFFICE, FILE NAME, AND NUMBER: Chicago District, Village of Plainfield, LRC-2018-901 C. PROJECT LOCATION AND BACKGROUND INFORMATION: Rt. 126 & Rt. 59 State: Illinois County/parish/borough: Will City: Plainfield Center coordinates of site (lat/long in degree decimal format): Lat. 41.623292°N, Long. -88.198571° W. Universal Transverse Mercator: Zone 16 Name of nearest waterbody: DuPage River Name of nearest Traditional Navigable Water (TNW) into which the aquatic resource flows: Des Plaines River Name of watershed or Hydrologic Unit Code (HUC): Des Plaines (07120004) Check if map/diagram of review area and/or potential jurisdictional areas is/are available upon request. Check if other sites (e.g., offsite mitigation sites, disposal sites, etc…) are associated with this action and are recorded on a different JD form. D. REVIEW PERFORMED FOR SITE EVALUATION (CHECK ALL THAT APPLY): Office (Desk) Determination. Date: March 17, 2020 Field Determination. Date(s): March 10, 2020 SECTION II: SUMMARY OF FINDINGS A. RHA SECTION 10 DETERMINATION OF JURISDICTION. There Are no “navigable waters of the U.S.” within Rivers and Harbors Act (RHA) jurisdiction (as defined by 33 CFR part 329) in the review area. [Required] B. CWA SECTION 404 DETERMINATION OF JURISDICTION. There Are no “waters of the U.S.” within Clean Water Act (CWA) jurisdiction (as defined by 33 CFR part 328) in the review area. [Required] 2. Non-regulated waters/wetlands (check if applicable):1 Potentially jurisdictional waters and/or wetlands were assessed within the review area and determined to be not jurisdictional. Explain: Site 2 is a man-made scrape on a slope that impounds water when it rains. RP1 is a man-made retention pond in dry land for the storage unit company. RD1 & RD2 are upland roadside ditches. The Gully is an erosional cut through a farm field from parking lot run-off. SECTION III: CWA ANALYSIS F. NON-JURISDICTIONAL WATERS, INCLUDING WETLANDS (CHECK ALL THAT APPLY): If potential wetlands were assessed within the review area, these areas did not meet the criteria in the 1987 Corps of Engineers Wetland Delineation Manual and/or appropriate Regional Supplements. Other: (explain, if not covered above): . SECTION IV: DATA SOURCES. A. SUPPORTING DATA. Data reviewed for JD (check all that apply - checked items shall be included in case file and, where checked and requested, appropriately reference sources below): Maps, plans, plots or plat submitted by or on behalf of the applicant/consultant: Approved Jurisdictional Determination Request dated February 22, 2019, prepared by CMT, Inc. Data sheets prepared/submitted by or on behalf of the applicant/consultant. Office concurs with data sheets/delineation report. Office does not concur with data sheets/delineation report. Data sheets prepared by the Corps: . 1 Supporting documentation is presented in Section III.F. Page 45 2 Corps navigable waters’ study: . U.S. Geological Survey Hydrologic Atlas:Plainfield HA 228, 1966, . USGS NHD data. USGS 8 and 12 digit HUC maps. U.S. Geological Survey map(s). Cite scale & quad name: Plainfield 7.5", 1993, Pick List, Pick List, Pick List, . USDA Natural Resources Conservation Service Soil Survey. Citation: Soil Survey of Will County, Illinois (1962). National wetlands inventory map(s). Cite name: Plainfield, . State/Local wetland inventory map(s): Pick List, . FEMA/FIRM maps: . 100-year Floodplain Elevation is: (National Geodetic Vertical Datum of 1929) Photographs: Aerial (Name & Date): . or Other (Name & Date): . Previous determination(s). File no. and date of response letter: . Applicable/supporting case law: . Applicable/supporting scientific literature: . Other information (please specify): . B. ADDITIONAL COMMENTS TO SUPPORT JD: Site visit on March 10, 2020 to walk entire site over 3-4 hours. Areas are ditches (check all that apply): RD1 & RD2. Non-tidal drainage and irrigation ditches excavated on dry land (51 FR 41217, Nov. 13, 1986). . Ditches (including roadside ditches) excavated wholly in and draining only uplands and that do not carry a relatively permanent flow of water (USACE JD Form Instructional Guidebook 5/30/2007). . Ditches that do not have a relatively permanent flow into waters of the U.S. or between two (or more) waters of the U.S. (USACE JD Form Instructional Guidebook 5/30/2007). . Area(s) are artificial waters created in upland or dry land: RP1 & Site 2. Artificially irrigated areas which would revert to upland if the irrigation ceased (51 FR 41217, Nov. 13, 1986). . Artificial lakes or ponds created by excavating and/or diking dry land to collect and retain water and which are used exclusively for such purposes as stock watering, irrigation, settling basins, or rice growing (51 FR 41217, Nov. 13, 1986). . Artificial reflecting or swimming pools or other small ornamental bodies of water created by excavating and/or diking dry land to retain water for primarily aesthetic reasons (51 FR 41217, Nov. 13, 1986). . Waterfilled depressions created in dry land incidental to construction activity and pits excavated in dry land for the purpose of obtaining fill, sand, or gravel unless and until the construction or excavation operation is abandoned and the resulting body of water meets the definition of waters of the United States (51 FR 41217, Nov. 13, 1986). Site 2. Waste treatment systems, including treatment ponds or lagoons designed to meet the requirements of the Clean Water Act (other than cooling ponds as defined in 40 CFR 423.11(m) which also meet criteria of this definition) (33 CFR 328.3 (a)). RP1. Area(s) are swales (USACE JD Form Instructional Guidebook 5/30/2007). . Area(s) are erosional features (including gullies) (USACE JD Form Instructional Guidebook 5/30/2007). Gully. Area(s) are prior converted cropland (33 CFR 328.3(a)(8)). . Area(s) are uplands. . Other: . Page 46 1 APPROVED JURISDICTIONAL DETERMINATION FORM U.S. Army Corps of Engineers SECTION I: BACKGROUND INFORMATION A. REPORT COMPLETION DATE FOR APPROVED JURISDICTIONAL DETERMINATION (JD): March 17, 2020 B. DISTRICT OFFICE, FILE NAME, AND NUMBER: Chicago District, Village of Plainfield, LRC-2018-901 C. PROJECT LOCATION AND BACKGROUND INFORMATION: Rt. 126 & Rt. 59 State: Illinois County/parish/borough: Will City: Plainfield Center coordinates of site (lat/long in degree decimal format): Lat. 41.623292°N, Long. -88.198571° W. Universal Transverse Mercator: Zone 16 Name of nearest waterbody: DuPage River Name of nearest Traditional Navigable Water (TNW) into which the aquatic resource flows: Des Plaines River Name of watershed or Hydrologic Unit Code (HUC): Des Plaines (07120004) Check if map/diagram of review area and/or potential jurisdictional areas is/are available upon request. Check if other sites (e.g., offsite mitigation sites, disposal sites, etc…) are associated with this action and are recorded on a different JD form. D. REVIEW PERFORMED FOR SITE EVALUATION (CHECK ALL THAT APPLY): Office (Desk) Determination. Date: March 17, 2020 Field Determination. Date(s): March 10, 2020 SECTION II: SUMMARY OF FINDINGS A. RHA SECTION 10 DETERMINATION OF JURISDICTION. There Are no “navigable waters of the U.S.” within Rivers and Harbors Act (RHA) jurisdiction (as defined by 33 CFR part 329) in the review area. [Required] Waters subject to the ebb and flow of the tide. Waters are presently used, or have been used in the past, or may be susceptible for use to transport interstate or foreign commerce. Explain: Defined in People of State of Ill. ex rel. Scott v. Hoffman, No. P-CIV-76-45, slip op. at 7 (S.D.Ill. Jan. 20, 1979). B. CWA SECTION 404 DETERMINATION OF JURISDICTION. There Are “waters of the U.S.” within Clean Water Act (CWA) jurisdiction (as defined by 33 CFR part 328) in the review area. [Required] 1. Waters of the U.S. a. Indicate presence of waters of U.S. in review area (check all that apply): 1 TNWs, including territorial seas Wetlands adjacent to TNWs Relatively permanent waters2 (RPWs) that flow directly or indirectly into TNWs Wetlands directly abutting RPWs that flow directly or indirectly into TNWs b. Identify (estimate) size of waters of the U.S. in the review area: Non-wetland waters: linear feet: width (ft) and/or 7.64 acres. Wetlands: 13.92 acres. c. Limits (boundaries) of jurisdiction based on: Midwest Supplement Elevation of established OHWM (if known): . SECTION III: CWA ANALYSIS A. TNWs AND WETLANDS ADJACENT TO TNWs The agencies will assert jurisdiction over TNWs and wetlands adjacent to TNWs. If the aquatic resource is a TNW, complete Section III.A.1 and Section III.D.1. only; if the aquatic resource is a wetland adjacent to a TNW, complete Sections III.A.1 and 2 and Section III.D.1.; otherwise, see Section III.B below. 1. TNW Identify TNW: Pick List. Summarize rationale supporting determination: As defined in People of State of Ill. ex rel. Scott v. Hoffman, No. P-CIV-76-45, slip op. at 7 (S.D.Ill. Jan. 20, 1979). 2. Wetlandadjacent to TNW Summarize rationale supporting conclusion that wetland is “adjacent”: . 1 Boxes checked below shall be supported by completing the appropriate sections in Section III below. 2 For purposes of this form, an RPW is defined as a tributary that is not a TNW and that typically flows year-round or has continuous flow at least “seasonally” (e.g., typically 3 months). Page 47 2 D. DETERMINATIONS OF JURISDICTIONAL FINDINGS. THE SUBJECT WATERS/WETLANDS ARE (CHECK ALL THAT APPLY): 1. TNWs and Adjacent Wetlands. Check all that apply and provide size estimates in review area: TNWs: linear feet width (ft), Or, acres. Wetlands adjacent to TNWs: acres. 2. RPWs that flow directly or indirectly into TNWs. Tributaries of TNWs where tributaries typically flow year-round are jurisdictional. Provide data and rationale indicating that tributary is perennial: The DuPage River is a direct tributary of the Des Plaines River, and has documented year-round flow. Lily Cache Creek is a direct tributary of the DuPage River, and had year-round flow based on aerials and size. The unnamed tributary of the DuPage River has year-round flow based on aerials and size of tributary. Tributaries of TNW where tributaries have continuous flow “seasonally” (e.g., typically three months each year) are jurisdictional. Data supporting this conclusion is provided at Section III.B. Provide rationale indicating that tributary flows seasonally: . Provide estimates for jurisdictional waters in the review area (check all that apply): Tributary waters: 10000 linear feet 20 width (ft). Other non-wetland waters: acres. Identify type(s) of waters: . 4. Wetlandsdirectly abutting an RPW that flow directly or indirectly into TNWs. Wetlands directly abut RPW and thus are jurisdictional as adjacent wetlands. Wetlands directly abutting an RPW where tributaries typically flow year-round. Provide data and rationale indicating that tributary is perennial in Section III.D.2, above. Provide rationale indicating that wetland is directly abutting an RPW: Site 1 is bisected by the DuPage River tributary. Pond 1/Wetland A is immediately adjacent to the DuPage River and the wetland portion abuts the river. Mining Pond 2 has a direct outlet/connection to Lily Cache Creek; and Mining Pond 3 outlets via a tributary to Lily Cache Creek. Wetland E is associated with Mining Pond 2, which abuts an RPW tributary to Lily Cache Creek. Wetlands directly abutting an RPW where tributaries typically flow “seasonally.” Provide data indicating that tributary is seasonal in Section III.B and rationale in Section III.D.2, above. Provide rationale indicating that wetland is directly abutting an RPW: . Provide acreage estimates for jurisdictional wetlands in the review area: 17.77 acres. SECTION IV: DATA SOURCES. A. SUPPORTING DATA. Data reviewed for JD (check all that apply - checked items shall be included in case file and, where checked and requested, appropriately reference sources below): Maps, plans, plots or plat submitted by or on behalf of the applicant/consultant: USACE Approved Jurisdictional Determination Request dated February 22, 2019, prepared by CMT, Inc.. Data sheets prepared/submitted by or on behalf of the applicant/consultant. Office concurs with data sheets/delineation report. Office does not concur with data sheets/delineation report. Data sheets prepared by the Corps: . Corps navigable waters’ study: . U.S. Geological Survey Hydrologic Atlas:Plainfield HA 228, 1966, . USGS NHD data. USGS 8 and 12 digit HUC maps. U.S. Geological Survey map(s). Cite scale & quad name: Plainfield 7.5", 1993, Pick List, Pick List, Pick List, . USDA Natural Resources Conservation Service Soil Survey. Citation: Soil Survey of Will County, Illinois (1962). National wetlands inventory map(s). Cite name: Plainfield, . State/Local wetland inventory map(s): Pick List, . FEMA/FIRM maps: . 100-year Floodplain Elevation is: (National Geodetic Vertical Datum of 1929) Photographs: Aerial (Name & Date): . or Other (Name & Date): . Previous determination(s). File no. and date of response letter: . Applicable/supporting case law: People of State of Ill. ex rel. Scott v. Hoffman, No. P-CIV-76-45, (S.D.Ill. Jan. 20, 1979) Applicable/supporting scientific literature: . Other information (please specify): . B. ADDITIONAL COMMENTS TO SUPPORT JD: Site visit on March 10, 2020 to walk entire site over 3-4 hours and locate all jurisdictional conections. Page 48 :HWODQG$DuPage River : 6LWH 6LWH : : 5' 5' 53 3RQG 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES MAP (1 of 2))HHWService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community$GGHQGXP'(65/LPLWV )LQDO $GGHQGXP'(65/LPLWV 3URSRVHG :HWODQGV &07 :HWODQG'DWD3RLQW &07 8SODQG'DWD3RLQW &07 6WUHDP2+:0 &07 H&H Waters (2016)'LWFK0LQLQJ3RQG3RQG5HWHQWLRQSRQG6WUHDP:HWODQG*XOO\ DVGHILQHGLQWKH+ +UHSRUWPage 49 DuPage River:HWODQG%:HWODQG&:HWODQG':HWODQG(Lake PlainfieldFletcher LakeMain Lake0LQLQJ3RQG 0LQLQJ3RQG 0LQLQJ3RQG 0LQLQJ3RQG 6LWH 53 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES MAP (2 of 2))HHWService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community$GGHQGXP'(65/LPLWV )LQDO $GGHQGXP'(65/LPLWV 3URSRVHG :HWODQGV &07 :HWODQG'DWD3RLQW &07 8SODQG'DWD3RLQW &07 6WUHDP2+:0 &07 H&H Waters (2016)*'LWFK0LQLQJ3RQG3RQG5HWHQWLRQSRQG6WUHDP:HWODQG DVGHILQHGLQWKH+ +UHSRUWPage 50 Page 51 Page 52 Page 53 Page 54 Page 55 Page 56 Page 57 &21&(378$/&203(16$7,213/$1 )/(7&+(5/$.( 352-(&71$0( 3/$,1),(/'5'675((7(;7(16,21 12)3 6(48(1&(12 352-(&7/2&$7,21 3/$,1),(/':,//&2817<,//,12,6 )(%58$5< 35(3$5(')25 9,//$*(2)3/$,1),(/' '(3$570(172)38%/,&:25.6 &2,/3/86'5,9( 3/$,1),(/',/ 35(3$5('%< &5$:)25'0853+< 7,//<,1& 1&200216'5,9(68,7( $8525$,/ Page 58 TABLE OF CONTENTS ,QWURGXFWLRQ 3URMHFW%DFNJURXQG /RFDWLRQ 'HVFULSWLRQ 5HVSRQVLEOH2IILFHIRU,PSOHPHQWDWLRQRI:HWODQG&RPSHQVDWLRQ3ODQ :HWODQG6XUYH\ :HWODQG,PSDFWV 'HVFULSWLRQRI$OWHUQDWLYH$FWLRQV&RQVLGHUHG%XW1RW6HOHFWHG $OWHUQDWLYHV1RW6HOHFWHG 3UHIHUUHG$OWHUQDWLYH 3URSRVHG:HWODQGV&RPSHQVDWLRQ 5HSODFHPHQW6LWH /RFDWLRQ ([LVWLQJ+\GURORJ\ ([LVWLQJ6RLOV ([LVWLQJ9HJHWDWLRQ %LRORJ\ 'HVFULSWLRQ &RPSHQVDWLRQ*RDOV :HWODQGV7R%H&UHDWHG 3UHH[LVWLQJ:HWODQG&UHGLWV 'HVFULSWLRQRI:RUN 6LWH3URWHFWLRQDQG0DLQWHQDQFH $SSHQGL[$±0DSSLQJ $SSHQGL[%±)OHWFKHU/DNH,PSDFW*UDGLQJDQG/DQGVFDSH3ODQV $SSHQGL[&±:HWODQG'HOLQHDWLRQ5HSRUW $SSHQGL['±$SSURYHG-XULVGLFWLRQDO'HWHUPLQDWLRQ $SSHQGL[(±*HRWHFKQLFDO5HSRUW $SSHQGL[)±3KRWRJUDSKV Page 59 2 INTRODUCTION 7KLV&RQFHSWXDO:HWODQG&RPSHQVDWLRQ3ODQKDVEHHQSUHSDUHGWRVXSSRUWWKH,OOLQRLV'HSDUWPHQW RI7UDQVSRUWDWLRQ ,'27 %XUHDXRI'HVLJQDQG(QYLURQPHQW %'( :HWODQG,PSDFW(YDOXDWLRQ :,( DQGFRPSOLDQFHZLWKWKH,QWHUDJHQF\:HWODQG3ROLF\$FW ,:3$ IRUWKHSURSRVHGZHWODQG LPSDFWVIRUWKHUG6WUHHW([WHQVLRQSURMHFW7KLVSODQKDVEHHQSUHSDUHGLQDFFRUGDQFHZLWK 6HFWLRQRIWKH,'27%'(0DQXDODQGWKH,'27:HWODQGV$FWLRQ3ODQ 7KHSODQQHGFRPSHQVDWRU\PLWLJDWLRQIRUWKHLPSDFWVWRWKHLVRODWHGZHWODQGZLOOLQFOXGHWKH IROORZLQJFRPSRQHQWV x 2QVLWHZHWODQGFUHDWLRQ )OHWFKHU/DNH x 3XUFKDVHRIZHWODQGPLWLJDWLRQEDQNFUHGLWV 2QVLWHZHWODQGFRPSHQVDWLRQLVSODQQHGWRPLWLJDWHIRUDSRUWLRQRILPSDFWVWR)OHWFKHU/DNHDVD UHVXOWRIWKHSURMHFW)OHWFKHU/DNHLVRZQHGE\%DVVDQG*LOO&OXEDGMDFHQWWRWKHSODQQHGUG 6WUHHWLPSURYHPHQWV3URMHFWLQIRUPDWLRQZHWODQGLPSDFWVDQGWKHFRQFHSWXDOFRPSHQVDWLRQSODQ DUHGHWDLOHGEHORZ PROJECT BACKGROUND LOCATION 7KHSURSRVHGUG6WUHHW([WHQVLRQSURMHFWLVORFDWHGZLWKLQWKH9LOODJHRI3ODLQILHOG:LOO&RXQW\ ,OOLQRLVDQGH[WHQGVIURP,OOLQRLV ,/ DQG86UG6WUHHWHDVWWR,OOLQRLV ,/ DQG UG6WUHHW/RFDWLRQPDSSLQJLVSURYLGHGLQ$SSHQGL[$ DESCRIPTION 7KHSURSRVHGSURMHFWLVDQH[WHQVLRQRIUG6WUHHWIURP,/5RXWH WR,/5RXWH$QHZ IRRWEULGJHRYHUWKH'X3DJH5LYHUH[WHQVLRQVWRERWKVLGHVRIWKH:HVW1RUPDQ'UDLQFXOYHUWXQGHU H[LVWLQJUG6WUHHWDQGDQHZHPEDQNPHQWLQ)OHWFKHU/DNHDUHUHTXLUHGIRUWKHQHZURDGZD\WR FURVVH[LVWLQJZDWHUUHVRXUFHV,PSURYHPHQWVWRWKHLQWHUVHFWLRQVRIUG6WUHHWDW,/5RXWH 1DSHUYLOOH5RDGDQG,/5RXWHZLOOEHUHTXLUHGIRUWKHSURSRVHGURDGZD\FURVVVHFWLRQ7KH LQWHUVHFWLRQLPSURYHPHQWVZLOOFRQVLVWRIUHSODFLQJH[LVWLQJRULQVWDOOLQJQHZWUDIILFVLJQDOV6WRUP VHZHUVZLOOEHLQVWDOOHGWRFDUU\VWRUPZDWHUUXQRIIWRQHZEDVLQVZLWKLQWKHSURMHFWDUHD$Q LQILOWUDWLRQEDVLQZLOOEHLQVWDOOHGDWWKHHDVWFRUQHURIUG6WUHHWDQG,/5RXWHWRFDSWXUH VWRUPZDWHULQWKHHDVWHUQTXDUWHURIWKHSURMHFW7KHUHPDLQLQJSRUWLRQRIWKHURDGZD\ZLOOGUDLQLQWR VWRUPVHZHUVWKDWIORZWKURXJKK\GURG\QDPLFVHSDUDWRUVEHIRUHRXWOHWWLQJQHDUWKH'X3DJH5LYHURU :HVW1RUPDQ'UDLQ)HQFLQJZLOOEHSODFHGRQWKHQRUWKVLGHRIUG6WUHHWDORQJ)OHWFKHU/DNHWR KHOSUHGXFHWKHDPRXQWRIURDGVDOWVDQGVQRZDUHGHSRVLWHGLQWRWKHODNHE\VQRZUHPRYDO RSHUDWLRQV $GGLWLRQDOFRPSRQHQWVRIWKHSURMHFWLQFOXGHDPXOWLXVHSDWKDORQJWKH&RP(GFRUULGRUH[WHQVLRQ RIWKHH[LVWLQJ'X3DJH5LYHU7UDLOXQGHUWKHSURSRVHGEULGJHWRFRQQHFWWRWKHVLGHZDONV$'$ FRPSOLDQWFURVVLQJVDQGRWKHUUHTXLUHGLQIUDVWUXFWXUHLPSURYHPHQWV)ORRGSODLQFRPSHQVDWRU\ VWRUDJHDUHDVZLOOEHFUHDWHGDORQJWKH'X3DJH5LYHUFRUULGRUDQGDORQJ:HVW1RUPDQ'UDLQWR SURYLGHDGGLWLRQDOIORRGVWRUDJHZLWKLQWKHSURMHFW$GGLWLRQDORSHQZDWHUDUHDZLOOEHFRQVWUXFWHGLQ Page 60 3 )OHWFKHU/DNHDVIORRGSODLQFRPSHQVDWRU\VWRUDJHDQGZHWODQGFRPSHQVDWLRQZLWKILVKKDELWDW LPSURYHPHQWVWRRIIVHWVRPHRIWKHLPSDFWRIILOOLQJDSRUWLRQRI)OHWFKHU/DNHIRUWKHURDGZD\ HPEDQNPHQW,PSDFWVWR)OHWFKHU/DNHDQGWKHSURSRVHGRQVLWHZHWODQGFRPSHQVDWLRQDUH GHVFULEHGLQGHWDLOEHORZ 7RUHGXFHWKHLPSDFWWRWUDIILFGXULQJFRQVWUXFWLRQDQGGXHWRWKHVL]HRIWKHSURMHFWFRQVWUXFWLRQLV SURSRVHGLQIRXUVWDJHVDQGZLOOXWLOL]HYDULRXVWUDIILFSDWWHUQV3UH6WDJH&RQVWUXFWLRQZLOOFRQVLVWRI GHPROLWLRQDQGFOHDULQJDFWLYLWLHVLQVWDOOLQJWHPSRUDU\WUDIILFVLJQDOVDQGURDGZD\LQVWDOOLQJ6(6& PHDVXUHVDQGLQVWDOOLQJKDXOURDGVWRDFFHVVWKHVLWH6WDJHVDQGIRFXVRQWKHFRQVWUXFWLRQRI WKHURDGZD\LPSURYHPHQWVDQGEULGJHVWUXFWXUHV6WDJHLQFOXGHVVHWWLQJWKHEULGJH VXSHUVWUXFWXUHLQVWDOOLQJWKHSHUPDQHQWWUDIILFVLJQDOVDQGHTXLSPHQWSDYLQJWKHELNHSDWKDQGILQDO ODQGVFDSLQJDQGUHVWRUDWLRQ 7KHSURMHFWLVDQWLFLSDWHGWREHOHWWKURXJK,'27LQ1RYHPEHUZLWKFRQVWUXFWLRQVWDUWLQJLQHDUO\ &RQVWUXFWLRQLVDQWLFLSDWHGWREHILQLVKHGE\WKHHQGRI RESPONSIBLE OFFICE FOR IMPLEMENTATION OF WETLAND COMPENSATION PLAN 7KH9LOODJHRI3ODLQILHOGZLOOEHUHVSRQVLEOHIRULPSOHPHQWLQJWKHZHWODQGFRPSHQVDWLRQSODQDQGZLOO FRRUGLQDWHZLWK,'27'LVWULFW%XUHDXRI/RFDO5RDGVWKURXJKRXWLPSOHPHQWDWLRQ 9LOODJHRI3ODLQILHOG 0U6FRWW7KUHHZLWW 'HSDUWPHQWRI3XEOLF:RUNV &RLO3OXV'ULYH 3ODLQILHOG,/ VWKUHHZLWW#JRSODLQILHOGFRP WETLAND SURVEY :HWODQGVXUYH\VRIWKHSURMHFWVLWHZHUHLQLWLDOO\FRPSOHWHGE\+XII +XII + + LQZLWKLQWKH RULJLQDOVWXG\DUHDOLPLWV,Q &07,QF &07 FRPSOHWHGDGGLWLRQDOZHWODQGVXUYH\VLQWKH H[SDQGHGVWXG\DUHD7KHZHWODQGGHOLQHDWLRQUHSRUWVDUHSURYLGHGLQ$SSHQGL[& &07,QF $OH[DQGUD=HOOHV&HUWLILHG(FRORJLVW 1&RPPRQV'ULYH6XLWH $XURUD,/ D]HOOHV#FPWHQJUFRP 5ROH 3URMHFWHQYLURQPHQWDOVFLHQWLVW 7KH+ +ZHWODQGVXUYH\LGHQWLILHGWKUHHZHWODQGVWKUHH:DWHUVRIWKH86RQHSRQG DGMDFHQWWRWKH'X3DJH5LYHUIRXUPLQLQJSRQGVWZRFRQVWUXFWHGVWRUPZDWHUVWRUDJHDQGWZR FRQVWUXFWHGFRQYH\DQFHIHDWXUHV7KH&07 VXUYH\LGHQWLILHGDQDGGLWLRQDOILYHZHWODQGVZLWKLQ WKHH[SDQGHGVWXG\DUHDDQGFRQILUPHGWKHSUHYLRXVO\LGHQWLILHGZDWHUUHVRXUFHVLGHQWLILHGE\+ + Page 61 4 $Q$SSURYHG-XULVGLFWLRQDO'HWHUPLQDWLRQ $-' ZDVFRPSOHWHGE\WKH86$UP\&RUSVRI (QJLQHHUV 86$&( RQ$SULO 6LWH3RQG0LQLQJ3RQGVDQGDQG:HWODQGV $DQG(ZHUHGHWHUPLQHGWREHXQGHUWKHMXULVGLFWLRQRIWKH86$&(6LWH5HWHQWLRQ3RQG 0LQLQJ3RQGV )OHWFKHU/DNH DQGDQG:HWODQGV%&DQG'ZHUHGHWHUPLQHGWREHLVRODWHG 6LWH5HWHQWLRQ3RQG5RDGVLGH'LWFKHVDQGDQG*XOO\ZHUHGHWHUPLQHGWREHH[HPSWIURP )HGHUDOUHJXODWLRQ7KH$-'LVSURYLGHGLQ$SSHQGL[' FLETCHER LAKE IMPACTS 7KHSURMHFWZLOOSHUPDQHQWO\LPSDFWDWRWDORI DFUHVRI)OHWFKHU/DNHDQLVRODWHGVXUIDFHZDWHU IHDWXUHDVVXPPDUL]HGLQ7DEOH$OOZHWODQGVDUHORFDWHGZLWKLQWKH'HV3ODLQHV5LYHUDQG/DNH 0LFKLJDQ7ULEXWDULHVGUDLQDJHEDVLQ Table 1. Fletcher Lake Impacts and Proposed Mitigation Site Type USACE Jurisdiction Impact Area (ac) Mitigation Ratio* On-Site Compensation In-Basin Mitigation Credit Purchase Fletcher Lake Pond No 1.807 1.5:1 2.71 - 0.691 4:1 0 2.765 Total 2.498 -2.71 2.765 DESCRIPTION OF ALTERNATIVE ACTIONS CONSIDERED BUT NOT SELECTED 'XULQJWKHLQLWLDOGHVLJQVWXG\WKHRULJLQDOSUHIHUUHGDOLJQPHQWLQFOXGHGWKHXVHRIWKHH[LVWLQJ &RP(GWUDQVPLVVLRQFRUULGRUKRZHYHUEDVHGXSRQIXUWKHUQHJRWLDWLRQVZLWK&RP(GLWZDV GHWHUPLQHGLQWKDWWKLVDOLJQPHQWZDVQRWIHDVLEOHGXHWRIXWXUHWUDQVPLVVLRQDQGGLVWULEXWLRQ QHHGV)RUWKLVUHDVRQWKHRULJLQDOSUHIHUUHGDOLJQPHQWXWLOL]LQJWKH&RP(GFRUULGRUZDVQRWFDUULHG IRUZDUG$IWHUDQDOLJQPHQWDOWHUQDWLYHVDQDO\VLVLWZDVGHWHUPLQHGWRDGMXVWWKHDOLJQPHQWQRUWKRI WKH&RP(GFRUULGRU7KLVDOLJQPHQWVKLIWSODFHGWKHSURSRVHGDOLJQPHQWIHHWQRUWKRIWKH QRUWKHUQSURSHUW\OLQHRI&RP(GDQGLQWRWKH%DVVDQG*LOO&OXEDSULYDWHKXQWLQJDQGILVKLQJFOXE 7KHLPSURYHPHQWVZRXOGSULPDULO\LPSDFW)OHWFKHU/DNHRQHRIWKHFOXE¶VILYHODNHVZKLOH VLJQLILFDQWO\GHFUHDVLQJWKHSURMHFW¶VRYHUDOOZHWODQGLPSDFWV ,QDGGLWLRQWRWKH1R$FWLRQ$OWHUQDWLYHIRXUDOWHUQDWLYHVZLWKLPSDFWVWR)OHWFKHU/DNHZHUH FRQVLGHUHGDVGHVFULEHGEHORZ ALTERNATIVES NOT SELECTED The No-Action AlternativeLVQRWIHDVLEOHEHFDXVHLWZLOOQRWPHHWWKHSXUSRVHDQGQHHGRIWKH SURMHFW7KLVDOWHUQDWLYHZLOOQRWLPSURYHPRELOLW\DQGVDIHW\WKURXJKWKHGRZQWRZQFRUULGRULQWKH 9LOODJHRI3ODLQILHOGE\UHGXFLQJWKHYHKLFXODUWUDYHOWLPHDQGWKHQXPEHURIFUDVKHVWKURXJKWKH FRUULGRU)RUWKLVUHDVRQWKLVDOWHUQDWLYHZDVQRWVHOHFWHG Page 62 5 Alternative 1 (Bridge):$IRRWEULGJHVSDQQLQJ)OHWFKHU/DNHZDVFRQVLGHUHG:KLOHLWZRXOG PHHWWKHSXUSRVHDQGQHHGRIWKHSURMHFWLWZDVQRWVHOHFWHGDVLWZRXOGFRVWDQHVWLPDWHGWR PLOOLRQWRFRQVWUXFW Alternative 2 (Retaining Wall):7KLVDOWHUQDWLYHLQYROYHGFRQVWUXFWLRQRIDUHWDLQLQJZDOOWKHOHQJWK RI)OHWFKHU/DNHDQGZRXOGPHHWWKHSXUSRVHDQGQHHGRIWKHSURMHFW%DVHGXSRQERULQJVWKHZDOO ZRXOGQHHGWREHFRQVWUXFWHGWRWKHVKDOORZEHGURFNDQGXQGHUXSZDUGVRIIHHWRIZDWHU)DWDO IODZVRIWKLVDOWHUQDWLYHLQFOXGHGWKHFRQVWUXFWDELOLW\LQDODNHZLWKVKDOORZEHGURFN GULOOLQJLQWRURFN DQGWKHDVVRFLDWHGH[FHVVLYHFRVW)RUWKLVUHDVRQWKLVDOWHUQDWLYHZDVQRWVHOHFWHG Alternative 3 (Structural Fill):7KLVDOWHUQDWLYHZRXOGLQFRUSRUDWHILOOLQJRIWKHODNHZLWKVWUXFWXUDOILOO WKDWWKHURDGZD\ZRXOGEHFRQVWUXFWHGXSRQDQGZRXOGPHHWWKHSXUSRVHDQGQHHGRIWKHSURMHFW 7KLVDOWHUQDWLYHVXEVWDQWLDOO\LPSDFWV)OHWFKHU/DNHVXFKWKDWDGMDFHQWUHVLGHQFHVZRXOGEH LPSDFWHGWRSURYLGHDGHTXDWHFRPSHQVDWRU\VWRUDJH IRUWKLVUHDVRQWKLVDOWHUQDWLYHZDVQRW VHOHFWHG PREFERRED ALTERNATIVE Alternative 4 (Combination Structural Fill and Retaining Wall)PHHWVWKHSXUSRVHDQGQHHGRI WKHSURMHFWDQGZDVVHOHFWHGDVWKHSUHIHUUHGDOWHUQDWLYH7KLVDOWHUQDWLYHZRXOGFRPELQH $OWHUQDWLYHVDQG6WUXFWXUDOILOOZRXOGEHGHVLJQHGWRIUHHERDUGDERYHWKHIORRGHOHYDWLRQVDQG UHWDLQLQJZDOOZRXOGEHEXLOWDWRSRIWKHILOO7KLVDOWHUQDWLYHSURYLGHVGHFUHDVHGODNHLPSDFW FRPSDUHGWR$OWHUQDWLYHDQGFRPSHQVDWRU\VWRUDJHFRXOGEHREWDLQHGZLWKRXWLPSDFWLQJDGMDFHQW SURSHUWLHV$GGLWLRQDOO\SURMHFWUHILQHPHQWLQFOXGLQJFRQVWUXFWLRQRIWKHPXOWLXVHSDWKZLWKLQWKH &RP(GFRUULGRUURDGZD\GHVLJQH[FHSWLRQVIURP,'27DVLJKWVFUHHQIHQFHDORQJ)OHWFKHU/DNH DQGVQRZVWRUDJHEHWZHHQWKHVLJKWVFUHHQIHQFHDQGURDGZD\IXUWKHUUHGXFHGLPSDFWVWR)OHWFKHU /DNH$IWHUFRRUGLQDWLRQZLWKWKH%DVVDQG*LOO&OXEWKH&OXELQGLFDWHGWKHLUSUHIHUHQFHIRU $OWHUQDWLYH%DVHGXSRQDFRPELQDWLRQRIFRVWGHFUHDVHGHQYLURQPHQWDOLPSDFWVDQGUHVLGHQWLDO GLVSODFHPHQWVDQGLQSXWIURPWKH%DVVDQG*LOO&OXE$OWHUQDWLYHZDVVHOHFWHGDVWKHSUHIHUUHG DOWHUQDWLYH PROPOSED WETLANDS COMPENSATION REPLACEMENT SITE LOCATION 7KHUHSODFHPHQWVLWHORFDWLRQIRULPSDFWVWR)OHWFKHU/DNHLVORFDWHGDGMDFHQWWRWKHLPSDFWDUHD ZLWKLQWKHVRXWKZHVWDQGVRXWKHDVWFRUQHUVRI)OHWFKHU/DNHZLWKLQWKH%DVVDQG*LOO&OXE 3DUFHO 117( ZLWKLQWKH6RXWKHDVW4XDUWHURI6HFWLRQDQGSDUWRIWKH6RXWKZHVW4XDUWHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH (DVWRIWKH7KLUG3ULQFLSDO0HULGLDQLQ:LOO&RXQW\ 7KHFXUUHQWODQGRZQHULVWKH%DVVDQG*LOO&OXE7KHVLWHLVFXUUHQWO\DGHJUDGHGXSODQGGHFLGXRXV IRUHVWWKDWLVXVHGIRUSULYDWHUHFUHDWLRQDQGKXQWLQJ7KHVLWHLVVORSHGWRZDUGV)OHWFKHU/DNHDQG KDVDVWHHSGURSRIIDWWKHVKRUHOLQHZLWKDQHOHYDWLRQFKDQJHRIWRIHHW/DQGXVHDGMDFHQWWR WKHZHVWRIWKHZHVWHUQSRUWLRQRIWKHFRPSHQVDWLRQDUHDLVUHVLGHQWLDODQGWRWKHVRXWKLVD WUDQVPLVVLRQFRUULGRUIRU&RP(G7KHVXUURXQGLQJODQGXVHWRWKHQRUWKDQGHDVWRIWKHVLWHLVIRU Page 63 6 SULYDWHUHFUHDWLRQILVKLQJDQGKXQWLQJE\%DVVDQG*LOO&OXEPHPEHUV,/ELVHFWVWKH%DVVDQG *LOO&OXESURSHUW\ $PDSVKRZLQJWKHSURSRVHGZHWODQGUHSODFHPHQWVLWHORFDWLRQWKHOHJDOGHVFULSWLRQDQGWKHSODW PDSDUHSURYLGHGLQ$SSHQGL[$3KRWRJUDSKVRIWKHVLWHDUHSURYLGHGLQ$SSHQGL[) EXISTING HYDROLOGY ([LVWLQJK\GURORJ\LVVXSSOLHGE\VXUIDFHZDWHUUXQRIIDQGVKHHWIORZ7KHVLWHLVORFDWHGZLWKLQWKH )OHWFKHU/DNHIORRGSODLQDQGPD\H[SHULHQFHWHPSRUDU\IORRGLQJE\)OHWFKHU/DNHGXULQJKLJK SUHFLSLWDWLRQHYHQWV+\GURORJ\WR)OHWFKHU/DNHLVVXSSOLHGE\VXUIDFHZDWHUUXQRIIDQG JURXQGZDWHU1RVXUIDFHZDWHUUHVRXUFHVIORZLQWR)OHWFKHU/DNHDQGWKHUHLVQRRXWOHW)OHWFKHU /DNH¶VK\GURORJ\LVODUJHO\FRQWUROOHGE\JURXQGZDWHUHOHYDWLRQGXHWRWKHVLWHKDYLQJEHHQ SUHYLRXVO\XVHGDVDPLQLQJTXDUU\DQGKDYLQJH[SRVHGEHGURFN7KHGHHSHVWSDUWRIWKHSRQGZDV PHDVXUHGDWIHHW $VPDOODFUHLVRODWHGZHWODQG :HWODQG& LVORFDWHGZLWKLQWKHZHVWHUQSRUWLRQRIWKH FRPSHQVDWLRQVLWH7KHZHWODQGKDGPXOWLSOHSULPDU\K\GURORJ\LQGLFDWRUVLQFOXGLQJVXUIDFHZDWHURI LQFKHVDKLJKZDWHUWDEOHVDWXUDWLRQDQGVSDUVHO\YHJHWDWHGFRQFDYHVXUIDFH EXISTING SOILS 7KH:LOO&RXQW\6RLO6XUYH\PDSVWKHIROORZLQJVRLOVRQVLWH x %±:DUVDZ6LOWORDPWRSHUFHQWVORSHV x %±2UWKHQWVORDP\XQGXODWLQJ 6RLOERULQJVLQWKHFRPSHQVDWLRQVLWH (0%DQG(0% W\SLFDOO\HQFRXQWHUHGDERXWLQFKHV RIFOD\ORDPWRSVRLOVDQG\WRSVRLOXQGHUODLQE\DERXWIHHWRIVWLIIWRYHU\VWLIIFOD\DQGVLOW\FOD\ IROORZHGE\ORRVHWRPHGLXPGHQVHVDQGVDQGDQGJUDYHORUVDQG\JUDYHOH[WHQGLQJWRWKHERULQJ WHUPLQDWLRQGHSWKRIIHHW 7KHPDWHULDOVVDPSOHGDWWKHH[LVWLQJSRQGERWWRPFRQVLVWHGSUHGRPLQDWHO\RIVLOW\VDQGVDQGDQG JUDYHODQGIUDFWXUHGURFNPL[HGZLWKVLOWDQGVDQG 6RLOVPDSSLQJDQGVRLOGHVFULSWLRQVDUHSURYLGHGLQ$SSHQGL[$7KH*HRWHFKQLFDO5HSRUWLV SURYLGHGLQ$SSHQGL[( EXISTING VEGETATION & BIOLOGY 7KHH[LVWLQJYHJHWDWLRQLVDGHJUDGHGXSODQGGHFLGXRXVVHFRQGDU\IRUHVWFRPPXQLW\WKDWKDVEHHQ SUHYLRXVO\GLVWXUEHGDQGLQYDGHGE\QRQQDWLYHLonicera maackii KRQH\VXFNOH DQGRhamnus cathartica EXFNWKRUQ 'RPLQDQWWUHHVSHFLHVLQFOXGHPrunus serotina EODFNFKHUU\ Morus alba ZKLWHPXOEHUU\ Ulmus americana $PHULFDQHOP Ulmus rubra VOLSSHU\HOP DQGPopulus deltoides HDVWHUQFRWWRQZRRG :HWODQG&LVORFDWHGZLWKLQWKHFRPSHQVDWLRQVLWHDQGZDVGRPLQDWHGE\$PHULFDQHOP Ulmus americana DQGFRPPRQEXFNWKRUQ Rhamnus cathartica 7KHWRWDOPHDQ&YDOXHIRU:HWODQG&LV QDWLYHPHDQ&YDOXHLV DQGWKHWRWDO)4,LV QDWLYH)4,LV LQGLFDWLQJWKDWWKHSODQW Page 64 7 FRPPXQLW\LVFRQVLGHUHGORZTXDOLW\DQGVHYHUHO\GHJUDGHG:HWODQG&ZLOOEHFRQYHUWHGWRDQ RSHQZDWHUKDELWDWIRUFRQVWUXFWLRQRIWKH)OHWFKHU/DNHFRPSHQVDWLRQDUHD WKLVFRQYHUVLRQZLOOEH PLWLJDWHGE\SXUFKDVLQJFUHGLWVIURPDQDSSURYHGZHWODQGPLWLJDWLRQEDQN5HIHUWRWKH:HWODQG 'HOLQHDWLRQ5HSRUWLQ$SSHQGL[&IRUGHWDLOHGLQIRUPDWLRQ 7KHVLWHGRHVQRWSURYLGHTXDOLW\KDELWDWIRUSODQWDQGDQLPDOVSHFLHV5DUHSODQWVDQGDQLPDO VSHFLHVDUHQRWH[SHFWHGWREHSUHVHQWDWWKHVLWHQRUKDYHWKH\EHHQREVHUYHG DESCRIPTION COMPENSATION GOALS 7KHJRDOVRIWKLVZHWODQGFRPSHQVDWLRQDUHDVIROORZV x 5HSODFHWKHSRQGDQGRSHQZDWHUDUHDORVWE\WKHURDGZD\FRQVWUXFWLRQ x &UHDWHDYHJHWDWLYHO\GLYHUVHEXIIHUDQGWUDQVLWLRQDO]RQHEHWZHHQWKHQHZSRQGDUHDDQG DGMRLQLQJXSODQGSURSHUWLHV x 3URYLGHDQGHQKDQFHDTXDWLFILVKKDELWDWWRWKHVDWLVIDFWLRQRI%DVVDQG*LOO&OXEWKH ODQGRZQHU WETLANDS TO BE CREATED ,PSDFWVWR)OHWFKHU/DNHZLOOEHPLWLJDWHGDWDUDWLRRI E\FUHDWLQJRQVLWHFRPSHQVDWRU\ IORRGSODLQVWRUDJHDQGQHZSRQGDUHD7KHRQVLWHZHWODQG SRQG FUHDWLRQZLOOSURYLGHDFUHVRI QHZSRQGDUHDZLWKLQ)OHWFKHU/DNHZKLFKLQFOXGHVDFUHRIHPHUJHQWDTXDWLFZHWODQGDQG DSSUR[LPDWHO\DFUHRIDGMRLQLQJHPHUJHQWZHWODQGDQGDSSUR[LPDWHO\ DFUHRIEXIIHU XSODQGKDELWDW 'HWDLOHGSODQVKHHWVVKRZLQJWKHH[WHQWRIWKHQHZ)OHWFKHU/DNHJUDGLQJDQGODQGVFDSLQJDUH SURYLGHGLQ$SSHQGL[% PREEXISTING WETLAND CREDITS 7KHRQVLWHZHWODQGFUHDWLRQIRULPSDFWVWR)OHWFKHU/DNHZLOOSURYLGHDSRUWLRQRIUHTXLUHGFUHGLWVIRU )OHWFKHU/DNHDVGHWDLOHGLQ7DEOH7KHDGGLWLRQDOFUHGLWIRULPSDFWWR)OHWFKHU/DNHDQGFUHGLWV IRULPSDFWWRDOORWKHULPSDFWHGZHWODQGVLQFOXGLQJ:HWODQG&ORFDWHGZLWKLQWKHFRPSHQVDWLRQVLWH ZLOOEHPLWLJDWHGE\SXUFKDVLQJ FUHGLWVIURP0LOO&UHHN:HWODQG%DQNORFDWHGLQ/DNH&RXQW\ ZLWKLQWKH'HV3ODLQHV5LYHUZDWHUVKHG +8& 0LOO&UHHN:HWODQG%DQN -RKQ5\DQ/DQGDQG:DWHU5HVRXUFHV,QF &XUUHQWEDODQFHDVRI'HFHPEHU 13 credits &07LVQRWDZDUHRIDQ\SHQGLQJFKDQJHVWRFUHGLWDYDLODELOLW\DWWKLVWLPH Page 65 8 DESCRIPTION OF WORK 7KHFRPSHQVDWLRQDUHDLVORFDWHGLQDGHJUDGHGDQGSUHYLRXVO\GLVWXUEHGXSODQGGHFLGXRXV VHFRQGDU\IRUHVWFRPPXQLW\7KHQHZURDGZD\DQGURDGZD\HPEDQNPHQWZLOOUXQDORQJWKH VRXWKHUQERXQGDU\RIWKHFRPSHQVDWLRQVLWH7KHVXUURXQGLQJODQGXVHWRWKHQRUWKDQGHDVWRIWKH VLWHLVIRUSULYDWHUHFUHDWLRQILVKLQJDQGKXQWLQJE\%DVVDQG*LOO&OXEPHPEHUV,/ELVHFWVWKH %DVVDQG*LOO&OXESURSHUW\ ([FDYDWLRQRIXSWRWHQIHHWZLOORFFXUZLWKLQWKHFRPSHQVDWLRQDUHD7KHH[FDYDWLRQZLOOUHPRYHWKH WRSVRLODQGZLOOH[SRVHWKHVDQGDQGJUDYHOOD\HUVEHORZWRIRUPWKHQHZSRQGERWWRP7KHQHZ SRQGERWWRPZLOOEHJUDGHGWRSURYLGHXQGXODWLRQIRUILVKKDELWDW 7KHZRUNZLOOFUHDWHDFUHVRIQHZSRQGDUHDZLWKILVKKDELWDWHQKDQFHPHQWVDQGDFUHVRI HPHUJHQWZHWODQGZLWKLQ)OHWFKHU/DNH,QDGGLWLRQWRWKHQHZSRQGDUHDDSSUR[LPDWHO\ DFUHV RIWUDQVLWLRQDODQGXSODQGEXIIHUKDELWDWZLOOEHFUHDWHG HYDROLOGY +\GURORJ\WR)OHWFKHU/DNHZLOOEHVXSSOLHGE\VXUIDFHZDWHUUXQRIIDQGJURXQGZDWHUZKLFKDUHWKH FXUUHQWK\GURORJ\VRXUFHVWRWKHSRQG1RRWKHUVXUIDFHZDWHUUHVRXUFHVIORZLQWR)OHWFKHU/DNH DQGWKHUHLVQRRXWOHW)OHWFKHU/DNH¶VK\GURORJ\LVODUJHO\FRQWUROOHGE\JURXQGZDWHUHOHYDWLRQGXH WRWKHVLWHKDYLQJEHHQSUHYLRXVO\XVHGDVDPLQLQJTXDUU\DQGKDYLQJVKDOORZRUH[SRVHGEHGURFN 7KHQRUPDOZDWHUHOHYDWLRQRIWKHFRPSHQVDWLRQVLWHZLOOPDWFKWKHHOHYDWLRQRIWKHH[LVWLQJSRQGDW IHHW7KHZDWHUHOHYDWLRQLVH[SHFWHGWREHUHODWLYHO\OHYHODQGIOXFWXDWHQRPRUHWKDQWR IHHWGXULQJQRUPDOVWRUPHYHQWV1RVWRUPZDWHUIURPWKHQHZURDGZD\ZLOORXWOHWWR)OHWFKHU/DNH SOILS 7KHH[LVWLQJVXUIDFHVRLOOD\HUVZLOOEHH[FDYDWHGWRDGHSWKRIIHHW7KLVH[FDYDWLRQRIVRLOZLOO H[SRVHORRVHWRPHGLXPGHQVHVDQGVDQGDQGJUDYHORUVDQG\JUDYHOZKLFKZLOOEHWKHQHZSRQG ERWWRP7KHQHZSRQGERWWRPPDWHULDOVPDWFKWKHH[LVWLQJSRQGERWWRPZKLFKFRQVLVWHG SUHGRPLQDWHO\RIVLOW\VDQGVDQGDQGJUDYHODQGIUDFWXUHGURFNPL[HGZLWKVLOWDQGVDQG VEGETATION 7KHFRPSHQVDWLRQVLWHZLOOEHODUJHO\FRPSULVHGRIRSHQZDWHUSRQGKDELWDW7KHRSHQZDWHUDUHD ZLOOQRWEHSODQWHGDVLWLVH[SHFWHGWKDWDQ\VXEPHUJHGDTXDWLFYHJHWDWLRQIURPWKHDGMRLQLQJ SRUWLRQRIWKHSRQGZLOOHYHQWXDOO\HVWDEOLVKLQWKHQHZSRQGDUHD7KHHPHUJHQWDTXDWLF]RQH ORFDWHGZLWKLQWKHSRQGIURPQRUPDOZDWHUOLQHHOHYDWLRQWRLQFKHVGHSWKZLOOEHSODQWHGZLWKQDWLYH SHUHQQLDOZHWODQGSOXJV7KHZHWODQGSOXJVZLOOLQFOXGHDYDULHW\RIVHGJHVSHFLHVDQGKHUEDFHRXV IORZHULQJSODQWV,QDGGLWLRQWRSURPRWLQJVLWHGLYHUVLW\WKLVZLOOKHOSWRDYRLGHURVLRQDQGUXQRII DQGSUHYHQWVPRWKHULQJRIILVKHJJVDQGDTXDWLFLQVHFWVWKDWILVKHDW 7KHHPHUJHQWZHWODQG]RQH WKHDUHDRIQRUPDOZDWHUIOXFWXDWLRQ ZLOOEHVHHGHGZLWK,'27&ODVV %ZHWODQGJUDVVDQGVHGJHVHHGPL[WXUHWRHVWDEOLVKKHUEDFHRXVYHJHWDWLRQRQWKHVLWH7KH ZHWODQGVHHGPL[WXUHLQFOXGHVFRYHUFURSVSHFLHVWRSUHYHQWLQYDVLYHVSHFLHVIURPGRPLQDWLQJWKH VLWHXQWLOWKHRWKHUVSHFLHVEHFRPHHVWDEOLVKHGLQWKHVXEVHTXHQWJURZLQJVHDVRQV7KHHPHUJHQW Page 66 9 ZHWODQG]RQHZLOODOVREHSODQWHGZLWKQDWLYHWUHHVDQGVKUXEVZLWKDZHWODQGLQGLFDWRUVWDWXVRI IDFXOWDWLYHIDFXOWDWLYHZHWODQGRUREOLJDWHDWIRRWVSDFLQJ 7KHXSODQG]RQHZLOOVHUYHDVDQDWXUDOEXIIHUEHWZHHQWKHSRQGDQGVXUURXQGLQJODQGXVH7KH XSODQG]RQHZLWKLQWKHZHVWHUQSRUWLRQRIWKHFRPSHQVDWLRQVLWHZLOOEHVHHGHGZLWK,'27&ODVV 1RUWKHUQ,OOLQRLVVORSHPL[WXUHDQGWKHHDVWHUQSRUWLRQRIWKHVLWHZLOOEHVHHGHGZLWK,'27&ODVV$ ORZSURILOHQDWLYHPL[WXUHDQG$ODUJHIORZHUQDWLYHIRUEPL[WXUH7KHXSODQGVHHGPL[WXUHVLQFOXGH DQQXDODQGFRYHUFURSVSHFLHVWRSUHYHQWLQYDVLYHVSHFLHVIURPGRPLQDWLQJWKHVLWHXQWLOWKHRWKHU VSHFLHVEHFRPHHVWDEOLVKHGLQWKHVXEVHTXHQWJURZLQJVHDVRQV1DWLYHWUHHVDQGVKUXEV DSSURSULDWHWRWKHVLWHFRQGLWLRQVZLOODOVREHSODQWHGDWIRRWVSDFLQJ %HFDXVHWKHSODQWLQJPHGLXPZLOOEHH[SRVHGGXULQJH[FDYDWLRQDQGH[LVWLQJWRSVRLOZLOOEH UHPRYHGKHUELFLGHDSSOLFDWLRQVKRXOGQRWEHUHTXLUHGSULRUWRSODQWLQJDQGVHHGLQJ,ILWLV GHWHUPLQHGWREHQHFHVVDU\VRLODPHQGPHQWVPD\EHDSSOLHGSULRUWRSODQWLQJDQGVHHGLQJ'XULQJ PRQLWRULQJWKHFRPSHQVDWLRQVLWHZLOOEHFORVHO\PRQLWRUHGIRUWKHSUHVHQFHRILQYDVLYHSODQW VSHFLHV,QYDVLYHVSHFLHVWREHFRQWUROOHGLQFOXGHPhragmites australis FRPPRQUHHG Phalaris arundinacea UHHGFDQDU\JUDVV Lythrum salicaria SXUSOHORRVHVWULIH DQGRhamnus cathartica EXFNWKRUQ ,IDQ\RIWKHVHVSHFLHVEHFRPHDSUREOHPZLWKLQWKHFRPSHQVDWLRQVLWHDFRQWURO SURJUDPZLOOEHGHYHORSHGDWWKDWWLPH&RQWURORILQYDVLYHSODQWVSHFLHVZLOOOLNHO\LQYROYHWKHXVHRI FKHPLFDOKHUELFLGHV 5HIHUWRWKHODQGVFDSLQJSODQVLQ$SSHQGL[%IRUGHWDLOHGLQIRUPDWLRQUHJDUGLQJSODQWLQJ]RQHVSODQW OLVWVDQGWUHHSODFHPHQW AQUATIC HABITAT %HFDXVHWKLVVLWHLVXVHGE\WKH%DVVDQG*LOO&OXEIRUILVKLQJLWLVLPSRUWDQWWKDWWKHQHZSRQGDUHD SURYLGHDSSURSULDWHKDELWDWIRUGHVLUHGILVKVSHFLHVLQFOXGLQJMicropterus salmoides ODUJHPRXWK EDVV *UDGLQJZLWKLQWKHQHZSRQGDUHDZLOOSURYLGHDQXQGXODWLQJERWWRPWRSURYLGHGHHSHUZDWHU KDELWDWIRUILVK)LVKFULEVURRWZDGVRUGHDGHYHUJUHHQWUHHVZLOOEHLQVWDOOHGWRSURYLGHVSDZQLQJ SURWHFWLYHDQGIHHGLQJVWUXFWXUHVIRUWKHILVK %DVVSUHIHUVDQG\JUDYHOVXEVWUDWH EDVHGRQWKHJHRWHFKQLFDOERULQJVWKHH[LVWLQJVXEVWUDWHDIWHU H[FDYDWLRQVKRXOGEHVXIILFLHQWIRUILVKXVH'XULQJFRQVWUXFWLRQFRQILUPDWLRQWKDWWKHVXEVWUDWHLV DSSURSULDWH VDQG\JUDYHODQGJHQHUDOO\ORRVHXQFRQVROLGDWHG ZLOORFFXU,IQHFHVVDU\VWHSVZLOOEH WDNHQWRSURYLGHDSSURSULDWHVXEVWUDWHDORQJWKHQHZSRQGERWWRP $ORQJWKHVKRUHOLQHSODQWLQJRIHPHUJHQWDTXDWLFSODQWVZLOOSURYLGHDPEXVKFRYHUDQGQHVWLQJ DUHDVIRUILVKDQGZLOODOVRSURYLGHKDELWDWIRUDTXDWLFLQYHUWHEUDWHVWKDWILVKFRQVXPH$TXDWLF YHJHWDWLRQDOVRSURWHFWVZLQGVZHSWVKRUHOLQHVIURPZDYHHURVLRQGHFUHDVLQJVLOWDWLRQRIWKHSRQG $QH[LVWLQJDHUDWLRQV\VWHPZLOOEHSODFHGEDFNLQWRWKHSRQGDIWHUFRQVWUXFWLRQLVFRPSOHWHG $HUDWLRQV\VWHPVKHOSWRSUHYHQWZLQWHUNLOOZKLFKRFFXUVZKHQWKLFNLFHDQGVQRZEORFNVXQOLJKW IURPUHDFKLQJVXEPHUJHGDTXDWLFSODQWV:KHQWKHSODQWVGLHWKH\GHFRPSRVHDQGGHSOHWHWKH GLVVROYHGR[\JHQQHHGHGE\WKHILVK$HUDWLRQDGGVR[\JHQWRWKHZDWHUWRSUHYHQWZLQWHUNLOO 5HIHUWRWKHJUDGLQJSODQVLQ$SSHQGL[%IRUGHWDLOVRIWKHSRQGWRSRJUDSK\ Page 67 10 SITE PROTECTION AND MAINTENANCE RESPONSIBLE PARTIES 7KH9LOODJHRI3ODLQILHOGZLOODVVXPHUHVSRQVLELOLW\IRUWKH)OHWFKHU/DNHFRPSHQVDWLRQVLWHWREH HVWDEOLVKHG7KH9LOODJHZLOOEHUHVSRQVLEOHIRUFRQGXFWLQJRUKLULQJDFRQVXOWDQWWRFRQGXFWWKHILYH \HDUPRQLWRULQJDQGPDLQWHQDQFHRIWKHZHWODQGPLWLJDWLRQVLWHWRZDUGVPHHWLQJWKHSHUIRUPDQFH VWDQGDUGVDQGJRDOV$IWHUWKHPRQLWRULQJKDVEHHQFRPSOHWHGWKH%DVV *LOO&OXEZLOOPDLQWDLQ DQGPDQDJHWKHVLWH Village of Plainfield 'HSDUWPHQWRI3XEOLF:RUNV 0U6FRWW7KUHHZLWW &RLO3OXV'ULYH 3ODLQILHOG,/ VWKUHHZLWW#JRSODLQILHOGFRP 5ROH 3HUPLWWHHILYH\HDUPRQLWRULQJDQGPDLQWHQDQFH Bass and Gill Club (0DLQ6W 3ODLQILHOG,/ Mr. Steve Beese, PresidHQW E]VWHYH#\DKRRFRP Mr. Richard Pach, Lakes Manager ULFNISDFK#WIZZLFRP 5ROH /DQGRZQHUORQJWHUPPDLQWHQDQFH Crawford, Murphy & Tilly, Inc. 0U&KDUOHV³7LFH´&ROH 1&RPPRQV'ULYH6XLWH $XURUD,/ FFROH#FPWHQJUFRP 5ROH (QJLQHHUDQGFRQVXOWDQW MONITORING PLAN 7KHFRPSHQVDWLRQDUHDZLOOEHPRQLWRUHGIRUILYH\HDUV0RQLWRULQJZLOORFFXUDQQXDOO\ZLWKUHSRUWV VXEPLWWHGE\'HFHPEHUVWRIHDFK\HDU7KHILYHUHSRUWVZLOOFRQWDLQSHUWLQHQWLQIRUPDWLRQDERXW WKHYHJHWDWLRQVRLOVDQGK\GURORJ\ZLWKLQWKHFRPSHQVDWLRQDUHD $%DVHOLQH5HSRUWZLOOEHVXEPLWWHGE\'HFHPEHUIROORZLQJFRPSOHWLRQRIWKH FRPSHQVDWLRQFRQVWUXFWLRQ7KH%DVHOLQH5HSRUWVKDOOLQFOXGHWKHIROORZLQJLQIRUPDWLRQ D $WRSRJUDSKLFVXUYH\GUDZLQJVKRZLQJWKH$V%XLOWFRQGLWLRQVRIWKHFRPSHQVDWLRQ DUHD $IXOOVL]HGUDZLQJDQGDQ´[´YHUVLRQZLOOEHSURYLGHG E &RORUSKRWRJUDSKVDQGDSKRWRORFDWLRQPDS Page 68 11 F $SODQWVSHFLHVOLVWWKDWJLYHV86):6:HWODQG,QGLFDWRU6WDWXVDQGVWUDWD HJKHUE VKUXE 'RPLQDQWSODQWVZLOOEHKLJKOLJKWHG7KHGDWHRIILHOGLQVSHFWLRQZLOODOVREH JLYHQ G :DWHUGHSWKDQGGDWHRIPHDVXUHPHQWZLOOEHSURYLGHGIURPUHSUHVHQWDWLYHORFDWLRQV ZLWKLQWKHFRPSHQVDWLRQDUHD7KHVDPSOHSRLQWORFDWLRQVZLOOEHQRWHG $QQXDOPRQLWRULQJUHSRUWVZLOOEHSUHSDUHGDQGVXEPLWWHGE\'HFHPEHURIHDFK\HDU7KH UHSRUWVZLOOLQFOXGHWKHIROORZLQJLQIRUPDWLRQEDVHGXSRQGDWDFROOHFWHGLQWKHPRQWKVRI 6HSWHPEHURU2FWREHU D &RORUSKRWRJUDSKVDQGDSKRWRORFDWLRQPDS E $SODQWVSHFLHVOLVW DVLQWKH%DVHOLQH5HSRUW F :DWHUGHSWKV DVLQWKH%DVHOLQH5HSRUW G :DWHUTXDOLW\PHDVXUHPHQWV LHGLVVROYHGR[\JHQS+DQGWXUELGLW\ ZLOOEH PHDVXUHGDWWKHVLWHDQGFRPSDUHGWRRWKHUDUHDVRIWKHSRQG H $TXHVWLRQQDLUHZLOOEHSURYLGHGWRWKH%DVVDQG*LOO&OXEWRPRQLWRUILVKLQJVXFFHVV LQWKHQHZSRQGDUHDFRPSDUHGWRWKHUHVWRIWKHODNH I $GLVFXVVLRQWKDWLQFOXGHVDVWDWHPHQWDVWRZKHWKHURUQRWWKHREMHFWLYHVRIWKH PLWLJDWLRQSURMHFWDUHEHLQJPHWDQGDSODQZLWKDQLPSOHPHQWDWLRQWLPHWDEOHWR FRUUHFWDQ\GHILFLHQFLHV )LYH<HDU0RQLWRULQJ5HSRUWZLOOEHVXEPLWWHGIROORZLQJWKHILIWKIXOOJURZLQJVHDVRQDIWHU FRPSOHWLRQRIWKHPLWLJDWLRQFRQVWUXFWLRQ7KH<HDU)LYH0RQLWRULQJ5HSRUWZLOOLQFOXGHWKH IROORZLQJLQIRUPDWLRQEDVHGRQGDWDFROOHFWHGLQWKHPRQWKVRI6HSWHPEHURU2FWREHU D $FRS\RIWKH%DVHOLQH5HSRUW E &RORUSKRWRJUDSKVDQGDSKRWRORFDWLRQPDS F $SODQWVSHFLHVOLVW DVLQWKH%DVHOLQH5HSRUW G :DWHUGHSWKV DVLQWKH%DVHOLQH5HSRUW H 7KHJRDOZLOOEHWRHQKDQFHWKHVLWHYHJHWDWLRQWRDFKLHYHD)ORULVWLF4XDOLW\,QGH[ )4, RILQGLFDWLQJKLJKYHJHWDWLYHTXDOLW\DQGRUD1DWLYH0HDQ&RIRYHU LQGLFDWLQJDKLJKTXDOLW\DTXDWLFUHVRXUFH I 7KHJRDOZLOOEHWRSURYLGHHTXDORUJUHDWHUTXDOLW\ILVKLQJKDELWDWLQWKHQHZSRQG DUHDFRPSDUHGWRWKHLPSDFWHGDUHD J $GHOLQHDWLRQRIWKHDUHDXVLQJWKH &RUSVRI(QJLQHHUV:HWODQGV'HOLQHDWLRQ 0DQXDOZLOOEHSHUIRUPHGGXULQJ\HDUILYHDQGLQFOXGHGZLWKWKHILQDOPRQLWRULQJ UHSRUW K $GLVFXVVLRQZKLFKLQFOXGHVDVWDWHPHQWDVWRZKHWKHURUQRWWKHREMHFWLYHVRIWKH FRPSHQVDWLRQSURMHFWDUHEHLQJPHWDQGDSODQZLWKDQLPSOHPHQWDWLRQWLPHWDEOHWR FRUUHFWDQ\GHILFLHQFLHV MANAGEMENT PLAN 5HPHGLDOPHDVXUHVZLOOEHLGHQWLILHGGXULQJWKHPRQLWRULQJSHULRGDQGZLOOEHDFFRPSOLVKHGDWWKH WLPHWKH\DUHLGHQWLILHGE\WKHPRQLWRULQJFRQVXOWDQWRUDWWKHUHTXHVWRIWKHVWDWHDJHQFLHVIROORZLQJ VLWHYLVLWVRUXSRQUHYLHZRIWKHDQQXDOUHSRUW ,IDWWKHILIWK\HDUWKHFUHDWHGDQGHQKDQFHGSRQGDUHDDQGEXIIHUZHWODQGDQGXSODQGDUHQRW SHUIRUPLQJDVSURSRVHGWKHPRQLWRULQJSHULRGZLOOEHH[WHQGHGWRHQDEOHUHYLVLRQVDWWKHH[LVWLQJ ORFDWLRQ,QWKHHYHQWWKDWUHYLVLRQVDUHQRWUHDVRQDEO\SRVVLEOHDQHZFRPSHQVDWLRQVLWHZLOOEH VRXJKWRUFUHGLWVDWDPLWLJDWLRQEDQNZLOOEHSXUFKDVHG ,IWKHPLWLJDWLRQVLWHLVQRWDGHTXDWHO\YHJHWDWHGE\WKHHQGRIWKHWKLUG\HDUDGGLWLRQDO SODQWLQJVZLOOEHGRQH3ODQWPDWHULDOZLOOEHREWDLQHGIURPQXUVHULHV Page 69 12 ,IWKHILVKKDELWDWLVQRWSHUIRUPLQJDWWKHOHYHORIRUEHWWHUWKDQWKHLPSDFWHGDUHDSULRUWR FRQVWUXFWLRQE\WKHHQGRIWKHWKLUG\HDUDGGLWLRQDOSODQWLQJVWRSRJUDSKLFJUDGLQJRU VWUXFWXUHSODFHPHQWPD\EHGRQH 7KHH[WHQWRILQYDVLYHVSHFLHVZLWKLQWKHFRPSHQVDWLRQDUHDZLOOEHPRQLWRUHGWKURXJKRXWWKH ILYH\HDUPRQLWRULQJSHULRG'XULQJWKLVWLPHVHOHFWLYHKHUELFLGHVSUD\LQJDQGRUKDQG UHPRYDOVZLOOEHFRQGXFWHGLIWKH\VWDUWWRDSSURDFKWKHGRPLQDQFHWKUHVKROG,QYDVLYH VSHFLHVWREHFRQWUROOHGLQFOXGHTypha x glauca K\EULGFDWWDLO Typha angustifolia QDUURZOHDIFDWWDLO Phragmites australis FRPPRQUHHG Phalaris arundinacea UHHGFDQDU\ JUDVV Lythrum salicaria SXUSOHORRVHVWULIH DQGRhamnus cathartica EXFNWKRUQ ,IDQ\RI WKHVHVSHFLHVEHFRPHDSUREOHPZLWKLQWKHFRPSHQVDWLRQVLWHDFRQWUROSURJUDPZLOOEH GHYHORSHGDWWKDWWLPH LEGAL PROTECTION $FRQVHUYDWLRQHDVHPHQWZLOOEHSODFHGRQWKHFRPSHQVDWLRQVLWHRXWVLGHRIWKHURDGZD\ULJKWRI ZD\WRUHVWULFWIXUWKHUDGYHUVHLPSDFWVWRWKHVLWHLQFOXGLQJLQFRPSDWLEOHFRQVWUXFWLRQZLWKLQWKH ZHWODQGFRPSHQVDWLRQDUHD7KHHDVHPHQWZLOOEHKHOGE\WKH%DVVDQG*LOO&OXEODQGRZQHUDQG XVHURIWKHVLWH Page 70 )OHWFKHU/DNH&RPSHQVDWLRQ APPENDIX A: MAPPING Page 71 Fletcher Lake143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE MITIGATION AREA LOCATION MAP-,)HHW&RPSHQVDWLRQ$UHD(65/LPLWVService Layer Credits: USGS The National Map: National Boundaries Dataset, 3DEP Elevation Program, Geographic Names Information System, NationalPage 72 Fletcher Lake,/Fletcher Lake143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE AERIAL MAP-,)HHW&RPSHQVDWLRQ$UHD3URSRVHG,PSURYHPHQWV3URSRVHG52:Service Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community)HHWPage 73 Route:143RDStreet(FAU0380) Section:06Ͳ00040Ͳ00ͲFP County:Will JobNo.:RͲ91Ͳ012Ͳ20 ParcelNo.:1NN0013TE Station:544+88.68to572+84.29 IndexNo.:06Ͳ03Ͳ02Ͳ100Ͳ012 ThatpartoftheSoutheastQuarterofSection3andpartoftheSouthwestQuarterofSection2, Township36North,Range9EastoftheThirdPrincipalMeridianinWillCounty,Illinois,lyingnorthof thecenterlineof143rdStreet,bearingsanddistancesarebasedontheIllinoisStatePlaneCoordinate System,EastZone,NAD83(2011Adjustment),withacombinedfactorof0.99995223;describedas follows: CommencingatafoundironpinattheSouthwestCornerofsaidSoutheastQuarterofSection3;thence South89degrees06minutes53secondsWestalongtheSouthlineoftheSouthwestQuarterofSection 3adistanceof395.70feettoapointonthecenterlineofNapervilleRoad;thenceNorth30degrees08 minutes16secondsEastalongsaidcenterlineadistanceof175.04feettoapoint150.00feetNorthof saidSouthlinewithsaidpointbeingontheNorthlineofDocumentNumber408480;thenceNorth89 degrees06minutes53secondsEastalongsaidNorthlineandparallelwithsaidSouthlineadistanceof 303.32feettoapointontheEastlineofsaidSouthwestQuarter;thenceNorth88degrees53minutes 02secondsEastalongsaidNorthlineandparallelwiththeSouthlineofsaidSoutheastQuartera distanceof143.13feettoapointontheSoutheasterlylineofJud’sAcresSubdivisionPlatasrecordedin PlatBook31Page101asDocumentNo.884141;thenceNorth27degrees58minutes13secondsEast alongtheSoutheasterlylinesofLots1,2and3ofsaidSubdivisionPlatadistanceof125.87feettothe PointofBeginning;thencecontinuingNorth27degrees58minutes13secondsEastalongthe SoutheasterlylinesofLots3,4,5and6ofsaidSubdivisionPlatadistanceof352.60feet;thenceSouth 67degrees38minutes28secondsEastadistanceof264.04feet;thenceSouth01degree06minutes58 secondsEastadistanceof192.96feet;thenceNorth88degrees53minutes02secondsEastadistance of1,682.21feet;thenceNorth43degrees35minutes44secondsEastadistanceof280.55feet;thence North51degrees54minutes02secondsEastadistanceof289.03feet;thenceSouth83degrees05 minutes58secondsEastadistanceof84.85feet;thenceSouth38degrees05minutes58secondsEasta distanceof205.00feet;thenceNorth51degrees54minutes02secondsEastadistanceof156.00feet; thenceSouth38degrees05minutes58secondsEastadistanceof25.00feet;thenceSouth51degrees 54minutes02secondsWestadistanceof440.00feet;thenceSouth76degrees57minutes06seconds Westadistanceof81.43feet;thenceSouth88degrees53minutes02secondsWestadistanceof 2,439.91feettothePointofBeginning. Saidparcelcontaining5.639Acres,moreorless. TemporaryEasementisforroadwayextension,compensatorystorageandlakeremediation. L:\Plainfield\16024202Ͳ00_143rd\Land_Acquisition\PlatsandLegals\LegalDescriptions\Parcel1NN0013TE.docx Page 74 Page 75 Page 76 Page 77 Fletcher Lake,/802BW290BFletcher Lake290BW290A802B143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE NRCS SSURGO SOIL SURVEY MAP-,)HHW&RPSHQVDWLRQ$UHD $:DUVDZVLOWORDPWRSHUFHQWVORSHVK\GULF %:DUVDZVLOWORDPWRSHUFHQWVORSHV%2UWKHQWVORDP\XQGXODWLQJK\GULF::DWHUService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community)HHWPage 78 Map Unit Description (Brief, Generated) :LOO&RXQW\,OOLQRLV >0LQRUPDSXQLWFRPSRQHQWVDUHH[FOXGHGIURPWKLVUHSRUW@ $:DUVDZVLOWORDPWRSHUFHQWVORSHVMap unit: Component::DUVDZ The Warsaw component makes up 90 percent of the map unit. Slopes are 0 to 2 percent. This component is on outwash plains. The parent material consists of Thin mantle of loess or other silty material and in the underlying loamy glaciofluvial deposits over sandy and gravelly glaciofluvial deposits. Depth to a root restrictive layer, strongly contrasting textural stratification, is 24 to 40 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. There is no zone of water saturation within a depth of 72 inches. Organic matter content in the surface horizon is about 3 percent. This component is in the R110XY006IL Dry Glacial Drift Upland Prairie ecological site. Nonirrigated land capability classification is 2s. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 20 percent. %:DUVDZVLOWORDPWRSHUFHQWVORSHVMap unit: Component::DUVDZ The Warsaw component makes up 92 percent of the map unit. Slopes are 2 to 4 percent. This component is on outwash plains. The parent material consists of Thin mantle of loess or other silty material and in the underlying loamy glaciofluvial deposits over sandy and gravelly glaciofluvial deposits. Depth to a root restrictive layer, strongly contrasting textural stratification, is 24 to 40 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. There is no zone of water saturation within a depth of 72 inches. Organic matter content in the surface horizon is about 3 percent. This component is in the R110XY006IL Dry Glacial Drift Upland Prairie ecological site. Nonirrigated land capability classification is 2e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 20 percent. %2UWKHQWVORDP\XQGXODWLQJMap unit: Component:2UWKHQWVORDP\XQGXODWLQJ The Orthents, loamy, undulating component makes up 90 percent of the map unit. Slopes are 1 to 6 percent. This component is on leveled land on outwash plains. The parent material consists of Earthy fill. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is moderate. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 51 inches during February, March, April. Organic matter content in the surface horizon is about 1 percent. Nonirrigated land capability classification is 3e. This soil does not meet hydric criteria. ::DWHUMap unit: Component::DWHU Generated brief soil descriptions are created for major soil components. The Water is a miscellaneous area. 3DJH 6XUYH\$UHD9HUVLRQ 6XUYH\$UHD9HUVLRQ'DWH Page 79 Hydric Soils :LOO&RXQW\,OOLQRLV 3HUFHQW RIPDS XQLW >7KLVUHSRUWOLVWVRQO\WKRVHPDSXQLWFRPSRQHQWVWKDWDUHUDWHGDVK\GULF'DVKHV LQDQ\FROXPQLQGLFDWHWKDWWKHGDWDZHUHQRWLQFOXGHGLQWKH GDWDEDVH'HILQLWLRQVRIK\GULFFULWHULDFRGHVDUHLQFOXGHGDWWKHHQGRIWKHUHSRUW@ /DQGIRUP +\GULF UDWLQJ +\GULF FULWHULD&RPSRQHQW0DSV\PERODQG PDSXQLWQDPH $ :DUVDZVLOWORDPWRSHUFHQWVORSHV :LOO 2XWZDVKSODLQV <HV % 2UWKHQWVORDP\XQGXODWLQJ 'UXPPHU 2XWZDVKSODLQV <HV 3HOOD 2XWZDVKSODLQV <HV 3DJH 6XUYH\$UHD9HUVLRQ 6XUYH\$UHD9HUVLRQ'DWH Page 80 Hydric Soils 7KLVWDEOHOLVWVWKHPDSXQLWFRPSRQHQWVWKDWDUHUDWHGDVK\GULFVRLOVLQWKHVXUYH\DUHD7KLVOLVWFDQKHOSLQSODQQLQJODQGXVHV KRZHYHURQVLWH LQYHVWLJDWLRQLVUHFRPPHQGHGWRGHWHUPLQHWKHK\GULFVRLOVRQDVSHFLILFVLWH 1DWLRQDO5HVHDUFK&RXQFLO +XUWDQGRWKHUV 7KHWKUHHHVVHQWLDOFKDUDFWHULVWLFVRIZHWODQGVDUHK\GURSK\WLFYHJHWDWLRQK\GULFVRLOVDQGZHWODQGK\GURORJ\ &RZDUGLQDQGRWKHUV 86 $UP\&RUSVRI(QJLQHHUV 1DWLRQDO5HVHDUFK&RXQFLO 7LQHU &ULWHULDIRUDOORIWKHFKDUDFWHULVWLFVPXVWEHPHWIRUDUHDVWREH LGHQWLILHGDVZHWODQGV8QGUDLQHGK\GULFVRLOVWKDWKDYHQDWXUDOYHJHWDWLRQVKRXOGVXSSRUWDGRPLQDQWSRSXODWLRQRIHFRORJLFDOZHWODQGSODQWVSHFLHV +\GULFVRLOVWKDWKDYHEHHQFRQYHUWHGWRRWKHUXVHVVKRXOGEHFDSDEOHRIEHLQJUHVWRUHGWRZHWODQGV +\GULFVRLOVDUHGHILQHGE\WKH1DWLRQDO7HFKQLFDO&RPPLWWHHIRU+\GULF6RLOV 17&+6 DVVRLOVWKDWIRUPHGXQGHUFRQGLWLRQVRIVDWXUDWLRQ IORRGLQJRUSRQGLQJORQJHQRXJKGXULQJWKHJURZLQJVHDVRQWRGHYHORSDQDHURELFFRQGLWLRQVLQWKHXSSHUSDUW )HGHUDO5HJLVWHU 7KHVHVRLOV XQGHUQDWXUDOFRQGLWLRQVDUHHLWKHUVDWXUDWHGRULQXQGDWHGORQJHQRXJKGXULQJWKHJURZLQJVHDVRQWRVXSSRUWWKHJURZWKDQGUHSURGXFWLRQRI K\GURSK\WLFYHJHWDWLRQ 7KH17&+6GHILQLWLRQLGHQWLILHVJHQHUDOVRLOSURSHUWLHVWKDWDUHDVVRFLDWHGZLWKZHWQHVV,QRUGHUWRGHWHUPLQHZKHWKHUDVSHFLILFVRLOLVDK\GULF VRLORUQRQK\GULFVRLOKRZHYHUPRUHVSHFLILFLQIRUPDWLRQVXFKDVLQIRUPDWLRQDERXWWKHGHSWKDQGGXUDWLRQRIWKHZDWHUWDEOHLVQHHGHG7KXV FULWHULDWKDWLGHQWLI\WKRVHHVWLPDWHGVRLOSURSHUWLHVXQLTXHWRK\GULFVRLOVKDYHEHHQHVWDEOLVKHG )HGHUDO5HJLVWHU 7KHVHFULWHULDDUHXVHGWR LGHQWLI\PDSXQLWFRPSRQHQWVWKDWQRUPDOO\DUHDVVRFLDWHGZLWKZHWODQGV7KHFULWHULDXVHGDUHVHOHFWHGHVWLPDWHGVRLOSURSHUWLHVWKDWDUHGHVFULEHGLQ 6RLO7D[RQRP\ 6RLO6XUYH\6WDII DQG.H\VWR6RLO7D[RQRP\ 6RLO6XUYH\6WDII DQGLQWKH6RLO6XUYH\0DQXDO 6RLO6XUYH\'LYLVLRQ 6WDII ,IVRLOVDUHZHWHQRXJKIRUDORQJHQRXJKSHULRGRIWLPHWREHFRQVLGHUHGK\GULFWKH\VKRXOGH[KLELWFHUWDLQSURSHUWLHVWKDWFDQEHHDVLO\REVHUYHG LQWKHILHOG7KHVHYLVLEOHSURSHUWLHVDUHLQGLFDWRUVRIK\GULFVRLOV7KHLQGLFDWRUVXVHGWRPDNHRQVLWHGHWHUPLQDWLRQVRIK\GULFVRLOVDUHVSHFLILHGLQ )LHOG,QGLFDWRUVRI+\GULF6RLOVLQWKH8QLWHG6WDWHV +XUWDQGRWKHUV +\GULFVRLOVDUHLGHQWLILHGE\H[DPLQLQJDQGGHVFULELQJWKHVRLOWRDGHSWKRIDERXWLQFKHV7KLVGHSWKPD\EHJUHDWHULIGHWHUPLQDWLRQRIDQ DSSURSULDWHLQGLFDWRUVRUHTXLUHV,WLVDOZD\VUHFRPPHQGHGWKDWVRLOVEHH[FDYDWHGDQGGHVFULEHGWRWKHGHSWKQHFHVVDU\IRUDQXQGHUVWDQGLQJRIWKH UHGR[LPRUSKLFSURFHVVHV7KHQXVLQJWKHFRPSOHWHGVRLOGHVFULSWLRQVVRLOVFLHQWLVWVFDQFRPSDUHWKHVRLOIHDWXUHVUHTXLUHGE\HDFKLQGLFDWRUDQG VSHFLI\ZKLFKLQGLFDWRUVKDYHEHHQPDWFKHGZLWKWKHFRQGLWLRQVREVHUYHGLQWKHVRLO7KHVRLOFDQEHLGHQWLILHGDVDK\GULFVRLOLIDWOHDVWRQHRIWKH DSSURYHGLQGLFDWRUVLVSUHVHQW 0DSXQLWVWKDWDUHGRPLQDQWO\PDGHXSRIK\GULFVRLOVPD\KDYHVPDOODUHDVRULQFOXVLRQVRIQRQK\GULFVRLOVLQWKHKLJKHUSRVLWLRQVRQWKH ODQGIRUPDQGPDSXQLWVGRPLQDQWO\PDGHXSRIQRQK\GULFVRLOVPD\KDYHLQFOXVLRQVRIK\GULFVRLOVLQWKHORZHUSRVLWLRQVRQWKHODQGIRUP 7KHFULWHULDIRUK\GULFVRLOVDUHUHSUHVHQWHGE\FRGHVLQWKHWDEOH IRUH[DPSOH% 'HILQLWLRQVIRUWKHFRGHVDUHDVIROORZV $OO+LVWHOVH[FHSWIRU)ROLVWHOVDQG+LVWRVROVH[FHSWIRU)ROLVWV 6RLOVLQ$TXLFVXERUGHUVJUHDWJURXSVRUVXEJURXSV$OEROOVVXERUGHU+LVWRUWKHOVJUHDWJURXS+LVWRWXUEHOVJUHDWJURXS3DFKLFVXEJURXSVRU &XPXOLFVXEJURXSVWKDW $DUHVRPHZKDWSRRUO\GUDLQHGDQGKDYHDZDWHUWDEOHDWWKHVXUIDFH IHHW GXULQJWKHJURZLQJVHDVRQRU %DUHSRRUO\GUDLQHGRUYHU\SRRUO\GUDLQHGDQGKDYHHLWKHU DZDWHUWDEOHDWWKHVXUIDFH IHHW GXULQJWKHJURZLQJVHDVRQLIWH[WXUHVDUH FRDUVHVDQGVDQGRUILQHVDQGLQDOOOD\HUVZLWKLQDGHSWKRILQFKHVRU DZDWHUWDEOHDWDGHSWKRIIRRWRUOHVVGXULQJWKHJURZLQJVHDVRQLI SHUPHDELOLW\LVHTXDOWRRUJUHDWHUWKDQLQKULQDOOOD\HUVZLWKLQDGHSWKRILQFKHVRU DZDWHUWDEOHDWDGHSWKRIIRRWRUOHVVGXULQJWKHJURZLQJVHDVRQLI SHUPHDELOLW\LVOHVVWKDQLQKULQDQ\OD\HUZLWKLQDGHSWKRILQFKHV 6RLOVWKDWDUHIUHTXHQWO\SRQGHGIRUORQJRUYHU\ORQJGXUDWLRQGXULQJWKHJURZLQJVHDVRQ 6RLOVWKDWDUHIUHTXHQWO\IORRGHGIRUORQJRUYHU\ORQJGXUDWLRQGXULQJWKHJURZLQJVHDVRQ 5HIHUHQFHV &RZDUGLQ/09&DUWHU)&*ROHWDQG(7/D5RH &ODVVLILFDWLRQRIZHWODQGVDQGGHHSZDWHUKDELWDWVRIWKH8QLWHG6WDWHV86)LVKDQG :LOGOLIH6HUYLFH):62%6 )HGHUDO5HJLVWHU6HSWHPEHU+\GULFVRLOVRIWKH8QLWHG6WDWHV )HGHUDO5HJLVWHU-XO\ &KDQJHVLQK\GULFVRLOVRIWKH8QLWHG6WDWHV +XUW*:30:KLWHGDQG5)3ULQJOHHGLWRUV9HUVLRQ)LHOGLQGLFDWRUVRIK\GULFVRLOVLQWKH8QLWHG6WDWHV 1DWLRQDO5HVHDUFK&RXQFLO :HWODQGV &KDUDFWHULVWLFVDQGERXQGDULHV 6RLO6XUYH\'LYLVLRQ6WDII 6RLOVXUYH\PDQXDO6RLO&RQVHUYDWLRQ6HUYLFH86'HSDUWPHQWRI$JULFXOWXUH+DQGERRN 6RLO6XUYH\6WDII.H\VWRVRLOWD[RQRP\ WKHGLWLRQ86'HSDUWPHQWRI$JULFXOWXUH1DWXUDO5HVRXUFHV&RQVHUYDWLRQ6HUYLFH 6RLO6XUYH\6WDII 6RLOWD[RQRP\ $EDVLFV\VWHPRIVRLOFODVVLILFDWLRQIRUPDNLQJDQGLQWHUSUHWLQJVRLOVXUYH\VQGHGLWLRQ1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH86'HSDUWPHQWRI$JULFXOWXUH+DQGERRN 7LQHU5:-U :HWODQGVRI'HODZDUH86)LVKDQG:LOGOLIH6HUYLFHDQG'HODZDUH'HSDUWPHQWRI1DWXUDO5HVRXUFHVDQG(QYLURQPHQWDO &RQWURO:HWODQGV6HFWLRQ 8QLWHG6WDWHV$UP\&RUSVRI(QJLQHHUV(QYLURQPHQWDO/DERUDWRU\ &RUSVRI(QJLQHHUVZHWODQGVGHOLQHDWLRQPDQXDO:DWHUZD\V([SHULPHQW 6WDWLRQ7HFKQLFDO5HSRUW< 3DJH 6XUYH\$UHD9HUVLRQ 6XUYH\$UHD9HUVLRQ'DWH Page 81 )OHWFKHU/DNH&RPSHQVDWLRQ APPENDIX B: PLANS Page 82 Fletcher Lake,/Fletcher Lake143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE LANDSCAPE CONCEPT-,)HHW8SODQG]RQH5LSDULDQZHWODQG]RQH(PHUJHQWDTXDWLF]RQH1HZSRQG DF 7XUI3URSRVHG,PSURYHPHQWV3URSRVHG52:Service Layer Credits: Source: Esri, Maxar, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community)HHW:HVWHUQVKRUHOLQH VORSHV DF 1RUWKHUQ,OOLQRLV6ORSH0L[WXUH(DVWHUQVKRUHOLQH VORSHVDF /RZ3URILOH1DWLYH /DUJH)ORZHU1DWLYH)RUE0L[WXUHV7UHH VKUXESODQWLQJV VSDFLQJ &KLQNDSLQRDN Quercus muehlenbergii 1RUWKHUQUHGRDN Quercus rubra 6KDJEDUNKLFNRU\ Carya ovata 5HGEXG Cercis canadensis 6XJDUPDSOH Acer saccharum %XURDN Quercus macrocarpa +DFNEHUU\ Celtis occidentalis 5HGPDSOH Acer rubrum %ODFNKDZYLEXUQXP Viburnum prunifolium *UD\GRJZRRG Cornus racemosa UPLAND ZONE(0.69 ac)RIPARIAN/WETLAND ZONE(0.16 ac):HWODQG*UDVV 6HGJH0L[WXUH7UHH VKUXESODQWLQJV VSDFLQJ $PHULFDQV\FDPRUH Platanus occidentalis 6KXPDUGRDN Quercus shumardii 6ZDPSZKLWHRDN Quercus bicolor %ODFNZLOORZ Salix nigra %DOGF\SUHVV Taxodium distichum (OGHUEHUU\ Sambucus canadensis 3XVV\ZLOORZ Salix discolor 5HGRVLHUGRJZRRG Cornus stolinfera V\QC. alba 6LON\GRJZRRG Cornus amomum 6SLFHEXVK Lindera benzoin %XWWRQEXVK Cephalanthus occidentalis 6ZDPSURVH Rosa palustris EMERGENT AQUATIC ZONE(0.12 ac):HWODQGSOXJVGLDPHWHUE\GHHS)URPQRUPDOZDWHUOLQHHOHYDWLRQWR´GHSWK(PHUJHQWVHHGPL[DQGRUSOXJV%ULVWO\VHGJH Carex comosa 3RUFXSLQHVHGJH Carex hystericina &RPPRQKRSVHGJH Carex lupulina &RPPRQWXVVRFNVHGJH Carex stricta 0XGSODQWDLQ Alisma subcordatum 7XUWOHKHDG Chelone glabra 5RVHPDOORZ Hibiscus laevis 6HHGER[ Ludwigia alternifolia 0RQNH\IORZHU Mimulus ringens &RPPRQDUURZKHDG Sagittaria latifolia $FUHDJHLVDUHDRIQHZSRQGDQG]RQHVRXWVLGHRISURSRVHG52:Page 83 6 0 0 600 600 6 0 0605605 6056 0 5 60 5 6 0 5605605 61 0 610 6 1 0610610610 610610610610 610615615 615 615 615 6 1 5 6 1 5 615615615615615615615615615615615615 615 615 6 1 5 615 6156 1 5 615615615615615615615615 615615 615615615615615 615615615620 620 620620620620 620,/Fletcher Lake595600600600600600605605605605605605605 610610610610610610 6 1 06106 1 0 61061061061061561561 5 61561561561561561561561561561615Fletcher Lake143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE EXISTING GRADING-,)HHWService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community)HHW([LVWLQJSURSHUW\ERXQGDULHVPage 84 Fletcher Lake,/ Fletcher Lake143rd Street Extension - Plainfield, Will Co., ILBASS & GILL CLUB FLETCHER LAKE PROPOSED GRADING-,)HHWService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community)HHW8SODQG:HWODQG7UDQVLWLRQDO(PHUJHQW$TXDWLF1HZSRQG7XUI3URSRVHG,PSURYHPHQWV3URSRVHG52:Page 85 Page 86 Page 87 Page 88 Page 89 Page 90 Page 91 Page 92 Excerpted for purposes of document size. Relevant pages provided.Page 93 Page 94 Page 95 Page 96 Page 97 Page 98 Page 99 Page 100 Page 101 Page 102 Page 103 Page 104 Page 105 Page 106 Page 107 Page 108 Page 109 Page 110 Page 111 Page 112 Page 113 Page 114 Page 115 Page 116 Page 117 Page 118 Page 119 Page 120 Page 121 Page 122 Page 123 Page 124 Page 125 Page 126 Page 127 Page 128 Page 129 Page 130 Page 131 Page 132 Page 133 Page 134 Page 135 Page 136 Page 137 Page 138 Page 139 Page 140 Page 141 Page 142 Page 143 Page 144 Page 145 Page 146 Page 147 Page 148 Page 149 Page 150 Page 151 Page 152 Page 153 Page 154 Page 155 Page 156 Page 157 Page 158 Page 159 Page 160 Page 161 Page 162 Page 163 Page 164 Page 165 Page 166 Page 167 Page 168 Page 169 Page 170 Page 171 Page 172 Page 173 Page 174 Page 175 Page 176 Page 177 Page 178 Page 179 Page 180 Page 181 Page 182 Page 183 Page 184 Page 185 Page 186 Page 187 Page 188 Page 189 Page 190 )OHWFKHU/DNH&RPSHQVDWLRQ APPENDIX C: WETLAND REPORT For purposes of the PDR, the duplicated wetland delineation report has been removed and is provided under separate cover. Page 191 )OHWFKHU/DNH&RPSHQVDWLRQ APPENDIX E: GEOTECHNIAL REPORT Page 192 STRUCTURE GEOTECHNICAL REPORT Retaining Wall Structure (SN 099-W028) 143rd Street Extension at Bass & Gill Club Village of Plainfield, Illinois Will County, Illinois Prepared for: Crawford, Murphy & Tilly (CMT) 550 North Commons Drive Suite 116 Aurora, IL 60504 Prepared by: Geo Services, Inc. 805 Amherst Court Suite 204 Naperville, Illinois 60565 (630) 305-9186 GSI Project No. 18117 December 3, 2019 Page 193 $PKHUVW&RXUW6XLWH1DSHUYLOOH,/3KRQH )D[ ZZZJHRVHUYLFHVLQFQHW 'HFHPEHU &UDZIRUG0XUSK\ 7LOO\ &07 1RUWK&RPPRQV'ULYH 6XLWH $XURUD,/ $WWQ 0U&KDUOHV³7LFH´&ROH3( -RE1R 5H 6WUXFWXUH*HRWHFKQLFDO5HSRUW 5HWDLQLQJ:DOO6WUXFWXUH 61 : UG6WUHHW([WHQVLRQDW%DVVDQG*LOO&OXE 9LOODJHRI3ODLQILHOG :LOO&RXQW\,OOLQRLV 'HDU0U&ROH 7KHIROORZLQJUHSRUWSUHVHQWVWKHJHRWHFKQLFDODQDO\VLVDQGUHFRPPHQGDWLRQVIRUWKH SURSRVHG FRQVWUXFWLRQ RI WKH UG 6WUHHW ([WHQVLRQ 5HWDLQLQJ :DOO 6WUXFWXUH 7KH SURMHFW LQFOXGHV D IRRW ORQJ UHWDLQLQJ ZDOO DORQJ WKH QRUWK VLGH RI UG 6WUHHW ZKLFKH[WHQGVLQWRWKH%DVVDQG*LOO&OXESURSHUW\LQ3ODLQILHOG,/7ZHOYH (0% ERULQJVZHUHFRPSOHWHGDWWKHVLWHE\*HR6HUYLFHV,QF *6, &RSLHVRIWKHVHERULQJ ORJVDORQJZLWKVRLOSURILOHVDUHLQFOXGHGLQWKLVUHSRUW ,IWKHUHDUHDQ\TXHVWLRQVUHJDUGLQJWKHLQIRUPDWLRQVXEPLWWHGKHUHLQSOHDVHGRQRW KHVLWDWHWRFRQWDFWXV 9HU\WUXO\\RXUV *(26(59,&(6,QF 'DQ7RQLVVHQ6WHSKHQ$%XFKHU3( 3URMHFW*HRORJLVW6HQLRU*HRWHFKQLFDO(QJLQHHU (PDLO GDQ#JHRVHUYLFHLQFQHW (PDLO VEXFKHU#JHRVHUYLFHLQFQHW HQF Page 194 TABLE OF CONTENTS SECTION 01: INTRODUCTION ...................................................................................... 1 SECTION 02: PROJECT DESCRIPTION ....................................................................... 1 SECTION 03: SUBSURFACE INVESTIGATION PROCEDURES ................................. 1 SECTION 04: LAB TESTING PROGRAM ...................................................................... 2 SECTION 05: SITE AND SUBSURFACE CONDITIONS ............................................... 2 SECTION 06: WATER TABLE CONDITIONS ................................................................ 3 SECTION 07: ANALYSES .............................................................................................. 3 6HLVPLF$QDO\VLV 6HWWOHPHQW$QDO\VLV 6ORSH6WDELOLW\$QDO\VLV SECTION 08: FOUNDATION RECOMMENDATIONS ................................................... 4 5HFRPPHQGHG:DOO7\SHV 06(:DOO5HFRPPHQGDWLRQV SECTION 09: CONSTRUCTION CONSIDERATIONS................................................... 6 SECTION 10: GENERAL QUALIFICATIONS ................................................................ 7 $33(1',;$±6LWH/RFDWLRQ0DS $33(1',;%±%RULQJ/RFDWLRQ3ODQ $33(1',;&±)LQDO76 / $33(1',;'±%RULQJ/RJV $33(1',;(±6ORSH6WDELOLW\&DOFXODWLRQV Page 195 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 1 - SECTION 01: INTRODUCTION 7KLV UHSRUW SUHVHQWV WKH UHVXOWV RI WKH JHRWHFKQLFDO LQYHVWLJDWLRQ IRU WKH SURSRVHG 5HWDLQLQJ :DOO 61 : DORQJ WKH QRUWK VLGH RI WKH UG 6WUHHW ([WHQVLRQ EHWZHHQ5RXWHDQG3ODLQILHOG1DSHUYLOOH5RDGLQ:LOO&RXQW\,OOLQRLV7KHUHVXOWVRI WKHWZHOYH VRLOERULQJV (0%WR(0% FRPSOHWHGE\*HR6HUYLFHVDORQJ ZLWKDVLWHORFDWLRQPDSERULQJORFDWLRQSODQDQGERULQJURFNFRUHORJVDUHLQFOXGHG ZLWKWKLVUHSRUW 7KLV UHSRUW LQFOXGHV GHVFULSWLRQV RI VRLO DQG JURXQGZDWHU FRQGLWLRQV DQG UHFRPPHQGDWLRQVSHUWDLQLQJWRWKHGHVLJQDQGFRQVWUXFWLRQRIWKHUHWDLQLQJZDOODQG HDUWKHPEDQNPHQWIRUWKHQHZURDGZD\ SECTION 02: PROJECT DESCRIPTION 7KH SURSRVHG UHWDLQLQJ ZDOO LV GHVLJQDWHG DV 61 : 7KH UHWDLQLQJ ZDOO LV SURSRVHGWREHDQ06(W\SHVWUXFWXUHKDYLQJDWRWDOOHQJWKRIDSSUR[LPDWHO\IHHW H[WHQGLQJIURP6WDWLRQ WR DORQJWKHQRUWKVLGHRIWKHSURSRVHGUG 6WUHHWDOLJQPHQWDQGWKHVRXWKVLGHRIWKH%DVVDQG*LOO&OXESRQG 6WULNH/DNH %DVHGRQWKHSUHOLPLQDU\FURVVVHFWLRQVSURYLGHGE\WKH&07WKHHVWLPDWHGERWWRPRI UHWDLQLQJZDOOIRRWLQJHOHYDWLRQLVDSSUR[LPDWHO\IHHW7KHUHWDLQLQJZDOOZLOOKDYHD PD[LPXPKHLJKWRIDSSUR[LPDWHO\IHHWQHDUVWDWLRQ$VHFWLRQRIWKHQHZ UHWDLQLQJ ZDOO EHWZHHQ DSSUR[LPDWH VWDWLRQV DQG H[WHQGV LQWR DQ H[LVWLQJ%DVVDQG*LOOSRQGWKDWZHXQGHUVWDQGLVQRWFXUUHQWO\RZQHGE\WKH9LOODJHRI 3ODLQILHOG SECTION 03: SUBSURFACE INVESTIGATION PROCEDURES %RULQJORFDWLRQVZHUHVHOHFWHGE\*HR6HUYLFHV,QF *6, LQFRRSHUDWLRQZLWK&UDZIRUG 0XUSK\DQG7LOO\ &07 %RULQJORFDWLRQVZHUHODLGRXWLQWKHILHOGE\*6,SHUVRQQHO (OHYDWLRQVZHUHEDVHGRQWRSRJUDSKLFLQIRUPDWLRQSURYLGHGE\&07DQGDUHVKRZQRQ WKHERULQJORJV (PEDQNPHQW ERULQJV (0% WKUX (0% DQG (0% WKUX (0% ZHUH SHUIRUPHGGXULQJ$SULO ZLWKDEDUJHPRXQWHGGULOOLQJULJDQGZHUHDGYDQFHGE\ PHDQVRIURWDU\ZDVKWHFKQLTXHVWRERULQJWHUPLQDWLRQZLWKWKHH[FHSWLRQRI(0% ZKLFK ZDV SHUIRUPHG E\ KDQG DXJHU (PEDQNPHQW ERULQJV (0% DQG (0% ZHUHSHUIRUPHGLQ2FWREHU ZLWKKDQGDXJHUHTXLSPHQW 5HSUHVHQWDWLYHVRLOVDPSOHVZHUHREWDLQHGLQWKHURWDU\ZDVKERULQJVHPSOR\LQJVSOLW VSRRQVDPSOLQJSURFHGXUHVLQDFFRUGDQFHZLWK$$6+720HWKRG76SOLWVSRRQ VDPSOLQJLQYROYHVGULYLQJDLQFKRXWVLGHGLDPHWHUVSOLWEDUUHOVDPSOHULQWRWKHVRLO Page 196 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 2 - ZLWKDSRXQGZHLJKWIDOOLQJIUHHO\WKURXJKDGLVWDQFHRILQFKHV%ORZFRXQWVDUH UHFRUGHGDWLQWHUYDOVDQGWKHEORZFRXQWVDUHVKRZQRQWKHERULQJORJV7KHQXPEHU RIEORZVUHTXLUHGWRDGYDQFHWKHVDPSOHUWKHODVWLQFKHVLVWHUPHGWKH6WDQGDUG 3HQHWUDWLRQ5HVLVWDQFH 1 7KH1YDOXHLVDQLQGLFDWLRQRIWKHUHODWLYHGHQVLW\RIWKH VRLO,QWKHKDQGDXJHUERULQJVVDPSOHVZHUHREWDLQHGE\PDQXDOO\GULYLQJDJHRSUREH VDPSOHU ZLWK SODVWLF OLQHU $OO VDPSOHV REWDLQHG LQ WKH ILHOG ZHUH EURXJKW WR RXU ODERUDWRU\IRUIXUWKHUH[DPLQDWLRQDQGWHVWLQJ SECTION 04: LAB TESTING PROGRAM 7KHWHVWSURFHGXUHVZHUHSHUIRUPHGLQDFFRUGDQFHZLWKWKH,'27DQG,OOLQRLV7ROOZD\ *HRWHFKQLFDO 0DQXDOV $OO VSOLWVSRRQ VDPSOHV REWDLQHG IURP WKH GULOOLQJ RSHUDWLRQ ZHUH YLVXDOO\ FODVVLILHG LQ WKH ILHOG &RKHVLYH VDPSOHV ZHUH WHVWHG IRU XQFRQILQHG FRPSUHVVLYH VWUHQJWK XVLQJ DQ ,'27 PRGLILHG 5,0$& WHVW GHYLFH DQGRU FDOLEUDWHG SHQHWURPHWHULQWKHILHOG 7KH ODERUDWRU\ VRLO WHVWLQJ SURJUDP LQFOXGHG SHUIRUPLQJ ZDWHU FRQWHQW GHQVLW\ DQG HLWKHUXQFRQILQHGFRPSUHVVLRQDQGRUFDOLEUDWHGSHQHWURPHWHUWHVWVRQWKHFRKHVLYH VDPSOHVUHFRYHUHG:DWHUFRQWHQWWHVWVZHUHSHUIRUPHGRQWKHQRQFRKHVLYHVDPSOHV UHFRYHUHG7KHVHWHVWVZHUHSHUIRUPHGXSRQUHSUHVHQWDWLYHSRUWLRQVRIWKHVDPSOHV REWDLQHGLQWKHILHOG7KHUHVXOWVRIWKHDERYHWHVWLQJDORQJZLWKDYLVXDOFODVVLILFDWLRQ RIWKHPDWHULDOEDVHGXSRQERWKWKH,OOLQRLVWH[WXUDOFODVVLILFDWLRQDQGWKH$$6+726RLO &ODVVLILFDWLRQ6\VWHPDUHLQGLFDWHGRQWKHERULQJORJV SECTION 05: SITE AND SUBSURFACE CONDITIONS 7KHORFDWLRQRIWKHSURSRVHGUHWDLQLQJZDOOLVSUHVHQWO\DVWHHSKHDYLO\ZRRGHGVORSH DORQJ WKH QRUWKHUQ ERXQGDU\ RI WKH &RP(G 52: 7KH VORSH IRUPV WKH VRXWKHUQ VKRUHOLQHRIDQH[LVWLQJ%DVVDQG*LOO&OXESRQG 6WULNH/DNH :HXQGHUVWDQGWKH VPDOOODNHVFRYHULQJWKHSURSHUW\ZHUHFUHDWHGDVDUHVXOWRISUHYLRXVVDQGDQGJUDYHO TXDUU\RSHUDWLRQV7KHGHSWKRIWKHODNHLQWKLVDUHDDVPHDVXUHGDWWKHERULQJVUDQJHV IURPDERXWIHHWDW(%0WKUX(0% IHHWDW(0%DQG(0% IHHWDW(0% IHHWDW(0% DQGIHHWDW(0%DQG(0% 7KH IROORZLQJ VHFWLRQV SURYLGH D JHQHUDO GHVFULSWLRQ RI WKH W\SLFDO VRLO SURILOHV HQFRXQWHUHGLQWKHDUHDRIWKHSURSRVHGUHWDLQLQJZDOO6SHFLILFVRLOFRQGLWLRQVIRXQGDW WKHERULQJORFDWLRQVFDQEHIRXQGRQWKHERULQJORJVLQFOXGHGLQ$SSHQGL['RIWKH UHSRUW +DQGDXJHUERULQJV(0%(0%DQG(0%ZHUHSHUIRUPHGDORQJWKHVRXWK VKRUHOLQHRIWKH%DVVDQG*LOO&OXESRQG 6WULNH/DNH 7KHVXEVXUIDFHVRLOVJHQHUDOO\ FRQVLVWHG RI WR IHHW RI WRSVRLOVLOW\ FOD\FOD\H\ JUDYHOVLOW\ VDQG DQG JUDYHO ILOO RYHUO\LQJVDQGDQGJUDYHOFOD\H\VDQGDQGJUDYHODQGIUDFWXUHGURFN Page 197 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 3 - 6RLO ERULQJV (0% WKUX (0% DQG (0% WKUX (0% ZHUH SHUIRUPHG ZLWKLQWKH%DVVDQG*LOO&OXESRQGDORQJWKHVRXWKVKRUHOLQH6RLOVHQFRXQWHUHGDWWKH ERWWRPRIWKHSRQGUDQJHGLQWKLFNQHVVIURPDERXWWRIHHWDQGJHQHUDOO\FRQVLVWHG RIPHGLXPGHQVHWRYHU\GHQVHVDQGVVLOW\VDQGVVLOW\ORDPVLOW\FOD\ORDPVDQGDQG JUDYHODQGPL[WXUHVRIWKHVHVRLOVZLWKIUDFWXUHGURFN%HORZWKHVHPDWHULDOVGRORPLWLF EHGURFN ZDV HQFRXQWHUHG DW DSSUR[LPDWH HOHYDWLRQV WR IHHW &RUHV RI WKH EHGURFNLQGLFDWHG54'YDOXHVUDQJLQJIURPWRDQGFRPSUHVVLYHVWUHQJWKVRI WRSVL SECTION 06: WATER TABLE CONDITIONS $VWKHERULQJVZHUHSHUIRUPHGZLWKLQ%DVVDQG*LOOSRQGRUDORQJWKHSHULPHWHURIWKH SRQG JURXQGZDWHU LV HVWLPDWHG WR EH DW WKH OHYHO RI VXUIDFH ZDWHU ZKLFK ZDV HQFRXQWHUHGDWDSSUR[LPDWHHOHYDWLRQIHHW)OXFWXDWLRQVLQWKHDPRXQWRIZDWHU DFFXPXODWHG DQG LQ WKH K\GURVWDWLF ZDWHU WDEOH FDQ EH DQWLFLSDWHG GHSHQGLQJ RQ YDULDWLRQVLQSUHFLSLWDWLRQDQGVXUIDFHUXQRII7KHZDWHUOHYHOUHDGLQJVDUHVKRZQRQWKH LQGLYLGXDOERULQJORJV SECTION 07: ANALYSES Seismic Analysis $FFRUGLQJ WR WKH $$6+72 /5)' %ULGJH 'HVLJQ 6SHFLILFDWLRQ WK HGLWLRQ WKH SURMHFWVLWHKDVDKRUL]RQWDO5HVSRQVH6SHFWUDO$FFHOHUDWLRQ&RHIILFLHQWRI 6 $$6+72)LJXUH DWDSHULRGRIVHFRQGDQGFULWLFDOGDPSHQLQJDQG 6V $$6+72 )LJXUH DW D SHULRG RI VHFRQGV DQG FULWLFDO GDPSHQLQJDQGD6LWH&ODVV &DFFRUGLQJWRWKHVRLOFRQGLWLRQV7KLVUHVXOWVLQD'HVLJQ 6SHFWUDO$FFHOHUDWLRQDWVHFRQG 6' DQGDWVHFRQGV 6'V DQG WKLVUHVXOWVLQWKHVLWHEHLQJGHVLJQDWHGDV6HLVPLF3HUIRUPDQFH=RQH 7KHSURMHFW VLWHLVFRQVLGHUHGWREHLQDORZVHLVPLFDUHD/LTXHILDEOHOD\HUVDQGVFRXUDUHQRW H[SHFWHGWRLPSDFWWKHGHVLJQRIWKHQHZHPEDQNPHQWDQGUHWDLQLQJZDOO7DEOH FRQWDLQVDVXPPDU\RIWKHVHLVPLFGDWDWREHXVHGIRUGHVLJQ Table 3 – Seismic Data Summary 6LWH&ODVV&SHU86*6 6' 6'V 6HLVPLF3HUIRUPDQFH=RQH Page 198 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 4 - Settlement Analysis %DVHGRQWKHUG6WUHHWUHWDLQLQJZDOOGUDZLQJVDQGFURVVVHFWLRQVSURYLGHGE\&07 DSURSRVHGPD[LPXPZDOOKHLJKWRIIHHWKDVEHHQHYDOXDWHGIRUVHWWOHPHQWEDVHGRQ WKH (0% VRLO SURILOH 'XH WR WKH SUHVHQFH RI SULPDULO\ JUDQXODU VRLOV DW WKH HPEDQNPHQWDQGEHORZWKHUHWDLQLQJZDOOVHWWOHPHQWFRQFHUQVDUHQRWDQWLFLSDWHGIRU WKHSURSRVHGUHWDLQLQJZDOO7KHFDOFXODWHGVHWWOHPHQWZDVOHVVWKDQLQFKIRU(0% 6HWWOHPHQWRIJUDQXODUVRLOVXVHGIRUFRQVWUXFWLRQRIWKHURFNILOOHPEDQNPHQWDQG UHWDLQLQJZDOOVKRXOGRFFXUDVWKHPDWHULDOLVEHLQJSODFHGDQGFRPSDFWHG Slope Stability Analysis )RUVORSHVWDELOLW\FDOFXODWLRQVWKHVORSHVWDELOLW\SURJUDP 67$%/9 ZDVXVHGWR FDOFXODWHIDFWRUVRIVDIHW\ )26 DWUHSUHVHQWDWLYHFURVVVHFWLRQVDORQJWKHSURSRVHG UHWDLQLQJ ZDOO %DVHG RQ WKH VORSH VWDELOLW\ DQDO\VHV WKH )26 IRU ERWK VKRUWWHUP XQGUDLQHG DQGORQJWHUP GUDLQHG FRQGLWLRQVDUHJUHDWHUWKDQDQGPHHWWKH)26 UHTXLUHPHQWV IRU D ILOO ZDOO SHU ,'27 UHTXLUHPHQWV 7KHUH DUHQR VORSH VWDELOLW\ FRQFHUQVIRUWKHUHWDLQLQJZDOO *UDSKLFDORXWSXWVDUHVKRZQLQ$SSHQGL[(RIWKLVUHSRUW7KHIROORZLQJWDEOHVKRZVWKH VXPPDU\RIWKHJOREDOVWDELOLW\IDFWRURIVDIHW\ )26 FDOFXODWHGIRUWKHVKRUWWHUPDQG ORQJWHUPVRLOFRQGLWLRQVRIWKHSURSRVHG06(ZDOOHPEDQNPHQW Table 2 – Summary of Slope Stability :DOO6WDWLRQ/LPLWV $OLJQPHQW 6RLO%RULQJ8VHG IRU6ORSH6WDELOLW\ $QDO\VLV &DOFXODWHG)DFWRURI6DIHW\ )26 8QGUDLQHG 7RWDO6WUHVV &RQGLWLRQ 'UDLQHG (IIHFWLYH 6WUHVV &RQGLWLRQ 6WDWLRQ(0% 1RWHV %RULQJXVHGIRU6ORSH6WDELOLW\$QDO\VLVZDVEDVHGRQWKHDSSDUHQWZRUVWFDVHVRLOSURILOHZLWKLQWKHZDOOVWDWLRQOLPLWV 67$%/ Y %LVKRS0HWKRGZDVXVHGIRU*OREDO6ORSH6WDELOLW\DQDO\VLV SECTION 08: FOUNDATION RECOMMENDATIONS Recommended Wall Types 7KHPD[LPXPZDOOKHLJKWLVHVWLPDWHGWREHDSSUR[LPDWHO\IHHW IURPWRSRIOHYHOLQJ SDGIRUWKHIRRWLQJWRWRSRIH[SRVHGZDOOSDQHO ,WLVDOVRQRWHGWKDWDQHPEDQNPHQW QHHGV WR EH FRQVWUXFWHG ZLWK DSSURSULDWH URFN ILOO PDWHULDOV LQ RUGHU WR VXSSRUW WKH Page 199 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 5 - SURSRVHG UG 6WUHHW UHWDLQLQJ ZDOO DQG QHZ URDGZD\ ORFDWHG QRUWK RI WKH &RP(G 52:DQGZLWKLQWKHH[LVWLQJ%DVVDQG*LOO&OXESRQGDUHD %DVHGRQWKHVRLOFRQGLWLRQVVKRZQRQWKHERULQJORJVDQGZDOOVLWHJHRPHWU\ ILOODUHD UHFRPPHQGHGZDOOW\SHVLQFOXGHDQ06(ZDOOZLWKSUHFDVWFRQFUHWHSDQHOVRUDSUHFDVW PRGXODUUHWDLQLQJZDOOV\VWHP6ROGLHUSLOHDQGVKHHWSLOHZDOOVDUHQRWUHFRPPHQGHG GXHWRWKHSUHVHQFHRIVKDOORZEHGURFNWKDWZRXOGLPSHGHSLOHGULYLQJDVZHOODVWKH DGGLWLRQDOZDOOKHLJKWZKLFKZRXOGUHTXLUHRQHRUPRUHOHYHOVRIWLHEDFNV (FRQRPLFFRQVWUXFWLRQDQGVFKHGXOLQJIDFWRUVVKRXOGEHHYDOXDWHGIRUWKHGHFLVLRQRI UHWDLQLQJZDOOGHVLJQ7KHIROORZLQJSURYLGHVDJHQHUDOGLVFXVVLRQRIVRLOFRQGLWLRQVDV WKH\UHODWHWRWKHUHWDLQLQJZDOOFRQVWUXFWLRQ MSE Wall Recommendations %DVHGRQWKH76 /SODQVSURYLGHGWRXVE\&07DQ06(ZDOOV\VWHPLVSURSRVHGIRU WKHUG6WUHHWUHWDLQLQJZDOO61 :&RQVLGHULQJWKHSURSRVHGQHZURFNILOO HPEDQNPHQWVRLOVWKHVRLOVDWSURSRVHGEDVHRIZDOOZLOOEHVXLWDEOHIRUVXSSRUWLQJWKH UHWDLQLQJZDOO$PD[LPXPIDFWRUHGEHDULQJUHVLVWDQFHRISVI XVLQJDUHVLVWDQFH IDFWRU RI FRXOG EH XVHG IRU GHVLJQ RI DQ 06( UHWDLQLQJ ZDOO 5HLQIRUFHPHQW VWUDSVOD\HUVKDYLQJDPLQLPXPOHQJWKRIWLPHVWKHZDOOKHLJKWLVUHFRPPHQGHGIRU 06(:DOOV\VWHPSHU$$6+72/5)'GHVLJQ 6RLOV VKRXOG EH YHULILHG LQ WKH ILHOG DW WKH WLPH RI FRQVWUXFWLRQ E\ DQ H[SHULHQFHG *HRWHFKQLFDO(QJLQHHURUWKHLUUHSUHVHQWDWLYH$FWXDOH[WHQWVRIUHPHGLDOWUHDWPHQWVLI DQ\ZLOOEHGHWHUPLQHGDWWKLVWLPH,IVRLOVZLWKOHVVWKDQDGHTXDWHEHDULQJVWUHQJWK DUHQRWHGDWWKHIRXQGDWLRQOHYHOGXULQJIRRWLQJFRQVWUXFWLRQLQILHOGWKHZHDNHUVRLOV HQFRXQWHUHGDWWKHEDVHRIWKHIRRWLQJVVKRXOGEHXQGHUFXWWRUHDFKVXLWDEOHEHDULQJ VRLOV DQG WKH XQGHUFXW DUHD ILOOHG ZLWK OHDQ FRQFUHWH RU DQ DSSURYHG FRPSDFWHG VWUXFWXUDO JUDQXODU ILOOPDWHULDO,QSDUWLFXODUZHZRXOGH[SHFWWKDWXQVXLWDEOHVRLOVZLOO EHIRXQGZLWKLQWKHH[LVWLQJGHWHQWLRQSRQGDQGXQGHUFXWVZLOOEHUHTXLUHG$UHDVZKHUH UHPHGLDWLRQWUHDWPHQWDUHDQWLFLSDWHGDUHSURYLGHGLQ7DEOHEHORZ 6WUXFWXUDO ILOO VKRXOG EH SODFHG LQ PD[LPXP LQFK ORRVH OLIWV &$ VKRXOG EH FRPSDFWHGWRDPLQLPXPRI RIWKHPD[LPXPGU\GHQVLW\REWDLQHGLQDFFRUGDQFH ZLWK$6706WDQGDUG'PRGLILHG3URFWRUPHWKRG7KHPRLVWXUHFRQWHQWRIWKH &$ILOOVKRXOGEHFRQWUROOHGZLWKLQRIWKHRSWLPXPPRLVWXUHFRQWHQW&$DQG &$PDWHULDOVFDQEHFRPSDFWHGE\SODFLQJLQOLIWVDQGWDPSLQJZLWKDEDFNKRHEXFNHW RUUROOLQJZLWKDYLEUDWRU\GUXPFRPSDFWRUWRDFKLHYHVROLGDJJUHJDWHLQWHUORFN (PEDQNPHQW ILOO EHKLQG WKH ]RQH RI 06( ZDOO UHLQIRUFHG ILOO VKRXOG EH SODFHG LQ FRPSOLDQFHZLWK6HFWLRQRIWKH,'276WDQGDUG6SHFLILFDWLRQVIRU5RDGDQG%ULGJH &RQVWUXFWLRQ 7KH 06( ZDOO EDFNILOO VKRXOG FRQVLVW RI D FRPSDFWHG IUHHGUDLQLQJ JUDQXODUPDWHULDO$SURSHUGUDLQDJHV\VWHPVKRXOGEHGHVLJQHGDQGSURYLGHGEHKLQG 06(ZDOODQGFDQWLOHYHUZDOOV7KHFKRVHQUHWDLQLQJZDOOW\SHVKRXOGEHGHVLJQHGE\ DQ,OOLQRLVOLFHQVHG6WUXFWXUDO(QJLQHHU Page 200 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 6 - 7R SURYLGH DGHTXDWH IURVW SURWHFWLRQ ZH UHFRPPHQG WKH ERWWRP RI DQ 06( ZDOO IRRWLQJOHYHOLQJSDGEHDPLQLPXPRIIHHWEHORZILQDOJUDGH SECTION 09: CONSTRUCTION CONSIDERATIONS %HWZHHQ DSSUR[LPDWHO\ 6WDWLRQV DQG WKH SURSRVHG UHWDLQLQJ ZDOO H[WHQGVLQWRDQH[LVWLQJ%DVVDQG*LOO&OXESRQG7KHSRQGZDWHUVXUIDFHHOHYDWLRQLV DSSUR[LPDWHO\ IHHW ZDWHU GHSWKV DORQJ WKH SURSRVHG QRUWKHUQ VLGH RI WKH UHWDLQLQJZDOOUDQJHGIURPWRIHHWDQGWKHERWWRPRISRQGHOHYDWLRQUDQJHGIURP DQG IHHW $IWHU VWULSSLQJ YHJHWDWLRQ DQG FOHDULQJJUXEELQJ WKH H[LVWLQJ VRXWKVORSHRIWKH%DVVDQG*LOO&OXESRQGDQGSULRUWRDQ\URFNILOOSODFHPHQWWKH H[LVWLQJVORSHVKRXOGEHEHQFKHGWRNH\WKHQHZILOOLQWRWKHH[LVWLQJVORSHDQGUHGXFH SRWHQWLDO IRU D VORSH IDLOXUH $ERYH WKH ZDWHU OHYHO WKH KRUL]RQWDO EHQFKHV VKRXOG JHQHUDOO\EHZLGHHQRXJKWRRSHUDWHHDUWKPRYLQJHTXLSPHQW IHHWPLQLPXP DQGQR PRUHWKDQIHHWKLJK 7KHURFNILOOVKRXOGH[WHQGDWOHDVWWRIHHWKRUL]RQWDOO\EH\RQGWKHIDFHRIWKHZDOO DQGDWOHDVWIHHWDERYHWKHQRUPDOZDWHUOHYHO DSSUR[LPDWHHOHYDWLRQIHHW LQ RUGHUWRSURYLGHDVXLWDEOHGU\ZRUNLQJSODWIRUPIRUWKH06(ZDOOFRQVWUXFWLRQ7KHURFN ILOOVKRXOGPHHWWKHUHTXLUHPHQWVRI6HFWLRQRIWKH,'276WDQGDUG6SHFLILFDWLRQV $PLQLPXPLQFKWKLFNEHGGLQJOD\HUVXFKDVJUDGDWLRQ55VKRXOGEHSODFHGRQWKH ERWWRPRIWKHSRQGSULRUWRSODFLQJODUJHUURFNILOOVXFKDVJUDGDWLRQ55$³WRHEHUP´ RIODUJHUURFN VXFKDVJUDGDWLRQ55 VKRXOGDOVREHFRQVLGHUHGDORQJWKHWRHRIWKH QHZURFNILOOVORSHWRDLGLQHVWDEOLVKLQJWKHKRUL]RQWDOOLPLWRIWKHILOOXQGHUZDWHU2QFH WKHURFNILOOVXUIDFHLVDERYHZDWHUOHYHOKHDY\YLEUDWRU\FRPSDFWLRQHTXLSPHQWVKRXOG EHXVHGWRLPSURYHWKHDJJUHJDWHLQWHUORFNDQGUHGXFHSRWHQWLDOIRUIXWXUHPRYHPHQWRI WKHPDWHULDOV 8SRQ FRPSOHWLRQ RI URFNILOO SODFHPHQW WR GHVLUHG HOHYDWLRQ D QRPLQDO LQFK WKLFN FDSSLQJOD\HURI&$RU&$JUDGHGFUXVKHGVWRQHRUUHF\FOHGFRQFUHWHVKRXOGEH SODFHGDERYHWKHURFNILOOWRRFFXS\WKHYRLGVDQGSURYLGHIRUDOHYHOZRUNLQJVXUIDFH$ OD\HURIQRQZRYHQJHRWH[WLOHIDEULFVKRXOGEHSODFHGRYHUWKHFDSSLQJOD\HUSULRUWR SODFHPHQWRI06(ZDOOW\SHILOODQGVXEVHTXHQWUHWDLQLQJZDOOFRQVWUXFWLRQ $OOH[FDYDWLRQVVKRXOGEHSHUIRUPHGLQDFFRUGDQFHZLWKWKHODWHVW2FFXSDWLRQDO6DIHW\ DQG+HDOWK$GPLQLVWUDWLRQ 26+$ UHTXLUHPHQWV$OORZDQFHVVKRXOGEHPDGHIRUDQ\ VXUFKDUJH ORDGV DGMDFHQW WR WKH UHWDLQLQJ VWUXFWXUHV ([FDYDWLRQ VDIHW\ LV WKH UHVSRQVLELOLW\RIWKHFRQWUDFWRU KRZHYHUDFFRUGLQJWR26+$UHJXODWLRQVWKHH[FDYDWLRQ VLGHVVKRXOGEHVORSHGDW+ 9RUIODWWHUDERYHWKHZDWHUWDEOHIRUWKLVSXUSRVH 6WRFNSLOHVRIPDWHULDORUHTXLSPHQWVKRXOGQRWEHSODFHGQHDUWKHWRSRIH[FDYDWLRQ VORSHV *URXQGZDWHU VHHSDJH WKURXJK WKH ILOO PDWHULDOV DQG QDWLYH VRLOV FDQ EH DQWLFLSDWHG GXULQJRSHQFXWH[FDYDWLRQVRXWVLGHWKHSRQGDQGDERYHWKHSRQGZDWHUOHYHO:H Page 201 143RD STREET EXTENSION STRUCTURE GEOTECHNICAL REPORT RETAINING WALL SN 099-W028 EB(R) GSI PROJECT NUMBER 18117 WILL COUNTY,IL - 7 - DQWLFLSDWHWKDWVWDQGDUGVXPSSXPSDQGSLWSURFHGXUHVVKRXOGEHDGHTXDWHWRUHPRYH DQ\ZDWHUWKDWDFFXPXODWHGLQWKHXQGHUFXWDUHD$Q\VXUIDFHZDWHUWKDWDFFXPXODWHV LQWKHH[FDYDWLRQVGXULQJFRQVWUXFWLRQDORQJZLWKDQ\VRIWHQHGGLVWXUEHGRUIUR]HQVRLO VKRXOGEHUHPRYHGSULRUWRWKHSODFHPHQWRIDQ\SURSRVHGFRQFUHWHVODEIRXQGDWLRQ $OOVRLOVZKLFKEHFRPHVRIWHQHGRUORRVHQHGDWWKHEDVHRIHPEDQNPHQWILOODUHDVRU VXEJUDGH DUHDV VKRXOG EH FDUHIXOO\ UHFRPSDFWHG RU UHPRYHG SULRU WR SODFHPHQW RI DGGLWLRQDOILOOPDWHULDO1RVWUXFWXUDOILOOVKRXOGEHSODFHGLQDUHDVRISRQGHGZDWHURU IUR]HQVRLO SECTION 10: GENERAL QUALIFICATIONS 7KHDQDO\VLVDQGUHFRPPHQGDWLRQVSUHVHQWHGLQWKLVUHSRUWDUHEDVHGXSRQWKHGDWD REWDLQHGIURPWKHVRLOERULQJVSHUIRUPHGDWWKHLQGLFDWHGORFDWLRQVDQGIURPDQ\RWKHU LQIRUPDWLRQGLVFXVVHGLQWKLVUHSRUW7KLVUHSRUWGRHVQRWUHIOHFWDQ\YDULDWLRQVWKDWPD\ RFFXUEHWZHHQERULQJVRUDFURVVWKHVLWH,QDGGLWLRQWKHVRLOVDPSOHVFDQQRWEHUHOLHG RQ WR DFFXUDWHO\ UHIOHFW WKH VWUDWD YDULDWLRQV WKDW XVXDOO\ H[LVW EHWZHHQ VDPSOLQJ ORFDWLRQV 7KH QDWXUH DQG H[WHQW RI VXFK YDULDWLRQV PD\ QRW EHFRPH HYLGHQW XQWLO FRQVWUXFWLRQ ,I YDULDWLRQV DSSHDU HYLGHQW LW ZLOO EH QHFHVVDU\ WR UHHYDOXDWH WKH UHFRPPHQGDWLRQVRIWKHUHSRUW,QDGGLWLRQLWLVUHFRPPHQGHGWKDW*HR6HUYLFHV,QF EH UHWDLQHG WR SHUIRUP FRQVWUXFWLRQ REVHUYDWLRQ DQG WKHUHE\ SURYLGH D FRPSOHWH SURIHVVLRQDOJHRWHFKQLFDOHQJLQHHULQJVHUYLFHWKURXJKWKHREVHUYDWLRQDOPHWKRG 7KLVUHSRUWKDVEHHQSUHSDUHGIRUWKHH[FOXVLYHXVHRIRXUFOLHQWIRUVSHFLILFDSSOLFDWLRQ WRWKHSURMHFWGLVFXVVHGDQGKDVEHHQSUHSDUHGLQDFFRUGDQFHZLWKJHQHUDOO\DFFHSWHG JHRWHFKQLFDOHQJLQHHULQJSUDFWLFHV1RRWKHUZDUUDQWLHVHLWKHUH[SUHVVHGRULPSOLHG DUHLQWHQGHGRUPDGH,QWKHHYHQWWKDWDQ\FKDQJHVLQWKHQDWXUHGHVLJQRUORFDWLRQRI WKHSURMHFWDVRXWOLQHGLQWKLVUHSRUWDUHSODQQHGWKHFRQFOXVLRQVDQGUHFRPPHQGDWLRQV FRQWDLQHGLQWKLVUHSRUWVKDOOQRWEHFRQVLGHUHGYDOLGXQOHVVWKHFKDQJHVDUHUHYLHZHG DQGWKHFRQFOXVLRQVRIWKLVUHSRUWPRGLILHGRUYHULILHGLQZULWLQJE\WKHJHRWHFKQLFDO HQJLQHHU$OVRQRWHWKDW*HR6HUYLFHV,QFLVQRWUHVSRQVLEOHIRUDQ\FODLPVGDPDJHV RU OLDELOLW\ DVVRFLDWHG ZLWK DQ\ RWKHU SDUW\¶V LQWHUSUHWDWLRQ RI WKLV UHSRUW¶V VXEVXUIDFH GDWD RU UHXVH RI WKH UHSRUW¶V VXEVXUIDFH GDWD RU HQJLQHHULQJ DQDO\VHV ZLWKRXW WKH H[SUHVVZULWWHQDXWKRUL]DWLRQRI*HR6HUYLFHV,QF Page 202 APPENDIX A Site Location Map Page 203 6,7(/2&$7,210$3'5$:1%<'7 UG6WUHHW([WHQVLRQ%ULGJH 6WUXFWXUH 61 :(% 5 %HWZHHQ,/ 86WR,/ 9LOODJHRI3ODLQILHOG,OOLQRLV $33529('%< $3 '$7(2FWREHU *6,-2%1R 6&$/(176 *HR6HUYLFHV,QF 6,7(/2&$7,21 Page 204 APPENDIX B Boring Location Plan Page 205 ?BHPEDQNPHQWSOQGJQ 30Page 206 ?BHPEDQNPHQWSOQGJQ 30Page 207 APPENDIX C Final TS&L Page 208 Page 209 APPENDIX D Boring Logs Page 210 � � � � � � � ! " # $ % % & � ' �( # " ) % * �+ � , - ) ! " # ! $ . # / . 0 % ) 1 � % 2 ) " # % 3 . % / � � ) 2 ) � % * ) % . . " ) % * 4 � 3 0 . " 5 / � # 6 " / 1 � 6 ) / . � 7 . " 2 ) . 1 � ) % # ) 5 � 8 9 � 4 4 % # ! # & ' ' & $ ' $ : : " & � / � ; / . % 5 ) # % � " # < . / �( . / $ . . % � � 1 �! ) * . �# ' � ) % ' ) . & 1 � ) % # ) 5 & ' � = 1 � $ � 1 � $ � 1 �& ' $ � 1 � " & ( � = = ' ) # * ( ! + $ & ' ' $ ) & 4 > ( , ( # : ( 4 ? ' / � ) * 0 / # * - ( + $ . ( # / # ! # # * 0 1 # , / % ( + * # * ! ( * 2 3 4 + , " 4 / ( " 4 # 0 / ' ( + / 0 / + ( - 2 + - ( + # ( ! / ( 0 1 + # , 5 # 6 6 7 8 " 0 9 : ; & $ < 4 = = & ' 1 # 0 1 + # 6 6 ' ( 0 * + $ $ : % 6 6 & ) � % & � 6 * . " ( ! ( + $ > 2 ' $ @ A B C B 4 B 4 > � : 1 � � � D 1 � E 1 � B 4 > �( � B 4 > F C �� = = P a g e 2 1 1 4 > 4 4 44 44 44 ( - E G H "#$%3.&)63Ɩ&.%5. Ɩ Ɩ ! "#$%&.%5. E G H "#$%3.&)63Ɩ&.%5. Ɩ 1Ɩ ! Ɩ E G Ɩ H *"I&.%5. Ɩ Ɩ :Ɩ$)/0 E"/6".&Ɩ #*"I2."IƖ&.%5. ")."5Ɩ5."2/)#%AƖ77".%/ (.&"# ")."5Ɩ5."2/)#%AƖ77".%/ (.&"#Ɩ (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = >= ') #* (! + $ & '' $ )& 4 > (, ( # :( ?4 '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ 4 > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 212 Page 213 4 4 4 4 4 4> 4 ( - Ɩ 1Ɩ ! Ɩ E G H "#$%3.&)63Ɩ&.%5. .#3)%*Ɩ*"IƖ+Ɩ , Ɩ Ɩ :Ɩ$)/0 E"/6".&Ɩ #*"I3.&)63 &.%5. Ɩ Ɩ ! *"I &.%5. ")."5Ɩ5."2/)#%AƖ77".%/ (.&"# %&Ɩ'Ɩ(#")%*Ɩ+Ɩ , -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = >= ') #* (! + $ & '' $ )& 4 > (, ( # :( ? '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ 6*." (! ( + $ > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 214 4 4 =J > = J = J > 4 44 ( - Ɩ Ɩ ! &" "#$%3.&)63Ɩ&.%5. Ɩ:Ɩ$)/0ƖE"/6".& #*"I3.&)63Ɩ&.%5. E G Ɩ H Ɩ ! "#$%2."I Ɩ&.%5. (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :( ? '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ 4 > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 215 Page 216 4 = J > 4 4 4 44 4 4 ( - Ɩ Ɩ ! "#$%3.&)63 &.%5. Ɩ:Ɩ$)/0ƖE"/6".& #*"I&.%5. E G Ɩ H *"I2."I &.%5. ")."5Ɩ5."2/)#%AƖ77".%/ (.&"# %&Ɩ'Ɩ(#")%*Ɩ+Ɩ, -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :( ?>4 '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ 6*." (! ( + $ > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 217 4 > =J 44 44 ("*. - /." Ɩ Ɩ ! "#$%3.&)63 Ɩ&.%5.Ɩ/# &.%5. ƖE G H "#$%2."IƖ&.%5. ƖE G H "#$%2."IƖ&.%5. (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :( ? '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 218 Page 219 � � � � � � 4 � � : " # $ % � : �$ ) / 0 � " 2 . & " " # $ % � � ! " # $ % E G � H % & � ' �( # " ) % * �+ � , - ) ! " # ! $ . # / . 0 % ) 1 � % 2 ) " # % 3 . % / � � ) 2 ) � % * ) % . . " ) % * 4 � 3 0 . " 5 / � # 6 " / 1 � 6 ) / . � 7 . " 2 ) . 1 � ) % # ) 5 � 8 9 � 4 4 % # ! # " I & ' ' & $ ' $ : : " & � / � ; / . % 5 ) # % � " # < . / �( . / $ . . % � � 1 �! ) * . �# ' � ) % ' ) . & 1 � ) % # ) 5 & ' � = 1 � $ � 1 � $ � 1 �& ' $ � 1 � " & ( � = = ' ) # * ( ! + $ & ' ' $ ) & 4 > ( , ( # : ( > 4 ? > ' / � ) * 0 / # * - ( + $ . ( # / # ! # # * 0 1 # , / % ( + * # * ! ( * 2 3 4 + , " 4 / ( " 4 # 0 / ' ( + / 0 / + ( - 2 + - ( + # ( ! / ( 0 1 + # , 5 # 6 6 7 8 " 0 9 : ; & $ < 4 = = & ' 1 # 0 1 + # 6 6 ' ( 0 * + $ $ : % 6 6 & ) � % & � 6 * . " ( ! ( + $ > 2 ' $ @ A B C B 4 B 4 > � : 1 � � � D 1 � E 1 � B 4 > �( � B 4 > F C �� = = P a g e 2 2 0 4 4 =J 4 4 4 44 44 ("*. - /." Ɩ Ɩ ! "#$%3.&)63 &.%5. Ɩ Ɩ ! *"I &.%5. Ɩ Ɩ :Ɩ$)/0 E"/6".&Ɩ #*"I2."IƖ5/)'' E G Ɩ H *"I2."I &.%5. (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :(4 ?> 4'/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ 4 > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 221 Page 222 > =J 4 4 4> 44 ("*. - /." Ɩ :"#$%3.&)63 &.%5. ƖE G H *"I2."IƖ&.%5. ").",5Ɩ5."2/)#%AƖ77".%/ (.&"# (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 4 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :( ? ' /Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ 4 > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 223 Page 224 4 > =J > 4 4 4 4 4 ("*. - /." Ɩ Ɩ ! "#$%3.&)63 &.%5. Ɩ :*"I&.%5. Ɩ:Ɩ$)/0ƖE"/6".& #*"I&.%5. E G Ɩ H *"I2."I &.%5. ").",5Ɩ5."2/)#%AƖ77".%/ (.&"# ").",5Ɩ5."2/)#%AƖ77".%/ (.&"#Ɩ (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ = = ') #* (! + $ & '' $ )& 4 > (, ( # :( ? '/Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 225 Page 226 4 > =J =J = J 4 4 4 ("*. - /." Ɩ Ɩ ! "#$%3.&)63 &.%5. Ɩ :*"I3.&)63Ɩ&.%5. Ɩ:Ɩ$)/0ƖE"/6".& #*"I2."IƖ&.%5. E G Ɩ H *"I2."I &.%5. (#".0#.Ɩ#%/)%6.&Ɩ$)/0Ɩ"# #")%* -) ! " #!$ .#/.0%)1Ɩ %2)"# % 3.%/Ɩ Ɩ)2)Ɩ %*)%..")%* 4Ɩ 30."5/Ɩ#6"/1Ɩ6)/.Ɩ 7."2).1Ɩ)%#)5Ɩ 89Ɩ44 % #! # %= %= & ' ' &$' $ "&Ɩ/Ɩ ;/.%5)#%Ɩ"#<./Ɩ(./$..%Ɩ Ɩ 1Ɩ!)*.Ɩ#'Ɩ)%').&1Ɩ)%#)5 & ' Ɩ = 1Ɩ $Ɩ1Ɩ$Ɩ 1Ɩ&'$Ɩ 1Ɩ "& ( Ɩ == ') #* (! + $ & '' $ )& 4 > (, ( # :( ? ' /Ɩ.'/ #*-( + $. ( # / #! # # * 01 #,/ %( + * #* !( *234+, " 4 / ( "4 # 0 / ' (+ / 0 / +(- 2+ - (+ # (!/(01+ #,5 # 66 78 " 09:;& $<4== & ' 1 # 01+ # 6 6 ' (0 *+ $ $ : Ɩ6 /#3/)6 &)ۯ##$Ɩ/.3Ɩ6*."=Ɩ #/"I (! ( + $ > 2' $@AB C B 4B 4 >Ɩ: 1Ɩ Ɩ Ɩ D 1Ɩ E 1 ƖB 4 >Ɩ( Ɩ B 4 > F CƖƖ == Page 227 Page 228 � � � � 4 > � & " � " # $ % �8 E ) 9 � ! " # $ % �8 E ) 9 � � � ! 8 7 7 " . % / �E ) 9 � � ! " # $ % % & � ' �( # " ) % * �+ � , - ) ! " # ! $ . # / . 0 % ) 1 � % 2 ) " # % 3 . % / � � ) 2 ) � % * ) % . . " ) % * 4 � 3 0 . " 5 / � # 6 " / 1 � 6 ) / . � 7 . " 2 ) . 1 � ) % # ) 5 � 8 9 � 4 4 % # ! # " I & ' ' & $ ' $ " & � / � ; / . % 5 ) # % � " # < . / �( . / $ . . % � � 1 �! ) * . �# ' � ) % ' ) . & 1 � ) % # ) 5 & ' � = 1 � $ � 1 � $ � 1 �& ' $ � 1 � " & ( � = = ' ) # * ( ! + $ & ' ' $ ) & 4 > ( , ( # : ( ? 4 4 ' / � . ' / # * - ( + $ . ( # / # ! # # * 0 1 # , / % ( + * # * ! ( * 2 3 4 + , " 4 / ( " 4 # 0 / ' ( + / 0 / + ( - 2 + - ( + # ( ! / ( 0 1 + # , 5 # 6 6 7 8 " 0 9 : ; & $ < 4 = = & ' 1 # 0 1 + # 6 6 ' ( 0 * + $ $ : % 6 6 & ) � % & � 6 * . " ( ! ( + $ > 2 ' $ @ A B C B 4 B 4 > � : 1 � � � D 1 � E 1 � B 4 > �( � B 4 > F C �� = = P a g e 2 2 9 APPENDIX E Slope Stability Calculations Page 230 Page 231 Page 232 )OHWFKHU/DNH&RPSHQVDWLRQ APPENDIX F: SITE PHOTOGRAPHS Page 233 )OHWFKHU/DNH&RPSHQVDWLRQ6LWH±3ODLQILHOG:LOO&R,/3KRWRJUDSKLF/RJ 9LHZRIJUDVVODZQDQG)OHWFKHU/DNHZLWKLQZHVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHD 9LHZRIZRRGHGDUHDZLWKLQZHVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHDPage 234 )OHWFKHU/DNH&RPSHQVDWLRQ6LWH±3ODLQILHOG:LOO&R,/3KRWRJUDSKLF/RJ 9LHZRIZRRGHGDUHDZLWKLQZHVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHD 9LHZRI:HWODQG&ZLWKLQZHVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHDPage 235 )OHWFKHU/DNH&RPSHQVDWLRQ6LWH±3ODLQILHOG:LOO&R,/3KRWRJUDSKLF/RJ 9LHZRIZRRGHGDUHDZLWKLQHDVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHD 9LHZRIZRRGHGDUHDZLWKLQHDVWHUQ)OHWFKHU/DNHPLWLJDWLRQDUHDPage 236 To: Bureau of Local Roads Attn: William Raffensperger From: Jack Elston By: Brad Koldehoff Subject: Cultural Resources - No Historic Properties Affected Clearance Date: April 1, 2020 Will County FAU 0350, 143rd Street Plainfield Sec. 06-00040-00-FP Seq.13370D For the above referenced undertaking, IDOT’s qualified Cultural Resources staff hereby make a “No Historic Properties Affected” finding pursuant to Section 106 of the National Historic Preservation Act. This finding concludes the Section 106 process in accordance with the stipulations of the Programmatic Agreement Regarding Section 106 Implementation for Federal-Aid Transportation Projects in the State of Illinois, executed March 6, 2018 by FHWA, Illinois SHPO, IDOT and the Advisory Council on Historic Preservation. No further cultural resources coordination is required for this undertaking, unless design modifications or new information indicate that historic properties may be affected. If so, then, additional coordination with my office is required. Brad H. Koldehoff Cultural Resources Unit Chief Bureau of Design & Environment Page 237 Cultural Resources Cleared for DA:04/01/2020 Cleared for Letting:04/01/2020 Submittal Date:10/26/2018 Sequence No:13370 Village of Plainfield Contract #:91-200-08 Route:FAU 0350 Marked: Street:143rd Street Section:06-00040-00-FP District:1 Counties:Will Municipalityies):Plainfield 1.3 FromTo (At):IL Route 59 to IL Route 126 Quadrangle:Plainfield Township-Range-Section:T36N-R9E-S3, 4 &9 Anticipated DA:12/01/2019 acres30 Project Length:km miles2.0921 Acquisition of additional ROW or easement ha/12.14055 Proposed Work: Project Description:The project limits have moved due to the inability to acquire right of w ay from ComEd. Highw ay Bridge Funding: Bike Trail Other Federal State TBP MFT Local Non-MFT Anticipated Processing:CE Requesting Agency:Local Job No.:P- D Project No: Historic Bridges 03/31/2020 District Notified:04/01/2020 District Notified: Sent for Survey ISAS:SHPO Concurrence: District Notified: Historic District Involved:Historic Building Involved: Architectural Photos Requested:Photos Received: Sent for Architectural Survey:SHPO Concurrence: Overall Cultural Resource Archaeological Resources District Notified: Sent for Archival Recordation:Substitute Bridge Identification: SHPO Submittal: Comments:Printed and given to B Koldehoff for review on 12/20/2018. KMB No survey required per B Koldehoff on 12/5/18. Sent to B Roman for historic review on 1/10/19. KMB Per my email to KMB in Jan 2019, information on the past clearances for this project is needed to move forw ard. This is a 13 year old project w ith past cultural review 10 years ago. BR Historic Resources Invnetory (HRI) found no above ground HPs, per report in file and notes on ESR Tracking Form. NHPA. BR 3/31/2020 Architectural Resources (Standing Structures) In-House Cultural Resources ClearanceYes In-House Archeology Only Clearance In-House Architectural Only Clearance In-House Historic Bridge Only Clearance Survey Target Date:06/14/2019 Page 238 Project Overview Submittal Date:08/07/2006 Sequence No:13370 Plainfield Contract #: Route:143rd Street Marked: Street:143rd Street Extension Section:06-00040-00-FP District:1 Counties:Will Municipality(ies):Village of Plainfield 1 FromTo (At):Illinois Route 59 to Illinois Route 126 Quadrangle:Plainfield Township-Range-Section:T36N-R9E-Sec 2,3,4,9,10,11 Project Length:km miles Anticipated Design Appr.:04/01/2007 1.6093 Anticipated Processing:ECAD Funding:Federal State TBP MFT Local Non-MFT Consultant: PTB No.:Item No.:PTB Date: Requesting Agency:Local Job No.: Prequal Level: Project No:Project Identifier: Survey Target Date: Ente re d By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE BDE 2/8/2010 2/8/2010 2/16/2010 2/16/2010 10/23/2006 10/23/2006 BDE Sequence No:13370 Resubmittal 12/08/2014 ResubmittalCleared 12/8/2014 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.: Ente re d By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE 2/8/2010 2/8/2010 1/22/2007 1/22/2007 BDE Sequence No:13370 A Resubmittal 12/08/2014 ResubmittalCleared 12/8/2014 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.: Ente re d By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE Sequence No:13370 B Resubmittal ResubmittalCleared 91-200-08 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.:P- Ente re d By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste 11/26/2013 BDE Sequence No:13370 C Resubmittal ResubmittalCleared 91-200-08 FromTo (At):Illinois Route 59 to Illinois Route 126 Section:06-00040-00-FP Job No.:P- Ente re d By Cleared for DA Cleared for Letting Biological Wetlands Cultural Special Waste BDE BDE BDE 2/16/2010 2/16/2010 4/1/2020 4/1/2020 7/31/2019 BDE Sequence No:13370 D Resubmittal ResubmittalCleared 91-200-08 FromTo (At):IL Route 59 to IL Route 126 Section:06-00040-00-FP Job No.:P- Page 239 Project Phase Comments: Project Initiation Ltr to FHWA Notice of Intent Notice of Availability Draft Final Public Info Meeting(s) 1st 2nd Public Hearing Draft ROD/FONSI Approved Date In Office: 12/26/2019 Date Out Of Office: 02/21/2020 Comments: Few minor edits. Technical Reports: Noise Page 240 143rd Street Extension, Plainfield, Will Co., IL Tree ,QYHQWRU\ Survey Report 143rd Street Extension Plainfield, Will County, Illinois Section 06--00040-00-FP MARCH 19, 2020 PREPARED BY: CRAWFORD, MURPHY & TILLY, INC. 550 NORTH COMMONS DRIVE SUITE 116 AURORA, IL 60504 PREPARED FOR: VILLAGE OF PLAINFIELD 24401 W. LOCKPORT STREET PLAINFIELD, IL 60544 Page 241 143rd Street Extension, Plainfield, Will Co., IL TABLE OF CONTENTS 1.0 EXECUTIVE SUMMARY................................................................................................. 1 2.0 BACKGROUND INFORMATION..................................................................................... 2 2.1 Project Description....................................................................................................... 2 2.2 Project Location........................................................................................................... 2 3.0 METHODOLOGY............................................................................................................ 7 4.0 RESULTS........................................................................................................................ 7 4.1 Direct Count Inventory (Non-Wooded Areas)............................................................... 7 Tree Type ........................................................................................................................... 7 Tree Health and Structure................................................................................................... 9 Tree Origin.........................................................................................................................10 Screening trees..................................................................................................................10 Suitability for preservation..................................................................................................10 4.2 Tree Survey (Point-Center Quarter Method of Wooded Stands) .................................11 Trees with Special Functions .............................................................................................11 4.3 Specimen Trees..........................................................................................................11 5.0 SUMMARY OF IMPACTS ..............................................................................................14 6.0 MITIGATION REQUIREMENTS.....................................................................................14 7.0 REFERENCES...............................................................................................................15 APPENDICES Appendix A Project Mapping Appendix B Direct Counting Inventory Data Appendix C Tree Survey (Point-Center Quarter Method) Data Page 242 143rd Street Extension, Plainfield, Will Co., IL 1 1.0 EXECUTIVE SUMMARY This tree LQYHQWRU\ DQGsurvey report has been prepared at the request of the Village of Plainfield.The purpose of this report is to document potential impacts to tree resources within the project limits, inclusive of all areas that will be disturbed as a result of construction activities for the proposed 143rd Street extension between IL-59 and IL-126 in Plainfield, Will County, Illinois. Adjacent land use is commercial, residential, agricultural, undeveloped land, ComEd transmission corridor, and Plainfield Park District DuPage River Trail easements. The Illinois Department of Transportation (IDOT) defines “trees” as a woody perennial plant with a stem having a diameter at breast height (DBH) of six inches or greater or less than six inches when such trees have been intentionally planted for landscaping, environmental mitigation, or habitat preservation/enhancement purposes. For purposes of biological surveys, a tree must have a DBH of at least 4 inches. Within project limits, 155 individual trees are expected to be impacted by the project outside of the wooded areas. Of the 20.3 acres of total wooded area, approximately 12.5 acres, and an estimated 5,359 trees, will be impacted by the proposed project Page 243 143rd Street Extension, Plainfield, Will Co., IL 2 2.0 BACKGROUND INFORMATION 2.1 PROJECT DESCRIPTION The proposed project involves roadway extension intersection improvements of 143rd Street from IL-59 to IL-126 in Plainfield, Will County, Illinois. The anticipated improvements include extension of 143rd Street adjacent to the existing Com-Ed transmission corridor as a four-lane roadway and construction of a bridge over the DuPage River. Intersection improvements to accommodate the roadway extension are also planned at IL-59, Naperville Road, and IL-126. Project mapping is provided in Appendix A. 2.2 PROJECT LOCATION The project is located at the intersection of W 143rd Street and IL-59 and extends east along existing Com-Ed easement to the intersection of E 143rd Street and IL-126 in Plainfield, Will County, Illinois. The Village of Plainfield is located in northern Will County, as shown on Figure 1.The study area on an aerial photograph is shown on Figure 2. The study area is in a moderately developed area with predominately commercial development and residential areas. The study area includes residential areas, agricultural row crop fields, and undeveloped land, including mowed grass, semi-frequently mowed grassland, wetlands, and forested habitats. FIGURE 1 – COUNTY LOCATION MAP Page 244 143rd Street Extension, Plainfield, Will Co., IL 6FIGURE 2 – STUDY AREA Page 245 143rd Street Extension, Plainfield, Will Co., IL 7 3.0 METHODOLOGY This tree survey followed the Illinois Department of Transportation (IDOT) Departmental Policies (D&E-18) regarding the preservation and replacement trees and the IDOT Bureau of Design and Environment Manual (2010). The on-site survey of the study area was conducted during site visits on June 26 and 27, 2019 and on July 2 and 12, 2019. Two survey methodologies were used. The direct counting method was utilized in residential areas and in undeveloped, non-wooded areas within the study area. In this method, each individual tree within the study area is inventoried. For each tree, information is collected on its species, size (diameter at breast height (DBH)), station, offset, health, structure, and impact status. The point-center quarter sampling method was utilized in each wooded stand unit within the study area. This method yields information on density (number of trees per acre), size (basal area per acre), and distribution within the stand (frequency of occurrence for each species sampled). Transects were established 10 meters apart within each unit and sampling points were established every 20 meters along each transect. Each point was divided into quadrants, and the distance to the nearest tree in each quadrant from the center point was measured. For each tree recorded, the species was identified and the DBH was measured. Non-native invasive woody trees and shrubs (as classified by Illinois Exotic Weed Act (525 ILCS 10/)) with a diameter less than 6 inches were not included in the tree inventory or survey. 4.0 RESULTS A total of 395 trees were located within the non-wooded portions of the study area. Of these, two trees have a DBH less than four inches, 115 trees have a DBH between four and six inches, and 242 trees have a DBH greater than six inches. The wooded stand units within the study area had an average density of 382.3 trees per acre and exhibited a thick understory of non-native invasive woody species. 4.1 DIRECT COUNT INVENTORY (NON-WOODED AREAS) A summary of the tree inventory by tree type, health and structure, and origin is provided below. Tree inventory data is provided in Appendix B. TREE TYPE Thirty-three (33) tree species were identified based on the tree inventory. Identification to species level was not always feasible due to condition of the tree. The most common tree species in the non-wooded stand units were Morus alba (white mulberry) and Acer negundo (boxelder). Table 1 presents the tree data by type. Page 246 143rd Street Extension, Plainfield, Will Co., IL 8 Table 1: TREE DATA BY SPECIES Tree Species Number of Individuals Percent of Total Morus alba (white mulberry) 68 18.9 Acer negundo (boxelder) 48 13.4 Juniperus virginiana (eastern red cedar) 28 7.8 Acer saccharinum (silver maple) 27 7.5 Picea sp. (spruce species) 25 7.0 Fraxinus pennsylvanica (green ash) 23 6.4 Gleditsia triacanthos (honey locust) 13 3.6 Prunus serotina (black cherry)13 3.6 Ulmus americana (American elm) 11 3.1 Acer saccharum (sugar maple) 10 2.8 Picea abies (Norway spruce) 10 2.8 Celtis occidentalis (hackberry) 9 2.5 Populus deltoides (eastern cottonwood) 9 2.5 Quercus palustris (pin oak) 8 2.2 Unknown 8 2.2 Acer rubra (red maple) 5 1.4 Juglans nigra (black walnut) 5 1.4 Malus sp. (crabapple species) 5 1.4 Quercus sp. (oak species) 5 1.4 Maclura pomifera (osage orange) 4 1.1 Acer platanoides (Norway maple) 3 0.8 Pinus resinosa (red pine) 3 0.8 Salix sp. (willow species) 3 0.8 Thuja occidentalis (northern white cedar) 3 0.8 Tilia americana (basswood) 3 0.8 Catalpa speciose (northern catalpa) 2 0.6 Pyrus calleryana (Callery pear) 2 0.6 Acer sp. (maple species) 1 0.3 Betula nigra (river birch) 1 0.3 Elaeagnus angustifolia (Russian olive) 1 0.3 Quercus velutina (black oak) 1 0.3 Rhamnus cathartica (common buckthorn) 1 0.3 Taxus sp. (yew species) 1 0.3 TOTAL 359 100 Page 247 143rd Street Extension, Plainfield, Will Co., IL 9 TREE HEALTH AND STRUCTURE Tree health and structure were assessed during the tree survey and are summarized in Table 2 and Table 3, respectively. Tree health is based on the extent to which a tree is reasonably free of signs and symptoms of disease, and tree structure is based on the extent to which a tree has structure and form typical of the species. Health and structure are categorized as good, fair, poor, or dead. Table 2: TREE DATA BY HEALTH Health Number of Individuals Percent of Total Good 18 5.0 Fair 276 76.9 Poor 46 12.8 Dead 19 5.3 TOTAL 359 100 Table 3: TREE DATA BY STRUCTURE Structure Number of Individuals Percent of Total Good 18 5.0 Fair 104 29.0 Poor 218 60.7 Dead 19 5.3 TOTAL 359 100 Page 248 143rd Street Extension, Plainfield, Will Co., IL 10 TREE ORIGIN The origin of the inventoried trees was determined based on location and surrounding area use. Landscaped trees are considered to have been intentionally planted for landscaping, environmental mitigation, or habitat preservation and enhancement purposes. Volunteer trees are considered to be naturally occurring, self-seeded, and were not intentionally planted. Table 4 summarizes tree origins within the non-wooded areas. Table 4: TREE DATA BY ORIGIN Origin Number of Individuals Percent of Total Landscaped 186 51.8 Volunteer 173 48.2 TOTAL 359 100 SCREENING TREES Trees that serve as a visual screen within the project limits (i.e. obstruct the view of a residential lot from an adjacent residence or the street) were identified within the study area at residences along Naperville Road and IL-126. 93 screening trees were identified outside of the wooded areas. SUITABILITY FOR PRESERVATION The suitability of trees for preservation considers the health, age, and structural condition of the tree and its potential to remain an asset into the future. A rating of good applies to trees with good health and structural stability that have the potential for longevity at the site. A rating of fair applies to trees with somewhat declining health and/or structural defects that can be abated with treatment, and a rating of poor applies to trees in poor health or with significant structural defects that cannot be mitigated and should be removed. Table 5 summarizes the suitability of trees for preservation. Table 5: TREE DATA BY SUITABILITY OF PRESERVATION Preservation Suitability Number of Individuals Percent of Total Good 18 5.0 Fair 276 76.9 Poor 65 18.1 TOTAL 359 100 Page 249 143rd Street Extension, Plainfield, Will Co., IL 11 4.2 TREE SURVEY (POINT-CENTER QUARTER METHOD OF WOODED STANDS) Six individual wooded stand units were surveyed within the study area. Unit boundaries were determined by identifying edges of the wooded stands, such as tree lines/transition zones or bisecting roadways. Identification of trees to species level was not always feasible due to condition of the tree. A summary of each stand unit, including location, density, and structure is provided in Table 6 below. Density measures how close trees are to each other by measuring the number of individual trees per unit area. Basal area is average amount of an area occupied by tree stems, defined as the total cross-sectional area of all stems in a stand measured at breast height, and expressed as per unit of land area. Frequency of occurrence is defined as the number of sample points at which a species occurs. The wood stand units totaled 20.3 acres and had an average density of 382.3 trees per acre, an average basal area of 10 ft2 per acre, and an average total frequency of occurrence for all species of 36.3%. All stand units were dominated by an invasive non-native shrub understory of either honeysuckle (Lonicera maackii) or buckthorn (Rhamnus cathartica). Detailed survey data for each sampling point and tree species identified are provided in Appendix C. TREES WITH SPECIAL FUNCTIONS Woody vegetation that is a buffer between a highway and a State-listed Natural Area, Nature Preserve, or Land and Water Reserve are considered trees with special functions. No woody vegetation within the study area meets this definition. Trees with roosting features such as peeling bark and cavities were identified as suitable roosting habitat for the federally endangered Indiana bat (Myotis sodalis) and threatened northern long-eared bat (Myotis septentrionalis) throughout the study area. 4.3 SPECIMEN TREES Specimen trees are individual trees listed on the 2013 Illinois Big Tree Register, are recognized as having historical significance, or are a notable and valued tree, based on consideration of species, size, condition, age, longevity, visual quality, and genetic attributes, as determined by the public and/or resource agencies and IDOT (IDOT D&E-18). No specimen trees were identified within the study area. None of the surveyed trees are listed on the 2013 Illinois Big Tree Register. Page 250 143rd Street Extension, Plainfield, Will Co., IL 12 Table 6: TREE SURVEY SUMMARY Stand Unit Location Species Composition Density (trees/acre) Average Basal Area Frequency of Occurrence Total Acreage Impact (acreage / number of trees lost) 1 East of IL-59, south of West Norman Drain 9 species Acer negundo (boxelder) Acer saccharinum (silver maple) Celtis occidentalis (hackberry) Morus alba (white mulberry) Populus deltoides (eastern cottonwood) Prunus serotina (black cherry) Salix sp. (willow species) Ulmus rubra (slippery elm) unknown 294.26 21.64 33.0 2.68 0.07 ac 21 trees 2 East of IL-59, north of West Norman Drain 10 species Celtis occidentalis (hackberry) Cornus sericea (red osier dogwood) Gleditsia triacanthos (honey locust) Juniperus virginiana (eastern red cedar) Maclura pomifera (osage orange) Morus alba (white mulberry) Populus deltoides (eastern cottonwood) Prunus serotine (black cherry) Pyrus calleryana (Callery pear) Salix sp. (willow species) 220.73 10.93 23.0 2.35 2.09 ac 461 trees 3 South of Fletcher Lake, east of IL-126 (Bass and Gill Club) 16 species Acer negundo (boxelder) Acer saccharum (sugar maple) Celtis occidentalis (hackberry) Fraxinus pennsylvanica (green ash) Fraxinus sp. (ash species) Juglans nigra (black walnut) Juniperus virginiana (eastern red cedar) Morus alba (white mulberry) Populus alba (white poplar) Populus deltoides (eastern cottonwood) Prunus serotina (black cherry) Tilia americana (basswood) Ulmus americana (American elm) Ulmus rubra (slippery elm) Ulmus sp. (elm species) Unknown 428.72 12.81 106.0 10.45 8.35 ac 3,578 trees 4 West of Fletcher Lake (Bass and Gill Club) 7 species Celtis occidentalis (hackberry) Fraxinus sp. (ash species) Juglans nigra (black walnut) Morus alba (white mulberry) Populus deltoides (eastern cottonwood) Prunus serotina (black cherry) Ulmus americana (American elm) 206.59 7.68 21.0 1.26 0.31 ac 64 trees Page 251 143rd Street Extension, Plainfield, Will Co., IL 13 Table 6: TREE SURVEY SUMMARY Stand Unit Location Species Composition Density (trees/acre) Average Basal Area Frequency of Occurrence Total Acreage Impact (acreage / number of trees lost) 5 North of E 143rd St (Bass and Gill Club) 9 species Acer saccharum (sugar maple) Fraxinus pennsylvanica (green ash) Juglans nigra (black walnut) Morus alba (white mulberry) Populus alba (white poplar) Prunus serotina (black cherry) Robinia pseudoacacia (black locust) Ulmus americana (American elm) unknown 751.55 5.38 28.0 2.30 1.6 ac 1,203 trees 6 South of E 143rd St (Pure Rod and Gun Club) 5 species Celtis occidentalis (hackberry) Juglans nigra (black walnut) Morus alba (white mulberry) Prunus serotina (black cherry) Ulmus americana (American elm) 391.78 1.49 7.0 1.28 0.08 ac 32 trees Total 20.3 ac 12.5 ac 5,359 trees Page 252 143rd Street Extension, Plainfield, Will Co., IL 14 5.0 SUMMARY OF IMPACTS Based upon Stage 1 plans, 155 trees will be impacted or removed by the proposed project within the non-wooded areas. Of the impacted trees six were rated as good suitability for preservation, 122 as fair, and 27 as poor. Of the 20.3 acres of total wooded area, approximately 12.5 acres, and an estimated 5,359 trees, will be impacted by the proposed project for construction of the roadway, bridge, floodplain and lake compensatory storage, and grading. 6.0 MITIGATION REQUIREMENTS Tree replacement based on the IDOT D&E-18 policy requires the replacement of isolated trees or small groups of trees within the project right-of-way to the extent practical. If bare root or balled and burlapped trees are used for replacement plantings, a minimum ration of 1:1 is recommended for the number of trees planted to the number of trees intended to be established. If seedlings are used, a minimum of 3:1 is recommended for the number of trees planted to the number of trees intended to be established. Replacement trees should be planted in suitable locations as close as practical to the removal site. Where it is not practical to provide replacement plantings within the right-of-way, opportunities for planting trees outside the right-of-way, on other projects, or in other highway locations should be considered, to achieve a long-term goal of providing at least as many replacement trees as the number removed. Replacement of trees providing visual screens must provide similar function as the trees removed. IDOT D&E-18 policy requires the intent of replacement plantings for trees removed from wooded areas should be to provide comparable functional replacement. Where comparable functional replacement cannot be achieved through replacement plantings within the right-of-way, consideration should be given to providing replacement plantings off the right-of-way. Decisions on the location, nature, and extent of replacement plantings for trees removed from these areas should be guided by result of any coordination and consultation with regulatory and natural resource agencies pursuant to local, state, and federal statutes, regulations, or agreements. Page 253 143rd Street Extension, Plainfield, Will Co., IL 15 7.0 REFERENCES The following references were consulted during the investigation: Barnes, B.V. and W.H. Wagner Jr. 2011. Michigan Trees: a guide to the trees of the Great Lakes Region. The University of Michigan Press. Braun, E. Lucy, 1989. The Woody Plants of Ohio. Ohio State University Press. Columbus. Cottam, G. and J.T. Curtis. 1956. The use of distance measures in phytosociological sampling. Ecology 37(3): 451-460. Gleason, H.A. and A. Cronquist. 1992. Manual of Vascular Plants of Northeastern United States and Adjacent Canada. Van Nostrand, Princeton, New Jersey, 2nd Edition. Holmgren, Noel H. 1998. The Illustrated Companion to Gleason and Cronquist’s Manual: illustrations of the vascular plants of northeastern United States and adjacent Canada. The New York Botanical Garden, Bronx, New York. Illinois Department of Transportation. 2002. Departmental Policies (D&E-18). Illinois Department of Transportation. 2010. Bureau of Design and Environment Manual. Revised April 2019. Springfield, Illinois. JoVE Science Education Database. 2020. Environmental Science. Tree Survey: Point- Centered Quarter Sampling Method. JoVE, Cambridge, MA. Kershaw, Linda. 2007. Trees of Illinois. Long Pine Publishing International. Mitchell, K. 2007. Quantitative analysis by the point-centered quarter method. http://faculty.wwu.edu/wallin/envr442/pdf_files/PCQM.pdf Ruch, D.G., B.G. Torke, K.S. Badger, and C.R. Reidy. 2008. Point-centered quarter analysis of four forest types at Hayes Arboretum in Wayne County, Indiana. Proceedings of the Indiana Academy of Science 117(2): 136-141. U.S. Geological Survey. 7.5-minute Topographic Quadrangle, Plainfield, IL. 2013 United States Department of Agriculture (USDA), NRCS 1999. The PLANTS database (http://plants.usda.gov/plants). National Plant Data Center, Baton Rouge, LA 70874- 4490 USA. University of Illinois. 2008. The 2008 Illinois Big Tree Register. Department of Natural Resources and Environmental Sciences Wilhelm, G. and L. Rerich. 2017. Flora of the Chicago Region. A Floristic and Ecological Synthesis. Indiana Academy of Science, Indianapolis. 1392 pp. Page 254 143rd Street Extension APPENDIX A: PROJECT MAPPING Page 255 143rd Street Extension Location Map - Will County, IL 02.55Miles Service Layer Credits: Sources: Esri, HERE, Garmin, USGS, Intermap, INCREMENT P, NRCan, Esri Japan, METI, Esri China (Hong Kong), Esri Korea, Esri (Thailand), NGCC, © OpenStreetMap contributors, and the GIS User Community Project Location Page 256 Copyright:© 2013 National Geographic Society, i-cubed 143rd StrHet Extension USGS Topographic Map 0 750 1,500375 Feet ESR Limit Page 257 143rd Street Extension - Plainfield, Will Co., ILAERIAL MAP05001,000250FeetAddendum D ESR Limits (Final 2018)N Division StreetNaperville RoadState Route 1263030DuPage RiverLake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User CommunityFletcher LakePage 258 5930W 143rd StreetN Division StreetNaperville RoadWest Norman DrainDuPage RiverNaperville Road12825417639513714572868205411403460311771484553163933592256421362362519654161103018704724504438645827216749554363122632665215296946234438848478218414124238014298308534528078874468248188444158104664094558504328278044264038868358238434374144634178098158498264088038558324348464604408124208588068294284514334598174164398114658638574568288514254024424624138204228608318088458194614678594104218054448488224384648628164188258024308561225123912191202126212161265122212051213123612271221120412101230126712241201120712661223120612121235123812031209123712171208124012201211143rd Street ExtensionTREE SURVEY MAP (1 of 2)0200400100Feet,QYHQWRULHGTreeWooded Stand UnitAddendum D ESR LimitsService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User CommunityPage 259 126E 143rd StreetNaperville Road3536488484787084186185383888788182486784486487385082788683584387284985583287884685885287583786385787485188083488387186083187783983388284586885987688584886586285687920151617200912391276200420291268124512621611127920182012126520062032202612361614128420232011200320311270160512301267160212782005126620251601160712351258123820022008124612551604124916101280123712742001200720271603125416091240201016061251143rd Street ExtensionTREE SURVEY MAP (2 of 2)0200400100Feet,QYHQWRULHG TreeWooded Stand UnitAddendum D ESR LimitsService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User CommunityPage 260 143rd Street Extension APPENDIX B: DIRECT COUNT INVENTORY DATA Page 261 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4CommentsLeft Offsets Naperville Rd 801Juglans nigra 30 F P F L Y Roadway extension N 802Acer negundo 8 F P F L N None N 803Gleditsia triacanthos 14 F P F L N None N Multistem 804Acer saccharinum 12 F P F L N None N Multistem 809Acer saccharinum 36 F F F L N None N Multistem 810Acer saccharinum 20 F F F L N None N Multistem 811Fraxinus pennsylvanica 24 D D P L N None N 812Maclura pomifera 20 F P F L Y Roadway extension Y Multistem 813Acer saccharinum 18 F F F L N None N Multistem 814Acer saccharum 16 F P F L Y Roadway extension Y 815Acer saccharum 18 F P F L Y Roadway extension Y 816Prunus serotina 12 F F F L N None N 817Picea sp 7 F P F L Y Roadway extension Y 818Picea sp 11 F P F L Y Roadway extension Y 819Picea sp 12 F P F L Y Roadway extension Y 820Acer saccharum 32 G G G L N None N 821Acer platanoides 12 F F F L N None N 822Celtis occidentalis 34 F P F L N None N 823Pinus resinosa 26 P P P L Y Roadway extension N 824Fraxinus pennsylvanica 24 F F F L Y Roadway extension Y 825Morus alba 8 F P F L N None Y 826Malus sp 8 P P P L Y Roadway extension Y Multistem 827Malus sp 10 F F F L Y Roadway extension Y Multistem 828Celtis occidentalis 6 F P F L N None Y 829Catalpa speciosa 12 F P F L N None Y 830Acer saccharinum 12 F P F L N None Y 831Morus alba 26 G G G L Y Roadway extension Y Multistem Page 262 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments832Maclura pomifera 24 F F F L Y Roadway extension Y Multistem 835Tilia americana 30 F F F L N None N 1201Picea sp 10 F P F L Y Roadway extension N Multistem 1202Acer sp 10 F P F L N None N Multistem 1203Salix sp 7 F P F L N None N 1204Acer saccharinum 10 F P F L N None N Multistem 1208Morus alba 8 F P F L N None N 1209Gleditsia triacanthos 10 G G G L Y Roadway extension N 1210Morus alba 8 F P F L N None N Multistem 1211Picea sp 12 F P F L N None N 1212Acer saccharinum 20 F F F L N None N Multistem 1213Picea sp 8 F P F L N None N 1214Malus sp 6 F F F L N None N Multistem 1215Acer saccharum 10 F P F L Y Roadway extension Y 1216Acer saccharinum 20 F F F L N None N Multistem 1217Tilia americana 16 F P F L N None Y 1218Fraxinus pennsylvanica 28 F F F L N None N 1219Maclura pomifera 18 F P F L N None N Multistem 1220Gleditsia triacanthos 26 F F F L N None N 1221Ulmus americana 36 F P F L N None N 1222Acer platanoides 32 F F F L Y Roadway extension N 1223Acer platanoides 8 F F F L Y Roadway extension N 1224Fraxinus pennsylvanica 18 F F F L Y Roadway extension Y 1225Morus alba 10 F P F L N None Y Multistem 1226Catalpa speciosa 8 F P F L N None Y 1227Celtis occidentalis 10 F P F L N None Y 1228Malus sp 10 P P P L Y Roadway extension Y Multistem 1229Fraxinus pennsylvanica 30 F F F L Y Roadway extension Y Page 263 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments1230Fraxinus pennsylvanica 22 P P P L Y Roadway extension Y 1231Quercus velutina 6 F P F L N None Y 1232Celtis occidentalis 8 F P F L N None Y 1233Celtis occidentalis 6 F P F L N None Y 1234Prunus serotina 18 P P P L Y Roadway extension Y 1235Maclura pomifera 16 P P P L Y Roadway extension Y Multistem 1236Picea sp 6 P P P L N None N 1237Taxus sp 6 P P P L N None N Multistem 1238Acer saccharum 8 G G G L N None N 1239Celtis occidentalis 16 F F F L N None N 1240Acer saccharinum 18 F F F L N None N Left Offsets IL-126 1605Celtis occidentalis 5 F F F L N None Y Multistem 1606Acer saccharinum 40 G G G L N None N 2004Morus alba 6 F F F L N None Y 2005Morus alba 4 F F F L N None Y 2031Picea abies 15 G G G L Y Roadway extension N 2032 Unknown 24 D D P L N None N Left Offsets IL-59, North of US 30 31Juniperus virginiana 7 F P F L Y Roadway extension N 33Juniperus virginiana 7 F P F L Y Roadway extension N 34Juniperus virginiana 6 F P F L Y Roadway extension N 35Juniperus virginiana 7 F P F L Y Roadway extension N 38Acer negundo 7 F P F V Y Roadway extension N 39Acer negundo 10 F P F V Y Roadway extension N 40Acer negundo 8 F P F V N None N 41Acer negundo 10 F P F V Y Roadway extension N 42Morus alba 8 F P F V N None N Multistem Page 264 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments43Morus alba 6 F P F V N None N 44Morus alba 15 F F F V N None N Multistem 45Morus alba 8 F P F V N None N 46Morus alba 10 P P P V N None N Multistem 47Acer negundo 11 F F F V N None N 48Morus alba 14 F P F V N None N 49Morus alba 8 F P F V N None N Multistem 50 Unknown 12 D D P V N None N 51Morus alba 6 F F F V N None N Multistem 52Morus alba 6 P P P V N None N Multistem 53Elaeagnus angustifolia 12 P P P V N None N Multistem 54Morus alba 10 F P F V N None N 55Morus alba 14 P P P V N None N Multistem 56Morus alba 6 P P P V N None N 57Prunus serotina 6 F P F V N None N Multistem 437Juniperus virginiana 5 F P F L Y Roadway extension N 438Morus alba 5 F P F L Y Roadway extension N Multistem 439Juniperus virginiana 6 F P F L Y Roadway extension N 440Juniperus virginiana 6 F P F L Y Roadway extension N 443Acer negundo 8 F P F V Y Roadway extension N 444Gleditsia triacanthos 12 F P F V N None N Multistem 445Acer negundo 15 F P F V N None N 446Morus alba 6 F P F V N None N 447Morus alba 6 F P F V N None N Multistem 448Morus alba 8 F P F V N None N Multistem 449Morus alba 10 F F F V N None N 450Morus alba 10 F P F V N None N Multistem 451Morus alba 8 F P F V N None N Multistem Page 265 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments452Morus alba 6 F F F V N None N 453Morus alba 10 F P F V N None N Multistem 454Morus alba 6 F P F V N None N Multistem 455Morus alba 6 F P F V N None N 456Morus alba 8 F F F V N None N Multistem 457Morus alba 15 F P F V N None N Multistem 458Morus alba 5 F F F V N None N Multistem Left Offsets IL-59, South of US 30 1Acer negundo 10 F P F V Y Roadway extension N 2Morus alba 4 P P P V Y Roadway extension N 3Morus alba 5 F P F V Y Roadway extension N 4 Unknown 6 D D P V Y Roadway extension N 5Acer negundo 4 F P F V Y Roadway extension N 6Gleditsia triacanthos 7 F P F V N None N 7Acer negundo 16 F P F V Y Roadway extension N Multistem 8Acer negundo 7 F P F V Y Roadway extension N Multistem 9Acer negundo 8 F F F V N None N 10Prunus serotina 8 F P F V Y Roadway extension N 11Acer negundo 5 P P P V N None N 12Acer negundo 6 F P F V Y Roadway extension N 13Acer negundo 6 F P F V N None N Multistem 14Morus alba 20 F P F V Y Roadway extension N 15Morus alba 18 P P P V N None N Multistem 16Acer negundo 6 F P F V N None N Multistem 17Acer negundo 6 F P F V N None N Multistem 18Acer negundo 10 F P F V N None N 19Acer negundo 6 F P F V N None N 20Acer negundo 13 P P P V N None N Multistem Page 266 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments21Acer negundo 5 F F F V N None N 22Acer negundo 8 F P F V N None N Multistem 23 Unknown 15 D D P V N None N 24 Unknown 18 D D P V N None N 25Acer negundo 8 F P F V N None N Multistem 26Ulmus americana 12 F F F V N None N Multistem 27Morus alba 7 P P P V N None N 28Ulmus americana 4 P P P V N None N 29Acer negundo 8 P P P V N None N Multistem 30Morus alba 15 F F F V N None N Multistem 32Juglans nigra 8 F F F V N None N Multistem 36Morus alba 6 P P P V N None N 37Prunus serotina 4 F F F V Y Roadway extension N 401Acer negundo 5 F P F V N None N 402Acer negundo 6 F P F V Y Roadway extension N 403Morus alba 20 F P F V N None N 404Morus alba 5 F P F V N None N 405Acer negundo 5 F P F V N None N Multistem 406Acer negundo 4 F P F V N None N 407Gleditsia triacanthos 12 G G G V N None N 408Acer negundo 4 F P F V Y Roadway extension N 409Acer negundo 5 F F F V N None N 410Gleditsia triacanthos 6 F P F V Y Roadway extension N Multistem 411Acer negundo 4 P P P V N None N 412Morus alba 18 F P F V Y Roadway extension N 413Morus alba 10 F P F V Y Roadway extension N Multistem 414Gleditsia triacanthos 10 F F F V N None N Multistem 415 Unknown 10 D D P V Y Roadway extension N Page 267 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments416Prunus serotina 12 F P F V Y Roadway extension N Multistem 417Acer negundo 4 P P P V N None N 418Prunus serotina 16 F P F V Y Roadway extension N Multistem 419Acer negundo 5 P P P V N None N 420Morus alba 30 F F F V N None N 421Gleditsia triacanthos 5 F F F V N None N 422Morus alba 20 F P F V N None N Multistem 423Acer negundo 5 P P P V N None N 424Acer negundo 10 F P F V N None N 425Acer negundo 4 F F F V N None N 426Acer negundo 8 F P F V N None N 427Acer negundo 6 F P F V N None N 428Acer negundo 11 F F F V N None N Multistem 429Acer negundo 5 F F F V N None N 430Morus alba 30 F P F V N None N Multistem 431Morus alba 10 P P P V N None N Multistem 432Morus alba 11 P P P V N None N 433Morus alba 20 F P F V N None N 434Fraxinus pennsylvanica 5 F F F V N None N 435Acer negundo 12 P P P V N None N Multistem 436 Unknown 8 F F F V N None N 441Juglans nigra 28 F F F V N None N 442Morus alba 30 F F F V N None N Right Offsets Naperville Rd 833Juniperus virginiana 5 F P F L Y Roadway extension N Multistem 834Juniperus virginiana 5 F P F L Y Roadway extension N Multistem 836Juniperus virginiana 5 F P F L Y Roadway extension N 837Juniperus virginiana 5 F P F L Y Roadway extension N Page 268 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments838Pinus resinosa 24 P P P L N None N Multistem 839Picea sp 18 P P P L N None N 840Picea abies 6 F P F L Y Roadway extension Y 841Picea abies 30 F P F L Y Roadway extension Y 842Juniperus virginiana 8 F P F L Y Roadway extension Y Multistem 843Juniperus virginiana 11 F P F L Y Roadway extension Y 844Juniperus virginiana 14 F P F L Y Roadway extension Y 845Juniperus virginiana 8 F P F L Y Roadway extension Y Multistem 846Picea sp 12 F P F L Y Roadway extension Y 847Picea sp 18 F P F L Y Roadway extension Y 848Picea abies 12 F P F L Y Roadway extension Y 849Picea abies 16 F P F L Y Roadway extension Y 850Picea abies 18 F P F L Y Roadway extension Y 851Acer saccharum 30 F P F L Y Roadway extension N 852Acer saccharinum 24 F F F L N None N Multistem 853Picea sp 8 F P F L Y Roadway extension Y Multistem 854Picea sp 8 F P F L Y Roadway extension Y 855Picea sp 14 F P F L Y Roadway extension Y 856Acer saccharum 34 P P P L N None N 857Quercus sp 40 F P F L Y Roadway extension N 858Acer saccharinum 45 F P F L N None N 859Quercus sp 18 F P F L N None N 860Picea sp 9 F P F L N None N 861Quercus sp 32 F P F L N None N 862Betula nigra 4 F F F L N None N Multistem 863Picea sp 30 F P F L Y Roadway extension N 864Acer saccharinum 40 F P F L N None N 865Acer saccharinum 24 G G G L N None N Multistem Page 269 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments866Acer saccharinum 12 F P F L N None N Multistem 867Acer rubra 6 F P F L N None N 868Acer saccharinum 38 G G G L N None N Multistem 869Acer rubra 12 F P F L N None N Multistem 870Tilia americana 24 F P F L N None N 871Salix sp 4 P P P L N None N Multistem 872Acer rubra 18 F P F L N None N Multistem 873Acer saccharinum 6 F F F L N None N 874Juniperus virginiana 2 F F F L N None N 875Picea abies 6 F F F L N None N 876Quercus palustris 24 F F F L N None N 877Quercus palustris 36 G G G L N None N 878Prunus serotina 36 P P P L N None N 879Quercus palustris 32 G G G L N None N 880Acer saccharinum 30 F F F L N None N 881Acer saccharinum 48 G G G L N None N 882Juniperus virginiana 6 F P F L Y Roadway extension N 883Juniperus virginiana 6 F P F L Y Roadway extension N Multistem 884Picea sp 8 F P F L Y Roadway extension N 885Thuja occidentalis 12 G G G L Y Roadway extension N Multistem 886Juniperus virginiana 6 F P F L Y Roadway extension N Multistem 887Thuja occidentalis 8 G G G L Y Roadway extension N Multistem 1241Juniperus virginiana 5 F P F L Y Roadway extension N Multiple individuals as a row hedge 1242Juniperus virginiana 5 F P F L Y Roadway extension N 1243Juniperus virginiana 5 F P F L Y Roadway extension N 1244Juniperus virginiana 5 F P F L Y Roadway extension N 1245Picea abies 26 F P F L Y Roadway extension Y 1246Acer saccharum 36 F F F L N None N Page 270 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments1247Juniperus virginiana 6 F P F L Y Roadway extension Y Multistem 1248Juniperus virginiana 12 F P F L Y Roadway extension Y Multistem 1249Quercus palustris 42 F F F L N None N 1250Juniperus virginiana 10 F P F L Y Roadway extension Y Multistem 1251 Unknown 20 D D P L N None N 1252Picea abies 22 F P F L Y Roadway extension Y 1253Picea sp 14 F P F L Y Roadway extension Y 1254Malus sp 12 F F F L N None N Multistem 1255Acer saccharum 20 G G G L N None N Multistem 1256Quercus sp 40 F P F L Y Roadway extension Y 1257Picea sp 6 F P F L Y Roadway extension Y Multistem 1258Gleditsia triacanthos 48 F F F L N None N 1259Quercus palustris 42 F F F L N None N 1260Picea sp 16 F P F L Y Roadway extension Y 1261Picea sp 11 F P F L Y Roadway extension Y 1262Picea sp 24 P P P L Y Roadway extension N 1263Picea sp 10 F P F L Y Roadway extension N 1264Picea sp 7 F P F L Y Roadway extension N 1265Acer rubra 6 F P F L N None N 1266Acer saccharinum 42 F P F L N None N 1267Picea sp 20 F P F L N None N 1268Quercus palustris 42 G G G L N None N 1269Quercus sp 36 F P F L N None N 1270Acer saccharum 22 F P F L N None N 1271Acer saccharinum 24 F F F L N None N 1272Acer rubra 20 F P F L N None N Multistem 1273Juniperus virginiana 2 F F F L N None N 1274Juglans nigra 24 F F F L N None N Multistem Page 271 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments1275Picea sp 16 P P P L N None N 1276Quercus palustris 8 F F F L N None N 1277Quercus palustris 32 F F F L N None N 1278Pinus resinosa 12 P P P L N None N 1279Acer saccharinum 36 G G G L N None N 1280Acer saccharinum 36 F F F L N None N 1281Picea abies 12 F F F L Y Roadway extension N 1282Acer saccharinum 58 F F F L Y Roadway extension N 1283Juniperus virginiana 6 F P F L Y Roadway extension N Multistem 1284Thuja occidentalis 8 G G G L Y Roadway extension N Multistem Right Offsets IL-126, North of E 143rd St 1601Celtis occidentalis 44 F F F V Y Roadway extension N 1602Ulmus americana 33 F F F V Y Roadway extension N 1603Acer saccharinum 20 F F F V Y Roadway extension N Multistem 1604Ulmus americana 10 F F F V Y Roadway extension N 2001Ulmus americana 6 F F F V Y Roadway extension N 2002Juglans nigra 36 F F F V N None N 2003Populus deltoides 14 F F F V Y Roadway extension N Multistem Right Offsets IL-126, South of E 143rd St 1607Fraxinus pennsylvanica 4 D D P V Y Roadway extension Y 1608Fraxinus pennsylvanica 6 P P P V Y Roadway extension Y 1609Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y Multistem 1610Morus alba 14 F F F V Y Roadway extension Y 1611Morus alba 4 F F F V Y Roadway extension Y 1612Fraxinus pennsylvanica 8 P P P V Y Roadway extension Y 1613Morus alba 16 F F F V Y Roadway extension Y Multistem 1614Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y 1615Morus alba 6 F F F V Y Roadway extension Y Page 272 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments1616Fraxinus pennsylvanica 5 D D P V Y Roadway extension Y 1617Morus alba 6 F F F L Y Roadway extension Y Multistem 1618Ulmus americana 8 F F F L Y Roadway extension Y Multistem 2006Fraxinus pennsylvanica 6 P P P V N None Y 2007Fraxinus pennsylvanica 4 D D P V Y Roadway extension Y 2008Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y 2009Fraxinus pennsylvanica 4 D D P V Y Roadway extension Y 2010Acer negundo 5 F F F V Y Roadway extension Y 2011Ulmus americana 8 F F F V Y Roadway extension Y 2012Fraxinus pennsylvanica 12 P P P V Y Roadway extension Y 2013Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y 2014Celtis occidentalis 5 F F F V Y Roadway extension Y 2015Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y Multistem 2016Morus alba 4 F F F V Y Roadway extension Y 2017Fraxinus pennsylvanica 6 D D P V Y Roadway extension Y 2018Morus alba 4 F F F V Y Roadway extension Y 2019Fraxinus pennsylvanica 5 D D P V Y Roadway extension Y 2020Morus alba 8 F F F V Y Roadway extension Y Multistem 2021Morus alba 4 F F F V Y Roadway extension Y 2022Morus alba 7 F F F V Y Roadway extension Y 2023Morus alba 4 F F F V Y Roadway extension Y 2024Fraxinus pennsylvanica 10 P P P V Y Roadway extension Y 2025Morus alba 14 F F F L Y Roadway extension Y 2026Ulmus americana 20 P P P L Y Roadway extension Y 2027Ulmus americana 20 F F F L Y Roadway extension Y 2028Morus alba 10 F F F L Y Roadway extension Y Multistem 2029Morus alba 6 F F F L Y Roadway extension Y Multistem 2030Ulmus americana 6 F F F L Y Roadway extension Y Multistem Page 273 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4CommentsRight Offsets IL-59 to Naperville Rd 58Prunus serotina 6 F P F V N None N Multistem 59Morus alba 8 F P F V N None N Multistem 60Morus alba 12 F P F V N None N Multistem 61Prunus serotina 16 F P F V N None N 62Acer negundo 18 F P F V Y Roadway extension N 63Rhamnus cathartica 4 F P F V Y Roadway extension N Multistem 64Acer negundo 4 P P P V Y Roadway extension N Multistem 65Acer negundo 4 P P P V N None N 66Pyrus calleryana 12 F F F V N None N Multistem 67Gleditsia triacanthos 4 F F F V N None N Multistem 68Populus deltoides 12 F F F V N None N 69Populus deltoides 4 F F F V N None N 70Morus alba 7 F P F V Y Roadway extension N Multistem 71Populus deltoides 5 P P P V N None N 459Prunus serotina 20 F P F V N None N Multistem 460Prunus serotina 10 F P F V Y Roadway extension N 461Acer negundo 6 F P F V N None N 462Acer negundo 6 F P F V N None N Multistem 463Gleditsia triacanthos 6 F P F V Y Roadway extension N 464Gleditsia triacanthos 5 F P F V Y Roadway extension N 465Prunus serotina 4 P P P V N None N Multistem 466Pyrus calleryana 7 F P F V Y Roadway extension N Multistem 467Populus deltoides 6 F F F V N None N 805Populus deltoides 24 F F F V N None N 806Populus deltoides 32 F F F V N None N 807Salix sp 12 F F F V Y Roadway extension N Multistem 808Acer saccharinum 24 F P F V N None N Page 274 TreeIDSpecies Size(DBH) Health1Structure1PreservationSuitability2Origin3Removal4Impact Status Screening Tree4Comments1205Populus deltoides 26 F F F V N None N Multistem 1206Populus deltoides 26 F F F V N None N 1207Acer saccharinum 12 F P F V N None N 1.Health&Structureratings:G=Good,F=Fair,P=Poor,D=Dead2.PreservationSuitabilityratings:G=Food,F=Fair,P=Poor3.Originratings:L=Landscaped,V=Volunteer4.Y=Yes,N=NoPage 275 143rd Street Extension APPENDIX C: TREE SURVEY DATA Page 276 Species Count Relative Density Density Average Basal Area Dominance Relative Dominance Frequency Relative Frequency Importance Value Unit 1 Acer negundo 7 12.96 38.15 0.54 20.69 4.45 3 9.09 26.50 Acer saccharinum 17 31.48 92.64 2.45 226.95 48.79 8 24.24 104.51 Celtis occidentalis 2 3.70 10.90 0.27 2.97 0.64 2 6.06 10.40 Morus alba 18 33.33 98.09 0.71 69.55 14.95 12 36.36 84.65 Populus deltoides 3 5.56 16.35 2.97 48.62 10.45 3 9.09 25.10 Prunus serotina 3 5.56 16.35 1.06 17.36 3.73 2 6.06 15.35 Salix sp 1 1.85 5.45 12.57 68.48 14.72 1 3.03 19.60 Ulmus rubra 2 3.70 10.90 0.87 9.51 2.04 1 3.03 8.78 unknown 1 1.85 5.45 0.20 1.07 0.23 1 3.03 5.11 Total 54 100 294.26 21.64 465.19 100 33 100 300 Unit 2 Celtis occidentalis 3 9.38 20.69 2.71 56.13 19.05 2 8.70 37.12 Cornus sericea 1 3.13 6.90 0.35 2.41 0.82 1 4.35 8.29 Gleditsia triacanthos 1 3.13 6.90 0.14 0.94 0.32 1 4.35 7.79 Juniperus virginiana 1 3.13 6.90 0.35 2.41 0.82 1 4.35 8.29 Maclura pomifera 3 9.38 20.69 3.09 63.99 21.72 2 8.70 39.79 Morus alba 8 25.00 55.18 0.45 24.75 8.40 5 21.74 55.14 Populus deltoides 6 18.75 41.39 2.77 114.52 38.87 3 13.04 70.66 Prunus serotina 7 21.88 48.29 0.53 25.73 8.73 6 26.09 56.70 Pyrus calleryana 1 3.13 6.90 0.20 1.35 0.46 1 4.35 7.93 Salix sp 1 3.13 6.90 0.35 2.41 0.82 1 4.35 8.29 Total 32 100 220.73 10.93 294.65 100 23 100 300 Unit 3 Acer negundo 1 0.62 2.66 1.07 2.85 0.81 1 0.94 2.37 Acer saccharum 3 1.86 7.99 0.47 3.73 1.06 3 2.83 5.75 Celtis occidentalis 5 3.11 13.31 0.30 3.96 1.13 5 4.72 8.95 Fraxinus pennsylvanica 1 0.62 2.66 0.20 0.52 0.15 1 0.94 1.71 Fraxinus sp 4 2.48 10.65 0.51 5.46 1.55 4 3.77 7.81 Juglans nigra 7 4.35 18.64 0.45 8.37 2.38 5 4.72 11.44 Juniperus virginiana 2 1.24 5.33 0.12 0.65 0.19 2 1.89 3.31 Morus alba 32 19.88 85.21 0.74 63.26 17.99 21 19.81 57.68 Populus alba 1 0.62 2.66 0.09 0.23 0.07 1 0.94 1.63 Populus deltoides 14 8.70 37.28 3.32 123.62 35.15 8 7.55 51.40 Prunus serotina 45 27.95 119.83 0.30 36.18 10.29 22 20.75 58.99 Tilia americana 1 0.62 2.66 0.79 2.09 0.59 1 0.94 2.16 Ulmus americana 22 13.66 58.58 0.57 33.20 9.44 14 13.21 36.31 Ulmus rubra 15 9.32 39.94 0.98 39.11 11.12 11 10.38 30.82 Ulmus sp 3 1.86 7.99 1.96 15.69 4.46 2 1.89 8.21 unknown 5 3.11 13.31 0.96 12.74 3.62 5 4.72 11.44 Total 161 100 428.72 12.81 351.66 100 106 100 300 Page 277 Species Count Relative Density Density Average Basal Area Dominance Relative Dominance Frequency Relative Frequency Importance Value Unit 4 Celtis occidentalis 2 7.14 14.76 1.39 20.48 8.95 2 9.52 25.62 Fraxinus sp 7 25.00 51.65 0.69 35.41 15.47 4 19.05 59.52 Juglans nigra 3 10.71 22.14 0.36 8.05 3.52 2 9.52 23.75 Morus alba 2 7.14 14.76 0.45 6.60 2.88 2 9.52 19.55 Populus deltoides 4 14.29 29.51 3.58 105.75 46.21 3 14.29 74.78 Prunus serotina 8 28.57 59.03 0.78 46.24 20.20 6 28.57 77.35 Ulmus americana 2 7.14 14.76 0.43 6.32 2.76 2 9.52 19.43 Total 28 100 206.59 7.68 228.85 100 21 100 300 Unit 5 Acer saccharum 2 4.26 31.98 1.159 37.06 9.06 2 7.14 20.45 Fraxinus pennsylvanica 1 2.13 15.99 0.087 1.40 0.34 1 3.57 6.04 Juglans nigra 1 2.13 15.99 0.087 1.40 0.34 1 3.57 6.04 Morus alba 6 12.77 95.94 0.916 87.91 21.48 5 17.86 52.10 Populus alba 4 8.51 63.96 0.350 22.41 5.48 2 7.14 21.13 Prunus serotina 3 6.38 47.97 1.309 62.79 15.34 2 7.14 28.87 Robinia pseudoacacia 18 38.30 287.83 0.439 126.46 30.90 8 28.57 97.77 Ulmus americana 10 21.28 159.90 0.289 46.14 11.27 5 17.86 50.41 unknown 2 4.26 31.98 0.742 23.72 5.80 2 7.14 17.19 Total 47 100 751.55 5.38 409.28 100 28 100 300 Unit 6 Celtis occidentalis 1 9.09 35.62 0.087 3.11 2.85 1 14.29 26.22 Juglans nigra 5 45.45 178.08 0.280 49.92 45.73 2 28.57 119.76 Morus alba 3 27.27 106.85 0.227 24.28 22.24 2 28.57 78.09 Prunus serotina 1 9.09 35.62 0.545 19.43 17.79 1 14.29 41.17 Ulmus americana 1 9.09 35.62 0.349 12.43 11.39 1 14.29 34.76 Total 11 100 391.78 1.49 109.17 100 7 100 300 Page 278 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments1 9 1 NE 36 6.0 8 Morus alba F P V 0 191NW356.010Morus alba FPV11 9 1 SE 33 7.5 12 Populus deltoides F P V 0 multistem 191SW3420.024Acer saccharinum FFV0multistem1 9 2 NE 37 3.0 8 Morus alba P P V 0 192NW3825.012Morus alba PPV01 9 2 SE 40 30.0 6 Morus alba P P V 0 192SW3924.06unknown DDV01 9 3 NE 41 10.0 14 Populus deltoides F F V 0 193NW437.58Prunus serotina FFV01 9 3 SE 42 4.5 6 Morus alba P P V 0 193SW4410.56Prunus serotina FFV01 9 4 NE 45 4.0 12 Acer saccharinum F F V 0 194NW469.08Acer saccharinum FPV01 9 4 SE 48 7.0 6 Acer saccharinum G F V 0 194SW478.010Acer saccharinum GFV01 9 5 NE 50 20.0 6 Morus alba P P V 0 195NW496.036Populus deltoides GFV21 9 5 SE 51 18.0 10 Morus alba F P V 0 195SW5215.06Acer saccharinum FPV01 9 6 NE 54 15.0 8 Celtis occidentalis P P V 0 196NW559.08Ulmus rubra PFV01 9 6 SE 53 9.0 12 Morus alba P P V 0 multistem 196SW569.016Ulmus rubra PFV01 10 1 NE 60 18.0 8 Morus alba F P V 0 1101NW576.022Acer saccharinum GFV01 10 1 SE 59 18.0 18 Acer saccharinum F F V 0 1101SW583.012Acer saccharinum FFV0multistemPage 279 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments1 10 2 NE 62 27.0 24 Acer saccharinum G F V 0 multistem 1102NW6113.014Acer saccharinum GFV0multistem1 10 2 SE 63 4.0 12 Morus alba F F V 0 1102SW648.026Acer saccharinum FPV0multistem1 10 3 NE 68 49.5 20 Acer saccharinum F F V 0 1103NW6627.010Acer saccharinum FFV01 10 3 SW 65 28.0 30 Acer saccharinum F P V 0 1103SW6739.012Morus alba FPV01 10 4 NE NA* 1104NWNA*1 10 4 SE 69 9.0 18 Morus alba P P V 1 multistem 1104SW708.010Morus alba PPV01 10 5 NE 71 14.0 22 Prunus serotina P P V 0 multistem 1105NW7421.020Morus alba PPV0multistem1 10 5 SE 72 10.0 10 Morus alba P P V 0 multistem 1105SW7310.014Morus alba PPV01 10 6 NE 76 19.0 10 Acer negundo P P V 0 1106NW755.06Acer negundo PPV01 10 6 SE 77 6.0 12 Acer negundo F F V 0 multistem 1106SW7832.024Acer saccharinum GFV0multistem1 10 7 NE 82 49.0 48 Salix sp F P V 0 1107NW8117.08Acer negundo FPV01 10 7 SE 79 3.0 12 Morus alba F F V 0 1107SW8026.012Acer negundo FPV01 11 1 NE 83 15.0 12 Acer negundo P P V 0 1111NW8426.08Acer negundo FFV0multistem1 11 1 SE 86 24.0 6 Celtis occidentalis F F V 0 1111SW8524.048Acer saccharinum FFV0Page 280 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments2 1 1 NE 3 54.0 36 Populus deltoides G G V 0 211NW15.05Morus alba GGV02 1 1 SE 4 50.0 10 Morus alba F G V 0 multistem 211SW22.010Morus alba GGV02 1 2 NE 7 10.0 8 Populus deltoides F F V 0 212NW524.030Populus deltoides FFV02 1 2 SE 8 9.0 5 Morus alba F F V 0 multistem 212SW615.014Morus alba GFV02 1 3 NE 9 6.0 12 Populus deltoides F F V 0 213NW1248.08Morus alba FFV0multistem2 1 3 SE 10 21.0 24 Populus deltoides F F V 0 213SW1127.08Populus deltoides GFV0multistem2 2 1 NE 15 15.0 30 Celtis occidentalis F F V 0 221NW133.024Celtis occidentalis GGV02 2 1 SE 14 3.0 10 Prunus serotina F P V 0 221SWNA*2 3 1 NE NA* 231NW165.024Maclura pomifera FFV02 3 1 SE NA* 231SW1724.030Maclura pomifera FFV02 4 1 NE NA* 241NW184.014Prunus serotina FPV12 4 1 SE 20 10.0 4 Celtis occidentalis F F V 0 241SW197.015Maclura pomifera PPV02 5 1 NE 21 3.0 8 Prunus serotina P P V 0 multistem 251NWNA*2 5 1 SE 22 8.0 8 Prunus serotina P P V 0 multistem 251SWNA*Page 281 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments2 6 1 NE 24 27.0 10 Prunus serotina G F V 0 multistem 261NW2636.08Salix sp GFV02 6 1 SE 23 42.0 12 Morus alba G F V 0 261SW2536.06Pyrus calleryana GFV0multistem2 7 1 NE 27 63.0 12 Prunus serotina G F V 0 multistem 271NW2827.05Gleditsia triacanthos GPV0multistem2 7 1 SE NA* 271SW2921.08Juniperus virginiana GGV0multistem2 8 1 NE 30 18.0 4 Prunus serotina F P V 0 281NE3236.08Cornus sericea FPV02 8 1 SE 31 10.0 2 Morus alba F P V 0 multistem 281SWNA*3 16 1 NE 115 6.0 14 Acer negundo G F V 0 3161NW11616.06Morus alba FPV03 16 1 SE 118 23.0 8 Juglans nigra F F V 0 3161SW1178.014Ulmus rubra FFV0multistem3 16 2 NE 119 27.0 4 Ulmus americana P F V 0 3162NW12020.06Morus alba GFV03 16 2 SE 121 9.0 5 Morus alba F P V 0 multistem 3162SW12215.024Ulmus americana FFV03 17 1 NE 124 12.0 14 Prunus serotina F F V 0 3171NW12515.04Ulmus americana GGV03 17 1 SE 123 10.0 14 Celtis occidentalis F F V 0 3171SW12624.014Morus alba GFV0multistem3 17 2 NE 130 33.0 10 Prunus serotina F P V 0 3172NW1286.08Prunus serotina PPV03 17 2 SE 127 4.0 4 Celtis occidentalis F P V 0 3172SW1299.012Prunus serotina FFV0Page 282 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 17 3 NE 132 9.0 6 Morus alba P P V 0 3173NW13311.06Ulmus americana FFV03 17 3 SE 131 4.0 12 Tilia americana F G V 0 3173SW1346.08Fraxinus sp DDV03 18 1 NE 136 20.0 14 unknown D D V 0 3181NW1389.023Morus alba GFV0multistem3 18 1 SE 135 8.0 8 Ulmus americana F F V 0 3181SW13710.010Fraxinus sp DDV03 18 2 NE 141 18.0 12 Morus alba P P V 0 multistem 3182NW1429.03Celtis occidentalis PFV03 18 2 SE 139 4.0 30 Populus deltoides G F V 0 3182SW14012.04Prunus serotina PPV03 18 3 NE 146 18.0 32 Populus deltoides G F V 0 multistem 3183NW1457.05Acer saccharum GGV03 18 3 SE 143 12.0 24 Populus deltoides G F V 0 multistem 3183SW14410.030Ulmus sp DDV03 18 4 NE 148 6.0 22 Populus deltoides F F V 0 3184NW14712.048Populus deltoides GGV23 18 4 SE 149 10.0 34 Populus deltoides F F V 0 3184SW1509.020unknown DDV0stump 3 19 1 NE 151 7.0 12 Morus alba F F V 0 3191NW1528.06Morus alba PPV03 19 1 SE 153 5.0 8 Ulmus rubra F P V 0 3191SW15415.06Prunus serotina PPV03 19 2 NE 155 15.0 12 Ulmus rubra F P V 0 3192NW15614.06Ulmus rubra FFV03 19 2 SE 157 15.0 7 Prunus serotina P P V 0 3192SW15830.06Ulmus americana GFV0Page 283 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 19 3 NE 159 15.0 24 Morus alba P P V 0 multistem 3193NWNA*3 19 3 SE 160 12.0 20 Ulmus rubra P F V 0 3193SWNA*3 19 4 NE 161 23.0 12 Morus alba F P V 0 multistem 3194NW16415.06Acer saccharum FFV03 19 4 SE 162 18.0 6 Fraxinus pennsylvanica F F V 0 3194SW1636.08Prunus serotina FPV0multistem3 19 5 NE 165 30.0 32 Ulmus rubra F P V 0 3195NWNA*3 19 5 SE 166 10.0 16 Morus alba F P V 0 multistem 3195SWNA*3 19 6 NE 167 12.0 12 Prunus serotina P F V 0 3196NE17033.011Ulmus rubra PPV03 19 6 NW 169 12.0 10 Prunus serotina F P V 0 3196SW16820.010Prunus serotina FPV03 20 1 NE NA* 3201NW17221.014unknown DDV0multistem3 20 1 SE 171 24.0 10 Prunus serotina F P V 0 3201SWNA*3 21 1 NE 173 5.0 4 Morus alba F F V 0 3211NW1746.012Morus alba GFV03 21 1 SE NA* 3211SW17539.012Morus alba FFV03 21 2 NE 176 10.0 32 Populus deltoides G F V 0 3212NW1779.05Prunus serotina FFV03 21 2 SE 179 10.0 6 Prunus serotina F P V 0 3212SW17810.06Prunus serotina FFV0Page 284 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 22 1 NE 180 8.0 12 Ulmus rubra P P V 0 multistem 3221NW18211.04Prunus serotina FFV03 22 1 SE 181 15.0 10 Prunus serotina F F V 0 multistem 3221SW18320.014Fraxinus sp DDV03 22 2 NE 185 13.0 6 Prunus serotina F P V 0 3222NW1848.06Prunus serotina FPV03 22 2 SE 187 27.0 7 Prunus serotina F F V 0 3222SW18626.06Morus alba FFV03 23 1 NE 190 8.0 4 Fraxinus sp D D V 0 3231NW1898.04Morus alba GFV03 23 1 SE 191 12.0 6 Ulmus rubra F F V 0 3231SW1886.010Ulmus rubra FFV03 24 1 NE 192 10.0 10 Populus deltoides F P V 0 3241NW19310.06Juniperus virginiana PFV03 24 1 SE 195 22.0 10 Populus deltoides G F V 0 3241SW1948.010Populus deltoides FPV03 24 2 NE 197 6.0 4 Ulmus americana G F V 0 3242NW19810.010Populus deltoides FFV03 24 2 SE 199 12.0 20 Populus deltoides G G V 0 3242SW19610.014Acer saccharum GGV03 25 1 NE 201 30.0 8 Ulmus americana P P V 0 3251NW20015.010Populus deltoides DDV0multistem3 25 1 SE 202 4.0 7 unknown D D V 0 3251SW20312.04Ulmus americana PPV03 25 2 NE 206 8.0 8 Prunus serotina P P V 0 3252NW2055.03Juniperus virginiana PPV03 25 2 SE 207 3.0 4 Ulmus americana G F V 0 3252SW20412.012Populus deltoides FFV0Page 285 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 26 1 NE 209 12.0 5 Prunus serotina F F V 0 3261NW2086.04Prunus serotina FPV03 26 1 SE 210 12.0 4 Prunus serotina P F V 0 3261SW21115.05Prunus serotina PPV03 26 2 NE 214 20.0 10 Prunus serotina G F V 0 3262NW21515.04Populus alba PPV03 26 2 SE 213 15.0 6 Prunus serotina F F V 0 3262SW21220.06Prunus serotina FPV03 26 3 NE 218 6.0 4 Prunus serotina F F V 0 3263NW2193.04Prunus serotina FPV03 26 3 SE 217 12.0 6 Prunus serotina F F V 0 3263SW21612.04Prunus serotina FPV03 27 1 NE 220 15.0 10 Prunus serotina G F V 0 multistem 3271NW22114.06Prunus serotina FPV03 27 1 SE 223 14.0 4 Celtis occidentalis F F V 0 3271SW22215.06Prunus serotina PPV03 27 2 NE 226 10.0 10 Juglans nigra F F V 0 3272NW22518.06Ulmus rubra FPV03 27 2 SE 227 20.0 11 Morus alba F F V 0 3272SW22412.06Ulmus rubra FPV03 27 3 NE 229 23.0 10 Prunus serotina F F V 0 3273NW2286.04Morus alba FFV03 27 3 SE 231 12.0 10 Morus alba G F V 0 3273SW23016.010Prunus serotina FPV03 28 1 NE 233 20.0 12 Ulmus sp D D V 0 3281NW23215.06Ulmus sp DDV03 28 1 SE 235 16.0 4 Morus alba P P V 0 multistem 3281SW2343.01Morus alba FPV0Page 286 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 28 2 NE 239 21.0 6 Morus alba P F V 0 3282NW2367.06Ulmus americana FFV03 28 2 SE 238 7.0 6 Ulmus americana G F V 0 3282SW2378.04Ulmus rubra FFV03 29 1 NE 240 5.0 8 Ulmus americana G F V 0 3291NW24312.06Celtis occidentalis GFV03 29 1 SE 241 1.0 10 Juglans nigra F P V 0 multistem 3291SW2426.04Prunus serotina FFV03 29 2 NE 245 6.0 4 Ulmus americana F F V 0 3292NW2466.05Ulmus americana FFV03 29 2 SE 244 0.5 4 Ulmus americana D D V 0 3292SW2475.04Ulmus americana FFV03 29 3 NE 251 14.0 4 Prunus serotina F P V 0 3293NW2485.02Prunus serotina PPV03 29 3 SE 250 2.0 10 Ulmus americana G F V 0 3293SW24912.06Prunus serotina FFV03 30 1 NE 253 2.0 5 Prunus serotina F P V 0 3301NW2528.010Morus alba GFV03 30 1 SE 254 10.0 8 Morus alba F F V 0 3301SW25518.08Prunus serotina FPV03 30 2 NE 256 8.0 4 Morus alba P P V 0 3302NW2571.03Ulmus americana FPV03 30 2 SE 259 2.0 4 Ulmus americana G F V 0 3302SW25822.04Morus alba PPV03 30 3 NE 260 6.0 6 unknown D D V 0 3303NW2618.06Morus alba FPV03 30 3 SE 263 18.0 8 Morus alba P P V 0 multistem 3303SW2626.014Morus alba GFV0multistemPage 287 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments3 31 1 NE 264 16.0 30 Ulmus americana F F V 0 3311NW26512.06Morus alba PPV03 31 1 SE 267 20.0 32 Morus alba G F V 0 3311SW26610.014Ulmus americana FFV03 31 2 NE 268 9.0 14 Juglans nigra P P V 0 multistem 3312NW26916.010Prunus serotina GPV03 31 2 SE 271 12.0 14 Ulmus rubra F P V 0 3312SW2704.012Ulmus rubra FFV03 32 1 NE 272 5.0 4 Juglans nigra F F V 0 3321NW27310.08Juglans nigra FFV03 32 1 SE 275 6.0 6 Juglans nigra F F V 0 3321SW2746.03Prunus serotina PPV04 12 1 NE 88 15.0 12 Prunus serotina F F V 0 4121NW876.04Prunus serotina PPV04 12 1 SE 89 9.0 22 Celtis occidentalis F F V 0 4121SW9011.06Juglans nigra FPV04 12 2 NE 91 5.0 6 Prunus serotina D D V 0 4122NW9232.08Juglans nigra FFV04 12 2 SE 94 29.0 11 Ulmus americana P F V 0 4122SW9321.010Juglans nigra FFV04 13 1 NE 98 50.0 12 Fraxinus sp D P V 0 4131NW9516.08Fraxinus sp DPV04 13 1 SE 97 12.0 5 Prunus serotina P F V 0 4131SW9614.010Morus alba PPV04 13 2 NE 101 21.0 8 Prunus serotina F P V 0 4132NW999.020Prunus serotina PPV04 13 2 SE 100 9.0 6 Fraxinus sp D D V 1 4132SW10218.024Populus deltoides FFV0Page 288 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments4 14 1 NE 103 14.0 24 Populus deltoides F F V 0 4141NW10514.010Fraxinus sp DDV04 14 1 SE 104 6.0 30 Populus deltoides F F V 0 4141SW10638.014Fraxinus sp DDV04 14 2 NE 110 12.0 12 Fraxinus sp D D V 0 4142NW1096.06Ulmus americana PPV04 14 2 SE 107 15.0 8 Prunus serotina D D V 0 4142SW10816.014Fraxinus sp DDV04 15 1 NE 114 24.0 20 Prunus serotina P P V 0 multistem 4151NW11112.05Celtis occidentalis FPV04 15 1 SE 113 16.0 8 Morus alba F F V 0 4151SW11227.024Populus deltoides FFV05 33 1 NE 276 8.0 14 Populus alba G G V 0 5331NW2778.014Robinia pseudoacacia GFV05 33 1 SE 278 2.0 6 Ulmus americana F F V 0 5331SWNA*5 33 2 NE 279 2.0 4 Ulmus americana F F V 0 5332NW2802.02Robinia pseudoacacia FFV05 33 2 SE 282 2.0 4 Ulmus americana P F V 0 5332SW2816.02Ulmus americana PPV05 34 1 NE 287 4.0 6 Robinia pseudoacacia P F V 0 5341NW28610.06Robinia pseudoacacia FFV05 34 1 SE 288 6.0 4 Juglans nigra F P V 0 5341SW2895.04Robinia pseudoacacia FFV05 34 2 NE 293 2.0 4 Populus alba F F V 0 5342NW2903.06Populus alba FFV05 34 2 SE 292 3.0 3 Populus alba F P V 0 5342SW2914.04unknown DDV0Page 289 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments5 34 3 NE 294 6.0 8 Ulmus americana F F V 0 siberian? 5343NW2974.02Ulmus americana PPV0siberian?5 34 3 SE 295 2.0 2 Ulmus americana P F V 0 siberian? 5343SW2966.05Ulmus americana PPV0siberian?5 35 1 NE 283 6.0 8 Robinia pseudoacacia F F V 0 5351NW28410.04Robinia pseudoacacia FFV05 35 1 SE NA* 5351SW2856.05Robinia pseudoacacia PFV05 35 2 NE NA* 5352NW30610.014Robinia pseudoacacia GPV05 35 2 SE 308 12.0 14 Robinia pseudoacacia F F V 0 5352SW30715.016Robinia pseudoacacia FFV05 36 1 NE 298 10.0 8 Robinia pseudoacacia P P V 0 multistem 5361NW2995.06Robinia pseudoacacia DDV05 36 1 SE 301 10.0 16 unknown D D V 0 hollow 5361SW3009.012Morus alba GFV05 37 1 NE 302 10.0 6 Robinia pseudoacacia F P V 0 5371NW30316.06Morus alba FPV05 37 1 SE 305 6.0 4 Robinia pseudoacacia P P V 0 5371SW3042.06Robinia pseudoacacia FFV05 38 1 NE 309 8.0 6 Morus alba F F V 0 5381NW31020.05Robinia pseudoacacia PPV05 38 1 SE 312 13.0 14 Robinia pseudoacacia F F V 0 5381SW3116.04Morus alba FFV05 38 2 NE 314 24.0 18 Ulmus americana F F V 0 5382NW31330.04 Fraxinus pennsylvanica FPV05 38 2 SE 315 6.0 20 Acer saccharum G F V 0 5382SW31633.010Morus alba FFV0Page 290 UnitTransect PointQuadrant TreeNo.Distance (ft) DBH Species Health1Structure1Origin2Endangered Bat Rating3Comments5 38 3 NE NA* 5383NW31722.026Morus alba FFV05 38 3 SE 319 15.0 20 Prunus serotina F F V 0 5383SW31830.05Acer saccharum GFV05 38 4 NE 320 30.0 8 Prunus serotina G F V 0 5384NW32120.06Ulmus americana FFV05 38 4 SE 322 30.0 16 Prunus serotina P P V 0 multistem 5384SWNA*6 39 1 NE 323 8.0 5 Juglans nigra F F V 0 6391NW32412.05Morus alba PPV06 39 1 SE 326 12.0 8 Ulmus americana F F V 0 6391SW32510.04Celtis occidentalis FFV06 39 2 NE 327 16.0 6 Juglans nigra P P V 0 6392NW32812.06Juglans nigra PPV06 39 2 SE 330 12.0 4 Juglans nigra F F V 0 6392SW3293.012Juglans nigra PFV06 39 3 NE NA* 6393NW33115.010Prunus serotina PPV06 39 3 SE 333 15.0 8 Morus alba F F V 0 6393SW33210.06Morus alba PFV01.Health&Structureratings:G=Good,F=Fair,P=Poor,D=Dead2.Originratings:L=Landscaped,V=Volunteer3.Potentialroostingcharacteristics(i.e.peelingbark&cavities)wasassessedforIndianabat(Myotissodalist)andnorthernlongͲearedbat(Myotisseptentrionalis).Habitatratings:0=0%bathabitat,1=1Ͳ20%,2=21Ͳ40%,3=41Ͳ60%,5=81Ͳ100%*QuadrantswiththenearesttreelocatedoutsideofthewoodstandunitboundaryarelabeledasNotApplicable(NA)Page 291 143rd Street Extension, Plainfield, Will Co., IL Wetlands Delineation Report 143rd Street Extension Plainfield, Will County, Illinois Section 06‐00040‐00‐FP NOVEMBER 15, 2019 PREPARED BY: CRAWFORD, MURPHY & TILLY, INC. 550 NORTH COMMONS DRIVE SUITE 116 AURORA, IL 60504 PREPARED FOR: VILLAGE OF PLAINFIELD 24401 W. LOCKPORT STREET PLAINFIELD, IL 60544 Page 292 143rd Street Extension, Plainfield, Will Co., IL TABLE OF CONTENTS 1.0 EXECUTIVE SUMMARY .................................................................................................. 1 2.0 METHODOLOGY ............................................................................................................ 2 2.1 Wetlands ...................................................................................................................... 2 2.1.1 Hydrophytic Vegetation ......................................................................................... 2 2.1.2 Hydric Soil ............................................................................................................ 2 2.1.3 Wetland Hydrology................................................................................................ 2 2.2 Streams ....................................................................................................................... 3 2.3 Other Surface Water Resources .................................................................................. 3 3.0 BACKGROUND INFORMATION ..................................................................................... 4 3.1 Project Description ....................................................................................................... 4 3.2 Project Location ........................................................................................................... 4 3.3 Historical or Published Information ............................................................................... 7 4.0 RESULTS ........................................................................................................................ 8 4.1 Wetlands ...................................................................................................................... 8 Wetland A ........................................................................................................................... 8 Wetland B ........................................................................................................................... 9 Wetland C ........................................................................................................................... 9 Wetland D ..........................................................................................................................10 Wetland E ..........................................................................................................................10 4.2 Streams ......................................................................................................................10 DuPage River ....................................................................................................................10 4.3 Other Surface Water Resources .................................................................................11 Pond 1 ............................................................................................................................11 Fletcher Lake .....................................................................................................................11 Main Lake ..........................................................................................................................11 5.0 Conclusions ....................................................................................................................12 6.0 REFERENCES ...............................................................................................................13 Page 293 143rd Street Extension, Plainfield, Will Co., IL APPENDICES Appendix A Project Mapping Appendix B Data Forms Appendix C Photographs Appendix D Huff & Huff Wetland Delineation (2016) Page 294 143rd Street Extension, Plainfield, Will Co., IL 1 1.0 EXECUTIVE SUMMARY This wetland delineation report has been prepared at the request of the Village of Plainfield. The purpose of this report is to describe the wetlands and other regulated waters located within the expanded study area for the proposed 143rd Street extension between IL-59 and IL-126 in Plainfield, Will County, Illinois. A wetland delineation was conducted in 2016 by Huff & Huff (H&H) within the original study area limits. Since then, the project alignment has shifted, and the study area was expanded. The purpose of this investigation is to identify any wetlands and other surface waters located within the expanded study area. The Clean Water Act defines wetlands as “those areas that are inundated or saturated by surface or ground water at a frequency and duration sufficient to support, and that under normal circumstances do support, a prevalence of vegetation typically adapted for life in saturated soils.” Thus, in accordance with the 1987 Corps of Engineers Wetlands Delineation Manual and the Midwest Regional Supplement, for an area to be considered a wetland, it must meet all of the following criteria, under normal circumstances: wetland hydrology, a dominance of hydrophytic vegetation, and hydric soils. The entire expanded study area was searched for wetlands and other surface water resources during the site visit conducted. Five (5) wetlands, the DuPage River and three (3) ponds were identified within the expanded study area. SUMMARY OF RESOURCES The following are present within the expanded study area: Wetlands – Five (5) wetlands (0.08 acres) Streams – DuPage River Other Surface Waters – Three (3) ponds Page 295 143rd Street Extension, Plainfield, Will Co., IL 2 2.0 METHODOLOGY 2.1 W ETLANDS The on-site evaluation of the expanded study area was conducted during site visits on June 26 and 27, 2019 and on July 2 and 12, 2019. When evaluating for the presence of wetlands, CMT personnel used the routine method presented in the 1987 Corps of Engineers Wetlands Delineation Manual and the Midwest Regional Supplement. In order for an area to be classified as a wetland, the area has to have a dominance of hydrophytic vegetation, hydric soils and wetland hydrology. The specific indicators used for each of the three parameters are noted in the following paragraphs. 2.1.1 HYDROPHY TIC VEGETATION According to Tiner (2012), a hydrophyte is a vascular plant that grows in water or on a substrate that is saturated at a frequency and duration during the growing period sufficient to affect plant occurrence. Using this definition, the U.S. Army Corps of Engineers released the National Wetland Plant List. This list categorizes species according to their probability of occurrence in wetlands based on the ecological region. The list identifies five general plant indicator status categories: ❖ Obligate (OBL): almost always is a hydrophyte, rarely in uplands ❖ Facultative Wetland (FACW): Usually is a hydrophyte but occasionally found in uplands ❖ Facultative (FAC): Commonly occurs as either a hydrophyte or non-hydrophyte ❖ Facultative Upland (FACU): Occasionally is a hydrophyte but usually occurs in uplands ❖ Obligate Upland (UPL): Rarely is a hydrophyte, almost always in uplands In order to satisfy the hydrophytic vegetation criteria required for a jurisdictional wetland, the area had to be dominated (over 50 percent) by obligate wetland plants, facultative wetland plants, and facultative plants. 2.1.2 HYDRIC SOIL Hydric soil is soil formed under conditions of saturation, flooding, or ponding long enough during the growing season to develop anaerobic conditions in the upper part. The concept of hydric soils includes soils developed under sufficiently wet conditions to support the growth and regeneration of hydrophytic vegetation. Hydric soil indicators include the presence of histosols, histic epipedons, reducing conditions, gleyed or low chroma soil colors, and high organic content or organic streaking in sandy soil. An additional hydric soil indicator used was if the mapped and confirmed soil type appears on the local or national hydric soils list. 2.1.3 WETLAND HYDROLOGY Wetland hydrology is defined as an area that is inundated or saturated at or near the surface for at least five percent of the growing season in most years. This can include areas that are ponded, flooded, or those areas that have a water table at or near the surface. Indications of wetland hydrology included surface water, saturation, evidence of drift deposits, iron deposits or drainage Page 296 143rd Street Extension, Plainfield, Will Co., IL 3 patterns, and inundation. Indicators such as water-stained leaves, oxidized root channels within 12 inches below ground surface on living plants, the FAC neutral test, and local soil survey data were also used to indicate wetland hydrology. 2.2 S TREAMS Streams were evaluated for their jurisdictional status based on the definition of waters of the United States, which requires the presence of an ordinary high-water mark (OHWM) and ultimate connection to downstream Traditional Navigable Waters (TNW). The following USACE definitions for the three streams types were used: Ephemeral streams have flowing water only during and for a short duration after, precipitation events in a typical year. Ephemeral stream beds are located above the water table year-round. Groundwater is not a source of water for the stream. Runoff from rainfall is the primary source of water for stream flow. Intermittent streams have flowing water during certain times of the year, when groundwater provides water for stream flow. During dry periods, intermittent streams may not have flowing water. Runoff from rainfall is a supplemental source of water for stream flow. Perennial Streams have flowing water year-round during a typical year. The water table is located above the stream bed for most of the year. Groundwater is the primary source of water for stream flow. Runoff from rainfall is a supplemental source of water for stream flow. The determination of stream designation is based on an evaluation of the size of the watershed for each stream, the presence of flow during the on-site evaluation and the evidence observed of the frequency of flow and the presence of aquatic life. 2.3 OTHER SURFACE WATER RESOURCES Other surface water resources include features such as lakes/ponds, drainage swales, and jurisdictional ditches. Evaluation of other surface water resources was based on the presence of an ordinary high-water mark (OHWM) and/or on their jurisdictional status. Page 297 143rd Street Extension, Plainfield, Will Co., IL 4 3.0 BACKGROUND INFORMATION 3.1 PROJECT DESCRIPTION The proposed project involves roadway extension intersection improvements of 143rd Street from IL-59 to IL-126 in Plainfield, Will County, Illinois. A wetland delineation was conducted in 2016 by Huff & Huff (H&H) within the original study area limits (Appendix D). Since then, the project alignment has shifted, and the study area was expanded. This wetland investigation delineated any wetlands and other surface waters located within the expanded study area beyond the original 2016 study area limits. The anticipated improvements include extension of 143rd Street along the existing Com-Ed easement as a four-lane roadway and construction of a bridge over the DuPage River. Intersection improvements to accommodate the roadway extension are also planned at IL-59, Naperville Road, and IL-126. Project mapping is provided in Appendix A. 3.2 PROJECT LOCATION The project is located at the intersection of W 143rd Street and IL-59 and extends east along existing Com-Ed easement to the intersection of E 143rd Street and IL-126 in Plainfield, Will County, Illinois. The Village of Plainfield is located in northern Will County, as shown on Figure 1. The study area on an aerial photograph is shown on Figure 2. The areas between the pink lines and red lines in Figure 2 are the expanded area that this report focuses on. The study area is in a moderately developed area with predominately commercial development and residential areas. FIGURE 1 – COUNTY LOCATION MAP Page 298 143rd Street Extension, Plainfield, Will Co., IL 6 FIGURE 2 – STUDY AREA Page 299 143rd Street Extension, Plainfield, Will Co., IL 7 3.3 H ISTORICAL OR P UBLISHED I NFORMATION The major water course that travels through this region is the DuPage River. The study area is located within the Des Plains River watershed, within the 8-digit Hydrologic Unit Code (HUC) 07120004 and within the DuPage River watershed 12-digit HUCs 071200040806, 071200040807, and 071200040808. The Natural Resources Conservation Service (NRCS) Will County Soil Survey (Appendix A) indicates the following soils are present within the study area, several of which are indicated to be hydric: ❖ 152A – Drummer silty clay loam, 0 to 2 percent slopes, hydric ❖ 223C2 – Varna silt loam, 4 to 6 percent slopes, eroded, hydric ❖ 290A - Warsaw silt loam, 0 to 2 percent slopes, hydric ❖ 290B - Warsaw silt loam, 2 to 4 percent slopes, not hydric ❖ 318C2 - Lorenzo loam, 4 to 6 percent slopes, eroded, not hydric ❖ 356A - Elpaso silty clay loam, 0 to 2 percent slopes, hydric ❖ 523A - Dunham silty clay loam, 0 to 2 percent slopes, hydric ❖ 541B - Graymont silt loam, 2 to 5 percent slopes, hydric ❖ 541C2 - Graymont silt loam, 5 to 10 percent slopes, eroded, hydric ❖ 614A - Chenoa silty clay loam, 0 to 2 percent slopes, hydric ❖ 802B - Orthents, loamy, undulating, hydric ❖ 802D - Orthents, loamy, rolling, not hydric ❖ 8321A - Du Page silt loam, 0 to 2 slopes, occasionally flooded, hydric ❖ W - Water The National Wetlands Inventory (NWI) (Appendix A) indicates three (3) freshwater emergent wetlands, one (1) freshwater pond, three (3) lakes and one (1) riverine wetland are located within or adjacent to the entire study area. The Federal Emergency Management Agency (FEMA) Flood Insurance Rate Map (FIRM) map (Appendix A) indicates that portions of the entire study area are located within FEMA Flood Zones A, which corresponds to the 1% annual chance of a flood with no base flood elevations, and Zone AE, which corresponds to the 1% annual chance of a flood with base flood elevations. These flood zones are the FEMA designated 100-year floodplain for the DuPage River and for Fletcher Lake and Lake Plainfield, both historic mining ponds. According to the NWI and USGS topographic maps (Appendix A), the DuPage River and two streams are located within the 143rd Street Extension study area. Page 300 143rd Street Extension, Plainfield, Will Co., IL 8 4.0 RESULTS Five (5) wetlands, one (1) stream, the DuPage River, and three (3) ponds (Pond 1, Fletcher Lake, and Main Lake) were identified within the expanded study area beyond the original study area during the June 26 and 27 and July 2 and 12, 2019 site visits. The following surface waters are located adjacent or near to the study area, but were not assessed as part of this report: Lake Plainfield (Mining Pond 4) located within the Pure Rod and Gun Club, adjacent approximately 20 feet southeast of the study area; an unnamed lake (Mining Pond 3) located within the Deer Creek Recreation Club, adjacent approximately 25 feet east of the study area; and, Lily Cache Creek located approximately 2,500 feet east of the study area. The Water Resources Map provided in Appendix A depicts the location of the resources within and immediately adjacent to the expanded study area, as well as the H&H (2016) water resources identified within the original study area, on an aerial photograph. Data forms indicating the field conditions observed during the site visits are included in Appendix B. Representative photographs are provided in Appendix C. 4.1 W ETLANDS Five (5) wetlands (Wetlands A-E) were identified within the expanded study area. A summary of the wetland data is provided in Table 1 below. Details on the soil, hydrology, and dominant vegetation for each wetland is provided on the Routine Wetland Determination Data Forms included in Appendix B, along with the floristic qualitative assessment data. The Water Resources Map in Appendix A shows the location of the wetlands within the expanded study area. Photographs of each wetland are provided in Appendix C. CMT biologists confirmed the presence and boundary of Site 1 identified by H&H (2016). Site 1 is located within the original study area and continues into the expanded study area (Appendix A and D). WETLAND A Wetland A is an emergent palustrine wetland abutting Pond 1 within the DuPage River floodway. This wetland was dominated by slender spike rush (Eleocharis tenuis) and reed canary grass (Phalaris arundinacea). The wetland exhibited problematic hydric soils as it was located along a constructed pond within a floodplain and had soils with high-chroma subsoils. The wetland had multiple primary hydrology indicators including a high-water table, saturation, water marks, an algal mat or crust, inundation visible on aerial imagery, presence of reduced iron, and a thick muck surface. The total mean C-value for Wetland A is 0.9 (native mean C-value is 1.5) and the total FQI is 2.4 (native FQI is 3), indicating that the plant community is considered low quality and severely degraded. Page 301 143rd Street Extension, Plainfield, Will Co., IL 9 Table 1: WETLAND SUMMARY WETLAND NAME WETLAND TYPE CONNECTIVITY NWI CLASSIF- ICATION FLORISTIC QUALITY ASSESSMENT Native FQI/ Native Mean C- Value FUNCTIONAL CLASSIFICATION (Based on FQI) ACRES WITHIN EXPANDED STUDY AREA Wetland A Emergent, Palustrine Pond 1>DuPage River floodway>DuPage River>Des Plains River None 3 / 1.5 Severely Degraded 0.064 Wetland B Forested, Palustrine Fletcher Lake floodplain None 4 / 2.3 Severely Degraded 0.022 Wetland C Forested, Palustrine Fletcher Lake floodplain None 4.9 / 3.5 Severely Degraded 0.003 Wetland D Forested, Palustrine Fletcher Lake (Bass and Gill Club) None 4.6 / 2.3 Severely Degraded 0.12 Wetland E Emergent, Palustrine Main Lake (Bass and Gill Club) Lake (L1UBHx) 7.1 / 2.5 Degraded 0.08 TOTAL 0.08 WETLAND B Wetland B is a forested palustrine wetland located within the Fletcher Lake floodplain. Fletcher Lake is not known to flow into any other water body. This wetland was dominated by cottonwood (Populus deltoides) and met the 2cm Muck hydric soil indicator. The wetland had multiple primary hydrology indicators including surface water of 3 inches, a high-water table, sparsely vegetated concave surface, and water-stained leaves. The total mean C-value for Wetland B is 1.4 (native mean C-value is 2.3) and the total FQI is 3.1 (native FQI is 4), indicating that the plant community is considered low quality and severely degraded. WETLAND C Wetland C is a forested palustrine wetland located within the Fletcher Lake floodplain. Fletcher Lake is not known to flow into any other water body. This wetland was dominated by American elm (Ulmus americana) and common buckthorn (Rhamnus cathartica). The soils sampled within the wetland met the Dark Surface hydric soil indicator. The wetland had multiple primary hydrology indicators including surface water of 3 inches, a high-water table, saturation, and sparsely vegetated concave surface. Page 302 143rd Street Extension, Plainfield, Will Co., IL 10 The total mean C-value for Wetland C is 2.3 (native mean C-value is 3.5) and the total FQI is 4 (native FQI is 4.9), indicating that the plant community is considered low quality and severely degraded. WETLAND D Wetland D is a forested palustrine wetland abutting Fletcher Lake within the Bass and Gill Club. Fletcher Lake is not known to flow into any other water body. This wetland was dominated by cottonwood (Populus deltoides), common buckthorn (Rhamnus cathartica), amur honeysuckle (Lonicera maackii), silver maple (Acer saccharinum), and Virginia creeper (Parthenocissus quinquefolia). The soils sampled within the wetland met the Dark Surface hydric soil indicator. The wetland had multiple primary hydrology indicators including surface water of 12 inches, a high-water table, saturation, and a sparsely vegetated concave surface. The total mean C-value for Wetland D is 1.5 (native mean C-value is 2.3) and the total FQI is 3.7 (native FQI is 4.6), indicating that the plant community is considered low quality and severely degraded. WETLAND E Wetland E is an emergent palustrine wetland abutting Main Lake within the Bass and Gill Club. Main Pond is not known to flow into any other surface water. This wetland was dominated by giant reed grass (Phragmites australis) and met the Depleted Matrix hydric soil indicator. The wetland had multiple primary hydrology indicators including surface water of 1 inch, high water table, saturation, and an algal mat or crust. The total mean C-value for Wetland E is 1.8 (native mean C-value is 2.5) and the total FQI is 6 (native FQI is 7.1), indicating that the plant community is considered low quality and degraded. 4 .2 S TREAMS One (1) stream, the DuPage River, was identified within the expanded study area. Lily Cache Creek is located approximately 2,500 feet east of the study area and was not assessed as part of this report. The Water Resources Map in Appendix A shows the location of the DuPage River within the entire study area. Photographs of the DuPage River are provided in Appendix C. DUPAGE RIVER The DuPage River was identified in the H&H (2016) report as Site W3 (Appendix D). Approximately 0.76 acres and approximately 910 linear feet of the DuPage River is located within the expanded study along the northern limits. The DuPage River is a perennial relatively permanent water (RPW) exhibiting a defined OHWM with an approximate width of 80-140 feet and an approximate depth of 48-60 inches. Observed substrate include gravel, silt, and artificial concrete. Approximately 230 linear feet of the southern bank through the expanded study area was encased by a concrete retaining wall. The DuPage River flows into the Des Plains River, a traditional navigable waterway (TNW). The DuPage River is likely a jurisdictional water of the U.S. Page 303 143rd Street Extension, Plainfield, Will Co., IL 11 4.3 OTHER SURFACE WATER RESOURCES The entire study area was searched for other surface water resources during the site visit conducted. Within the expanded study area, a total of three (3) ponds were identified: Pond 1, Fletcher Lake, and Main Lake. The Water Resources Map in Appendix A shows the location of Pond 1, Fletcher Lake, and Main Lake on the project site. Photographs of the ponds are provided in Appendix C. Lake Plainfield (Mining Pond 4), located within the Pure Rod and Gun Club, adjacent approximately 20 feet southeast of the study area along State Route 126, and an unnamed lake (Mining Pond 3), located within the Deer Creek Recreation Club, adjacent approximately 25 feet east of the study area, were identified within the H&H (2016) report. These surface waters were not assessed in this report or in the H&H (2016) report due to their location outside of the study area. POND 1 Pond 1 was identified in the H&H (2016) report as Pond 1 (Appendix D). Pond 1 is a total of 2.4 acres and is located entirely within the expanded study area. Pond 1 (approximately 36 inches in depth) is located within the DuPage River floodway approximately 40 feet from the eastern bank of the river. The pond appears to have been excavated after 1939, likely between 1974 and 1988, and is likely not associated with a previously undisturbed natural water feature. Due to the pond’s connection to the DuPage River floodway, Pond 1 may be considered a jurisdictional Water of the U.S. FLETCHER LAKE Fletcher Lake was identified in the H&H (2016) report as Mining Pond 1 (Appendix D). Approximately 11.3 acres of Fletcher Lake is located within the entire study area. This area is a former gravel pit excavated between 1952 and 1961 and is now owned by the Bass and Gill Club, Inc. Fletcher Lake is not known to directly flow to any other surface water; however, FEMA mapping (Appendix A) show the Fletcher Lake floodplain connects to the DuPage River floodway. MAIN LAKE Main Lake was identified in the H&H (2016) report as Mining Pond 2 (Appendix D). Approximately 0.1 acre of Main Lake is located within the entire study area. This area is a former gravel pit excavated between 1952 and 1961 and is now owned by the Bass and Gill Club, Inc. Main lake is not known to directly flow to any other surface water. Page 304 143rd Street Extension, Plainfield, Will Co., IL 12 5.0 CONCLUSIONS Five (5) small wetlands totaling 0.08 acres were identified within the expanded study area. These wetlands were all degraded, low quality wetlands. Wetland E may provide minimal shoreline protection of Main Lake. One (1) wetland was abutting Main Lake within the DuPage River floodplain and may be considered a jurisdictional water of the U.S. The other four (4) wetlands are located either within the floodplains of the mining ponds or abutting the mining ponds; however, the mining ponds are not known to connect to any other surface water. They are likely not considered a jurisdictional water of the U.S due to the lack of known hydrologic connectivity to known waters of the U.S. The DuPage River flows into the Des Plains River, a traditional navigable waterway (TNW), and is likely a jurisdictional water of the U.S. Pond 1 may be considered a jurisdictional water of the U.S. due to its connection to the DuPage River floodway. The mining ponds (Fletcher Lake and Main Lake) are likely not considered jurisdictional waters of the U.S. because they lack a direct connection to a TNW and were excavated due to mining activities. Wetlands and other surface water resources that are considered waters of the U.S. are subject to regulation under Section 404 of the Clean Water Act (CWA) and the jurisdictional regulatory authority lies with the U.S. Army Corps of Engineers (USACE). Additionally, the IDNR has regulatory authority over nonfederal wetlands, navigable waters, and adjacent lands under the Interagency Wetlands Policy Act for state or state-funded projects. Any wetlands or waters that are not under jurisdiction will be regulated by the Will County Stormwater Management Ordinance as administered by the Village of Plainfield. Page 305 143rd Street Extension, Plainfield, Will Co., IL 13 6 .0 REFERENCES The following references were consulted during the investigation: ❖ Braun, E. Lucy, 1989. The Woody Plants of Ohio. Ohio State University Press. Columbus. ❖ Brown, Lauren, Grasses an Identification Guide. Houghton Mifflin Company. New York, 1979. ❖ Brown, Lauren, 1997. Wildflowers and Winter Weeds. W.W. Norton and Company. New York. ❖ Cowardin, L.M., V. Carter, F.C. Golet and E.T. LaRoe, 1979. Classification of Wetlands and Deepwater Habitats of the United States. U.S. Fish and Wildlife Service, Biological Survey Program FWS/OBS-79/31. ❖ Crow, Garrett E. and Barre Hellquist. Aquatic and Wetland Plants of Northeastern North America, Volume 2 Angiosperms: Monocotyledons. The University of Wisconsin Press. Madison, Wisconsin, 2000. ❖ Gleason, H.A. and A. Cronquist. 1992. Manual of Vascular Plants of Northeastern United States and Adjacent Canada. Van Nostrand, Princeton, New Jersey, 2nd Edition. ❖ Holmgren, Noel H. 1998. The Illustrated Companion to Gleason and Cronquist’s Manual: illustrations of the vascular plants of northeastern United States and adjacent Canada. The New York Botanical Garden, Bronx, New York. ❖ Knobel, Edward, Field Guide to the Grasses, Sedges and Rushes of the United States. Dover Publications, Inc. New York, 1977. ❖ Munsell Soil Color Charts. 1994 Revised Edition. Macbeth Division of Kollmorgen Instruments Corporation. New Windsor, New York. ❖ Natural Resources Conservation Service (NRCS) Soil Survey of Will County. Issued September 2016. ❖ Newcomb, Lawrence, Newcomb’s Wildflower Guide. Little, Brown and Company, Boston, New York, Toronto, London, 1977. ❖ National Wetland List of Plant Species That Occur in Wetlands, Illinois. U.S. Fish and Wildlife Service, May 2016. ❖ Taft, John B., Wilhelm, Gerould S., Ladd, Douglas M., and Masters, Linda A. Floristic Quality Assessment for Vegetation in Illinois a Method for Assessing Vegetation Integrity. 1997. ❖ Tekiela, Stan, Wildflowers of Ohio. Adventure Publications Inc. Cambridge, Minnesota, 2001. ❖ Tiner, Ralph W. Defining Hydrophytes for Wetland Identification and Delineation ERDC/CRREL CR-12-1. January 2012. ❖ U.S. Army Corps of Engineers. 2012. Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Midwest Region (Version 2.0), ed. J.S. Wakeley, R.W. Page 306 143rd Street Extension, Plainfield, Will Co., IL 14 Lichvar, and C.V. Noble. ERDC/EL TR-12-1. Vicksburg, MS: U.S. Army Engineer Research and Development Center. ❖ United States Department of Agriculture (USDA), NRCS 1999. The PLANTS database (http://plants.usda.gov/plants). National Plant Data Center, Baton Rouge, LA 70874- 4490 USA. ❖ United States Department of Agriculture (USDA) Midwestern wetland flora: Field office guide to plant species. USDA Soil Conservation Service, Midwest National Technical Center, Lincoln, Nebraska. Jamestown, ND: Northern Prairie Wildlife Research Center Home Page. http://www.npwrc.usgs.gov/resource/othrdata/plntguid/plntguid.htm (Version 16JUL97). ❖ Wilhelm, G. and L. Rerich. 2017. Flora of the Chicago Region. A Floristic and Ecological Synthesis. Indiana Academy of Science, Indianapolis. 1392 pp. Page 307 143rd Street Extension APPENDIX A: PROJECT MAPPING AND PLANS Page 308 143rd Street Extension - Plainfield, Will Co., IL Location Map - Will County, IL 0 2.5 5 Miles Service Layer Credits: Sources: Esri, HERE, Garmin, USGS, Intermap, INCREMENT P, NRCan, Esri Japan, METI, Esri China (Hong Kong), Esri Korea, Esri (Thailand), NGCC, © OpenStreetMap contributors, and the GIS User Community Project Location Page 309 Copyright:© 2013 National Geographic Society, i-cubed143rd Street Extension - Plainfield, Will Co., IL USGS Topographic Map 0 750 1,500375 Feet ESR Limit Page 310 143rd Street Extension - Plainfield, Will Co., ILAERIAL MAP 0 500 1,000250 Feet Addendum D ESR Limits (Final 2018) Addendum D ESR Limits (Proposed 2016)N Division StreetNaperville RoadState Route 12630 30 Du P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Fletcher Lake Page 311 Wetland ADuPage River**W1* *****Site 1* Site 2*W2* W3* RD1* RD2* RP1* Pond 1* 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES MAP (1 of 2) 0 200 400100 Feet Service Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Addendum D ESR Limits (Final 2018) Addendum D ESR Limits (Proposed 2016) Wetlands (CMT 2019) Wetland Data Point (CMT 2019) Upland Data Point (CMT 2019) Stream OHWM (CMT 2019) H&H Waters (2016) Ditch Mining Pond Pond Retention pond Stream Wetland Gully * as defined in the H&H 2016 report Page 312 DuPage RiverWetland B Wetland C Wetland D Wetland E Lake Plainfield Fletcher Lake Main Lake Mining Pond 1* Mining Pond 2* Mining Pond 4* Mining Pond 3* Site 3* RP2* 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES MAP (2 of 2) 0 200 400100 Feet Service Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Addendum D ESR Limits (Final 2018) Addendum D ESR Limits (Proposed 2016) Wetlands (CMT 2019) Wetland Data Point (CMT 2019) Upland Data Point (CMT 2019) Stream OHWM (CMT 2019) H&H Waters (2016)* Ditch Mining Pond Pond Retention pond Stream Wetland * as defined in the H&H 2016 report Page 313 143rd Street ExtensionNATIONAL WETLAND INVENTORY MAP 0 400 800200 Feet Legend ESR Limits NWI Wetlands Freshwater Emergent Wetland Freshwater Forested/Shrub Wetland Freshwater Pond Lake Other Riverine N Division StreetNaperville RoadState Route 12630 30 Du P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Page 314 143rd Street Extension - Plainfield, Will Co., ILFEMA MAP 0 500 1,000250 Feet Addendum D ESR Limits (Final 2018) FEMA Flood Zone A AE AO X N Division StreetNaperville RoadState Route 12630 30 Du P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Fletcher Lake Main Lake Page 315 N Division StreetNaperville RoadState Route 126802B 541B 290B W 614A 290B W W 8321A 8321A 152A W 541B W 290A 8321A 523A W W 802B 356A 290B W W W W 223C2 290A 93C2 290A 197A 541C2 W 356A 223C2 318B 802D 356A W 290B 1103A W 197A W93C2 802D 197A 197A 318C2 318B 318C2969F356A 541C2 290BW 802D 290B 93C2 802D143rd Street Extension - Plainfield, Will Co., ILNRCS Soils Map 0 400 800200 Feet Addendum D ESR Limits (Final 2018) 30 30 Du P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Page 316 Map Unit Description (Brief, Generated) Will County, Illinois [Minor map unit components are excluded from this report] 152A - Drummer silty clay loam, 0 to 2 percent slopesMap unit: Component:Drummer, drained (94%) The Drummer, drained component makes up 94 percent of the map unit. Slopes are 0 to 2 percent. This component is on outwash plains on plains. The parent material consists of loess over stratified loamy outwash. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is poorly drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is high. Shrink-swell potential is moderate. This soil is not flooded. It is frequently ponded. A seasonal zone of water saturation is at 6 inches during January, February, March, April, May. Organic matter content in the surface horizon is about 6 percent. Nonirrigated land capability classification is 2w. This soil meets hydric criteria 223C2 - Varna silt loam, 4 to 6 percent slopes, erodedMap unit: Component:Varna, eroded (90%) The Varna, eroded component makes up 90 percent of the map unit. Slopes are 4 to 6 percent. This component is on ground moraines on till plains. The parent material consists of loess over silty clay loam or clay loam till. Depth to a root restrictive layer, densic material, is 24 to 55 inches. The natural drainage class is moderately well drained. Water movement in the most restrictive layer is moderately low. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 33 inches during February, March, April. Organic matter content in the surface horizon is about 3 percent. Nonirrigated land capability classification is 3e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 5 percent. 290A - Warsaw silt loam, 0 to 2 percent slopesMap unit: Component:Warsaw (90%) The Warsaw component makes up 90 percent of the map unit. Slopes are 0 to 2 percent. This component is on outwash plains. The parent material consists of Thin mantle of loess or other silty material and in the underlying loamy glaciofluvial deposits over sandy and gravelly glaciofluvial deposits. Depth to a root restrictive layer, strongly contrasting textural stratification, is 24 to 40 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. There is no zone of water saturation within a depth of 72 inches. Organic matter content in the surface horizon is about 3 percent. Nonirrigated land capability classification is 2s. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 20 percent. Page 1 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 317 Map Unit Description (Brief, Generated) Will County, Illinois 290B - Warsaw silt loam, 2 to 4 percent slopesMap unit: Component:Warsaw (92%) The Warsaw component makes up 92 percent of the map unit. Slopes are 2 to 4 percent. This component is on outwash plains. The parent material consists of Thin mantle of loess or other silty material and in the underlying loamy glaciofluvial deposits over sandy and gravelly glaciofluvial deposits. Depth to a root restrictive layer, strongly contrasting textural stratification, is 24 to 40 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. There is no zone of water saturation within a depth of 72 inches. Organic matter content in the surface horizon is about 3 percent. Nonirrigated land capability classification is 2e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 20 percent. 318C2 - Lorenzo loam, 4 to 6 percent slopes, erodedMap unit: Component:Lorenzo, eroded (92%) The Lorenzo, eroded component makes up 92 percent of the map unit. Slopes are 4 to 6 percent. This component is on stream terraces. The parent material consists of loamy outwash over calcareous sand and gravel. Depth to a root restrictive layer, strongly contrasting textural stratification, is 12 to 24 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is low. Shrink-swell potential is low. This soil is not flooded. It is not ponded. There is no zone of water saturation within a depth of 72 inches. Organic matter content in the surface horizon is about 3 percent. Nonirrigated land capability classification is 3e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 28 percent. 356A - Elpaso silty clay loam, 0 to 2 percent slopesMap unit: Component:Elpaso, drained (94%) The Elpaso, drained component makes up 94 percent of the map unit. Slopes are 0 to 2 percent. This component is on till plains on uplands. The parent material consists of loess over till. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is poorly drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is high. Shrink-swell potential is moderate. This soil is not flooded. It is frequently ponded. A seasonal zone of water saturation is at 6 inches during January, February, March, April, May. Organic matter content in the surface horizon is about 6 percent. Nonirrigated land capability classification is 2w. This soil meets hydric criteria. Page 2 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 318 Map Unit Description (Brief, Generated) Will County, Illinois 523A - Dunham silty clay loam, 0 to 2 percent slopesMap unit: Component:Dunham (92%) The Dunham component makes up 92 percent of the map unit. Slopes are 0 to 2 percent. This component is on outwash plains. The parent material consists of Loess or other silty material and in the underlying loamy and gravelly outwash. Depth to a root restrictive layer, strongly contrasting textural stratification, is 40 to 55 inches. The natural drainage class is poorly drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is moderate. This soil is not flooded. It is frequently ponded. A seasonal zone of water saturation is at 6 inches during January, February, March, April, May. Organic matter content in the surface horizon is about 5 percent. Nonirrigated land capability classification is 2w. This soil meets hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 10 percent. 541B - Graymont silt loam, 2 to 5 percent slopesMap unit: Component:Graymont (94%) The Graymont component makes up 94 percent of the map unit. Slopes are 2 to 5 percent. This component is on till plains on till plains. The parent material consists of loess over till. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is moderately well drained. Water movement in the most restrictive layer is moderately low. Available water to a depth of 60 inches (or restricted depth) is high. Shrink-swell potential is moderate. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 33 inches during February, March, April. Organic matter content in the surface horizon is about 4 percent. Nonirrigated land capability classification is 2e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 18 percent. 541C2 - Graymont silt loam, 5 to 10 percent slopes, erodedMap unit: Component:Graymont, eroded (97%) The Graymont, eroded component makes up 97 percent of the map unit. Slopes are 5 to 10 percent. This component is on till plains on uplands. The parent material consists of loess over till. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is moderately well drained. Water movement in the most restrictive layer is moderately low. Available water to a depth of 60 inches (or restricted depth) is high. Shrink-swell potential is moderate. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 30 inches during February, March, April. Organic matter content in the surface horizon is about 3 percent. Nonirrigated land capability classification is 3e. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 18 percent. Page 3 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 319 Map Unit Description (Brief, Generated) Will County, Illinois 614A - Chenoa silty clay loam, 0 to 2 percent slopesMap unit: Component:Chenoa (94%) The Chenoa component makes up 94 percent of the map unit. Slopes are 0 to 2 percent. This component is on ground moraines on till plains. The parent material consists of loess over till. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is somewhat poorly drained. Water movement in the most restrictive layer is moderately low. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is low. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 18 inches during January, February, March, April, May. Organic matter content in the surface horizon is about 4 percent. Nonirrigated land capability classification is 2w. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 25 percent. 802B - Orthents, loamy, undulatingMap unit: Component:Orthents, loamy, undulating (90%) The Orthents, loamy, undulating component makes up 90 percent of the map unit. Slopes are 1 to 6 percent. This component is on leveled land on outwash plains. The parent material consists of Earthy fill. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is moderate. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 51 inches during February, March, April. Organic matter content in the surface horizon is about 1 percent. Nonirrigated land capability classification is 3e. This soil does not meet hydric criteria. 802D - Orthents, loamy, rollingMap unit: Component:Orthents, loamy, rolling (92%) The Orthents, loamy, rolling component makes up 92 percent of the map unit. Slopes are 6 to 12 percent. This component is on outwash plains. The parent material consists of earthy fill. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is moderate. Shrink-swell potential is moderate. This soil is not flooded. It is not ponded. A seasonal zone of water saturation is at 51 inches during February, March, April. Organic matter content in the surface horizon is about 1 percent. Nonirrigated land capability classification is 4e. This soil does not meet hydric criteria. 8321A - Du Page silt loam, 0 to 2 slopes, occasionally floodedMap unit: Component:Du Page (90%) The Du Page component makes up 90 percent of the map unit. Slopes are 0 to 2 percent. This component is on flood plains. The parent material consists of Calcareous alluvium. Depth to a root restrictive layer is greater than 60 inches. The natural drainage class is well drained. Water movement in the most restrictive layer is moderately high. Available water to a depth of 60 inches (or restricted depth) is high. Shrink-swell potential is low. This soil is occasionally flooded. It is not ponded. A seasonal zone of water saturation is at 57 inches during February, March, April. Organic matter content in the surface horizon is about 4 percent. Nonirrigated land capability classification is 2w. This soil does not meet hydric criteria. The calcium carbonate equivalent within 40 inches, typically, does not exceed 23 percent. Page 4 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 320 Map Unit Description (Brief, Generated) Will County, Illinois W - WaterMap unit: Component:Water (100%) Generated brief soil descriptions are created for major soil components. The Water is a miscellaneous area. Page 5 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 321 Hydric Soils Will County, Illinois Percent of map unit [This report lists only those map unit components that are rated as hydric. Dashes (---) in any column indicate that the data were not included in the database. Definitions of hydric criteria codes are included at the end of the report] Landform Hydric rating Hydric criteriaComponentMap symbol and map unit name 152A: Drummer silty clay loam, 0 to 2 percent slopes Drummer, drained 94 Outwash plains Yes 2 Harpster, drained 3 Depressions Yes 2 Peotone, drained 3 Depressions Yes 2 223C2: Varna silt loam, 4 to 6 percent slopes, eroded Ashkum, drained 6 Ground moraines Yes 2 290A: Warsaw silt loam, 0 to 2 percent slopes Will --- Outwash plains Yes 2 356A: Elpaso silty clay loam, 0 to 2 percent slopes Elpaso, drained 94 Till plains Yes 2 Harpster, drained 4 Depressions Yes 2 Peotone, drained 2 Depressions Yes 2 523A: Dunham silty clay loam, 0 to 2 percent slopes Dunham 92 Outwash plains Yes 2 Houghton 2 Ground moraines Yes 1 Millsdale 2 Swales Yes 2 541B: Graymont silt loam, 2 to 5 percent slopes Ashkum, drained 5 Ground moraines Yes 2 541C2: Graymont silt loam, 5 to 10 percent slopes, eroded Elpaso, drained 3 Till plains Yes 2 614A: Chenoa silty clay loam, 0 to 2 percent slopes Ashkum, drained 3 Swales Yes 2 Elpaso, drained 3 Swales Yes 2 802B: Orthents, loamy, undulating Drummer 1 Outwash plains Yes 2 Pella 1 Outwash plains Yes 2 8321A: Du Page silt loam, 0 to 2 slopes, occasionally flooded Millington --- Flood plains Yes 2 Page 1 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 322 Hydric Soils This table lists the map unit components that are rated as hydric soils in the survey area. This list can help in planning land uses; however, onsite investigation is recommended to determine the hydric soils on a specific site (National Research Council, 1995; Hurt and others, 2002). The three essential characteristics of wetlands are hydrophytic vegetation, hydric soils, and wetland hydrology (Cowardin and others, 1979; U.S. Army Corps of Engineers, 1987; National Research Council, 1995; Tiner, 1985). Criteria for all of the characteristics must be met for areas to be identified as wetlands. Undrained hydric soils that have natural vegetation should support a dominant population of ecological wetland plant species. Hydric soils that have been converted to other uses should be capable of being restored to wetlands. Hydric soils are defined by the National Technical Committee for Hydric Soils (NTCHS) as soils that formed under conditions of saturation, flooding, or ponding long enough during the growing season to develop anaerobic conditions in the upper part (Federal Register, 1994). These soils, under natural conditions, are either saturated or inundated long enough during the growing season to support the growth and reproduction of hydrophytic vegetation. The NTCHS definition identifies general soil properties that are associated with wetness. In order to determine whether a specific soil is a hydric soil or nonhydric soil, however, more specific information, such as information about the depth and duration of the water table, is needed. Thus, criteria that identify those estimated soil properties unique to hydric soils have been established (Federal Register, 2002). These criteria are used to identify map unit components that normally are associated with wetlands. The criteria used are selected estimated soil properties that are described in "Soil Taxonomy" (Soil Survey Staff, 1999) and "Keys to Soil Taxonomy" (Soil Survey Staff, 2003) and in the "Soil Survey Manual" (Soil Survey Division Staff, 1993). If soils are wet enough for a long enough period of time to be considered hydric, they should exhibit certain properties that can be easily observed in the field. These visible properties are indicators of hydric soils. The indicators used to make onsite determinations of hydric soils are specified in "Field Indicators of Hydric Soils in the United States" (Hurt and others, 2002). Hydric soils are identified by examining and describing the soil to a depth of about 20 inches. This depth may be greater if determination of an appropriate indicator so requires. It is always recommended that soils be excavated and described to the depth necessary for an understanding of the redoximorphic processes. Then, using the completed soil descriptions, soil scientists can compare the soil features required by each indicator and specify which indicators have been matched with the conditions observed in the soil. The soil can be identified as a hydric soil if at least one of the approved indicators is present. Map units that are dominantly made up of hydric soils may have small areas, or inclusions, of nonhydric soils in the higher positions on the landform, and map units dominantly made up of nonhydric soils may have inclusions of hydric soils in the lower positions on the landform. The criteria for hydric soils are represented by codes in the table (for example, 2B3). Definitions for the codes are as follows: 1. All Histels except for Folistels, and Histosols except for Folists. 2.Soils in Aquic suborders, great groups, or subgroups, Albolls suborder, Historthels great group, Histoturbels great group, Pachic subgroups, or Cumulic subgroups that: A. are somewhat poorly drained and have a water table at the surface (0.0 feet) during the growing season, or B. are poorly drained or very poorly drained and have either: 1) a water table at the surface (0.0 feet) during the growing season if textures are coarse sand, sand, or fine sand in all layers within a depth of 20 inches, or 2) a water table at a depth of 0.5 foot or less during the growing season if permeability is equal to or greater than 6.0 in/hr in all layers within a depth of 20 inches, or 3) a water table at a depth of 1.0 foot or less during the growing season if permeability is less than 6.0 in/hr in any layer within a depth of 20 inches. 3. Soils that are frequently ponded for long or very long duration during the growing season. 4. Soils that are frequently flooded for long or very long duration during the growing season. References: Cowardin, L.M., V. Carter, F.C. Golet, and E.T. LaRoe. 1979. Classification of wetlands and deep-water habitats of the United States. U.S. Fish and Wildlife Service FWS/OBS-79/31. Federal Register. September 18, 2002. Hydric soils of the United States. Federal Register. July 13, 1994. Changes in hydric soils of the United States. Hurt, G.W., P.M. Whited, and R.F. Pringle, editors. Version 5.0, 2002. Field indicators of hydric soils in the United States. National Research Council. 1995. Wetlands: Characteristics and boundaries. Soil Survey Division Staff. 1993. Soil survey manual. Soil Conservation Service. U.S. Department of Agriculture Handbook 18. Soil Survey Staff. 2003. Keys to soil taxonomy. 9th edition. U.S. Department of Agriculture, Natural Resources Conservation Service. Soil Survey Staff. 1999. Soil taxonomy: A basic system of soil classification for making and interpreting soil surveys. 2nd edition. Natural Resources Conservation Service. U.S. Department of Agriculture Handbook 436. Tiner, R.W., Jr. 1985. Wetlands of Delaware. U.S. Fish and Wildlife Service and Delaware Department of Natural Resources and Environmental Control, Wetlands Section. United States Army Corps of Engineers, Environmental Laboratory. 1987. Corps of Engineers wetlands delineation manual. Waterways Experiment Station Technical Report Y-87-1. Page 2 Survey Area Version: 14 Survey Area Version Date: 09/16/2019 Page 323 143rd Street Extension APPENDIX B: DATA FORMS Page 324 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil X , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7.X 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X =Total Cover (Plot size: 30' ) =Total Cover No 30 Iris pseudacorus Cyperus esculentus 5 82 Hydrophytic Vegetation Present?No Percent of Dominant Species That Are OBL, FACW, or FAC: No 0 Prevalence Index worksheet: 4 4 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species UPL species (Plot size:Tree Stratum 30' Absolute % Cover Total % Cover of: 15' ) NWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL A1Sampling Point: -88.196094 NAD 83 Convex Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 0-2 Long:41.623641 Datum: Remarks: DuPage silt loam (8321A)None Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover Yes 42 Indicator Status Dominant Species? (Plot size: OBL 5 OBL Phalaris arundinacea 5Lysimachia nummularia FACW Salix nigra 2 ) FAC FAC FACW Yes Juncus tenuis 40 No 15 Herb Stratum 5' Yes 10 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species Hydrophytic Vegetation Indicators: 0 221 0 97 No Floodplain 2 - Dominance Test is >50% Yes 126 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 0 2.28Prevalence Index = B/A = 15 Multiply by: 80 (Plot size: Acer saccharinum 15 FACW 40 WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? US Army Corps of Engineers Midwest Region – Version 2.0Page 325 Sampling Point: %%Type1 Loc2 100 100 100 95 5 C M X Type: Depth (inches):Hydric Soil Present? Yes X No Primary Indicators (minimum of one is required; check all that apply) X X X X XX X XX X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: A1SOIL 9 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) 9 5 cm Mucky Peat or Peat (S3) This wetland is located along a constructed pond within a floodplain and has soils with high-chroma subsoils. This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx). Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, Organic Clayey sand with silt (organic) Distinct redox concentrations 0-0.5 Sandy 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) 3Indicators of hydrophytic vegetation and Matrix 6-9 7.5YR 5/6 Texture Remarks 0.5-2 Color (moist) Sandy5YR 5/8 Histosol (A1) Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 2-6 10YR 2/1 Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 7.5YR 5/6 10YR 2/1 Sandy Sandy US Army Corps of Engineers Midwest Region – Version 2.0Page 326 Floristic Quality Assessement Plainfield 143rd Street Extension, Plainfield, Will Co., IL Resource: Wetland A Field Assessment:6/27/2019 Practitioner:Alex Zelles, CMT Weather Notes:Sunny; 89F FQA DB Region: Chicago Region USACE Latitude:41.623641 Duration Notes: FQA Publication:2017 Longitude:-88.196094 Community Type:Emergent; abutting pond FQA DB Description: Conservatism-Based Metrics: Total Mean C:0.9 % C value 1-3:14.3 Native Mean C:1.5 % C value 4-6:14.3 Total FQI:2.4 % C value 7-10:0 Native FQI:3 Native Tree Mean C:3 Adjusted FQI:11.3 Native Shrub Mean C:n/a % C value 0:71.4 Native Herbaceous Mean C:0 Species Richness:Species Wetness: Total Species:7 Mean Wetness:-1.1 Native Species:4 57.10%Native Mean Wetness:-1 Non-native Species:3 42.90% Physiognomy Metrics:Duration Metrics: Tree:2 28.60%Annual:0 0% Shrub:0 0%Perennial:7 100% Vine:0 0%Biennial:0 0% Forb:3 42.90%Native Annual:0 0% Grass:1 14.30%Native Perennial:4 57.10% Sedge:1 14.30%Native Biennial:0 0% Rush:0 0% Fern:0 0% Bryophyte:0 0% Species: Scientific Name Family Acronym Native?C W Physiognomy Duration Common Name Acer saccharinum Aceraceae ACESAI native 1 -1 tree perennial silver maple Cyperus esculentus Cyperaceae CYPESC native 0 -1 sedge perennial chufa Iris pseudacorus Iridaceae IRIPSE non-native 0 -2 forb perennial pale-yellow iris Juncus tenuis Juncaceae JUNTEN native 0 0 forb perennial lesser poverty rush Lysimachia nummularia Primulaceae LYSNUM non-native 0 -1 forb perennial creeping-jenny Phalaris arundinacea Poaceae PHAARU non-native 0 -1 grass perennial reed canary grass Salix nigra Salicaceae SALNIG native 5 -2 tree perennial black willow https://www.lrc.usace.army.mil/Missions/Regulatory/FQA.aspx Page 327 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7. 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland A Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Floodplain 2 - Dominance Test is >50% No 270 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 0 2.95Prevalence Index = B/A = 0 Multiply by: 10 (Plot size: 0 5 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species Hydrophytic Vegetation Indicators: 0 280 0 95FAC FACW Poa pratensis 90 Herb Stratum (Plot size: Lysimachia nummularia ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover Yes 90 Indicator Status Dominant Species? City/County: Plainfield, Will Co.Sampling Date: 6/27/2019 Plainfield IL A2Sampling Point: -88.195985 NAD 83 Convex Alex Zelles & Ellen Hogrebe (CMT)S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 0-2 Long:41.623638 Datum: Remarks: DuPage silt loam (8321A)NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species (Plot size:Tree Stratum Absolute % Cover Total % Cover of: ) 95 Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 0 Prevalence Index worksheet: 1 1 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species =Total Cover (Plot size: ) =Total Cover 5 US Army Corps of Engineers Midwest Region – Version 2.0Page 328 Sampling Point: %%Type1 Loc2 100 75 25 C M X Type: Depth (inches):Hydric Soil Present? Yes X No Primary Indicators (minimum of one is required; check all that apply) X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes No X Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 4/2 10YR 3/1 Sandy Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture Remarks 6-12 Color (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, 10YR 5/6 Clayey sand Prominent redox concentrations 0-6 Sandy 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: A2SOIL 12 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 329 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7.X 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X FAC =Total Cover (Plot size: 30 ) =Total Cover Toxicodendron radicans Hydrophytic Vegetation Present?No Percent of Dominant Species That Are OBL, FACW, or FAC: No 0 Prevalence Index worksheet: 1 1 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species UPL species Yes FACW (Plot size: No 80 Tree Stratum No 30 5 Absolute % Cover FAC Total % Cover of: 15 ) NWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL B1Sampling Point: -88.191580 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624972 Datum: Remarks: Warsaw silt loam (290B)None Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover 86 Indicator Status Dominant Species? (Plot size: FAC 2 Morus alba ) No 4 Herb Stratum 5 No 2No 2 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 2 Hydrophytic Vegetation Indicators: 0 278 0 96 Depression 2 - Dominance Test is >50% 258 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 0 2.90Prevalence Index = B/A = 0 Multiply by: 20 (Plot size: Rhamnus cathartica 90 0 FAC 10 WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland B Ulmus americana Fraxinus pennsylvanica FACW Total Number of Dominant Species Across All Strata: Dominance Test worksheet: 5 No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Populus deltoides Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? US Army Corps of Engineers Midwest Region – Version 2.0Page 330 Sampling Point: %%Type1 Loc2 100 X Type: Depth (inches):Hydric Soil Present?Yes X No Primary Indicators (minimum of one is required; check all that apply) XX X X X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: B1SOIL Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) 3 0 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, 0-18 Muck 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) 3Indicators of hydrophytic vegetation and Matrix Texture RemarksColor (moist) Histosol (A1) Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 5YR 2.5/1 US Army Corps of Engineers Midwest Region – Version 2.0Page 331 Floristic Quality Assessement Plainfield 143rd Street Extension, Plainfield, Will Co., IL Resource: Wetland B Field Assessment:6/27/2019 Practitioner:Alex Zelles, CMT Weather Notes:Sunny; 89F FQA DB Region: Chicago Region USACE Latitude:41.624972 Duration Notes: FQA Publication:2017 Longitude:-88.19158 Community Type:Vernal pool; forested FQA DB Description: Conservatism-Based Metrics: Total Mean C:1.4 % C value 1-3:20 Native Mean C:2.3 % C value 4-6:20 Total FQI:3.1 % C value 7-10:0 Native FQI:4 Native Tree Mean C:2.3 Adjusted FQI:17.8 Native Shrub Mean C:n/a % C value 0:60 Native Herbaceous Mean C:n/a Species Richness:Species Wetness: Total Species:5 Mean Wetness:-0.4 Native Species:3 60%Native Mean Wetness:-0.7 Non-native Species:2 40% Physiognomy Metrics:Duration Metrics: Tree:4 80%Annual:0 0% Shrub:1 20%Perennial:5 100% Vine:0 0%Biennial:0 0% Forb:0 0%Native Annual:0 0% Grass:0 0%Native Perennial:3 60% Sedge:0 0%Native Biennial:0 0% Rush:0 0% Fern:0 0% Bryophyte:0 0% Species: Scientific Name Family Acronym Native?C W Physiognomy Duration Common Name Fraxinus pennsylvanica Oleaceae FRAPEN native 4 -1 tree perennial green ash Morus alba Moraceae MORALB non-native 0 0 tree perennial white mulberry Populus deltoides Salicaceae POPDEL native 0 0 tree perennial eastern cottonwood Rhamnus cathartica Rhamnaceae RHACAT non-native 0 0 shrub perennial european buckthorn Ulmus americana Ulmaceae ULMAME native 3 -1 tree perennial american elm https://www.lrc.usace.army.mil/Missions/Regulatory/FQA.aspx Page 332 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7. 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland B Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Populus deltoides Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Depression 2 - Dominance Test is >50% 330 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 20 3.13Prevalence Index = B/A = 0 Multiply by: 0 (Plot size: Lonicera maackii 85 0 UPL 0 5 Yes 20 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 5 Hydrophytic Vegetation Indicators: 25 375 5 120FAC Yes Alliaria petiolata 5 25 Herb Stratum 5 Yes (Plot size: FAC 5 Rhamnus cathartica ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover Yes 110 Indicator Status Dominant Species? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL B2Sampling Point: -88.191480 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624904 Datum: Remarks: Warsaw silt loam (290B)NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species Yes (Plot size: 85 Tree Stratum 30 Absolute % Cover FAC Total % Cover of: 15 ) 5 Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 5 Prevalence Index worksheet: 3 5 60.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species FACU =Total Cover (Plot size: 30 ) =Total Cover Parthenocissus quinquefolia US Army Corps of Engineers Midwest Region – Version 2.0Page 333 Sampling Point: %%Type1 Loc2 100 100 100 Type: Depth (inches):Hydric Soil Present? Yes No X Primary Indicators (minimum of one is required; check all that apply) X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No 8-12 10YR 5/6 Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 3/3 10YR 2/2 Sandy Sandy Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3)Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture Remarks 5-8 Color (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, sandy silt sandy silt with gravel sandy silt with gravel 0-5 Sandy 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: B2SOIL Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) 8 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 334 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology X Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7.X 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland C Fraxinus pennsylvanica Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Ulmus americana Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Depression 2 - Dominance Test is >50% 105 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 0 2.29Prevalence Index = B/A = 0 Multiply by: 174 (Plot size: Fraxinus pennsylvanica 85 0 FACW 87 35 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species Hydrophytic Vegetation Indicators: 0 279 0 122 Yes 37 Herb Stratum 5 No (Plot size: FAC 2 Rhamnus cathartica ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover 35 Indicator Status Dominant Species? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL C1Sampling Point: -88.191603 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624035 Datum: Remarks: Orthents, loamy, undulating (802B) NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species Yes FACW (Plot size: 80 Tree Stratum No 30 5 Absolute % Cover FACW Total % Cover of: 15 ) Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 0 Prevalence Index worksheet: 2 2 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species =Total Cover (Plot size: 30 ) =Total Cover US Army Corps of Engineers Midwest Region – Version 2.0Page 335 Sampling Point: %%Type1 Loc2 100 X Type: Depth (inches):Hydric Soil Present? Yes X No Primary Indicators (minimum of one is required; check all that apply) X X X X X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 2/1 Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture RemarksColor (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, silt with sand and gravel0-6 Sandy 3 0 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: C1SOIL 6 Restrictive Layer (if observed): Remarks: This wetland may be located within a historic borrow site Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 336 Floristic Quality Assessement Plainfield 143rd Street Extension, Plainfield, Will Co., IL Resource: Wetland C Field Assessment:6/27/2019 Practitioner:Alex Zelles, CMT Weather Notes:Sunny; 89F FQA DB Region: Chicago Region USACE Latitude:41.624035 Duration Notes: FQA Publication:2017 Longitude:-88.191603 Community Type:Vernal pool; forested FQA DB Description: Conservatism-Based Metrics: Total Mean C:2.3 % C value 1-3:33.3 Native Mean C:3.5 % C value 4-6:33.3 Total FQI:4 % C value 7-10:0 Native FQI:4.9 Native Tree Mean C:3.5 Adjusted FQI:28.6 Native Shrub Mean C:n/a % C value 0:33.3 Native Herbaceous Mean C:n/a Species Richness:Species Wetness: Total Species:3 Mean Wetness:-0.7 Native Species:2 66.70%Native Mean Wetness:-1 Non-native Species:1 33.30% Physiognomy Metrics:Duration Metrics: Tree:2 66.70%Annual:0 0% Shrub:1 33.30%Perennial:3 100% Vine:0 0%Biennial:0 0% Forb:0 0%Native Annual:0 0% Grass:0 0%Native Perennial:2 66.70% Sedge:0 0%Native Biennial:0 0% Rush:0 0% Fern:0 0% Bryophyte:0 0% Species: Scientific Name Family Acronym Native?C W Physiognomy Duration Common Name Fraxinus pennsylvanica Oleaceae FRAPEN native 4 -1 tree perennial green ash Rhamnus cathartica Rhamnaceae RHACAT non-native 0 0 shrub perennial european buckthorn Ulmus americana Ulmaceae ULMAME native 3 -1 tree perennial american elm https://www.lrc.usace.army.mil/Missions/Regulatory/FQA.aspx Page 337 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7. 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland C Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Ulmus americana Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Depression 2 - Dominance Test is >50% 126 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 8 2.51Prevalence Index = B/A = 0 Multiply by: 140 (Plot size: Lonicera maackii 70 0 UPL 70 2No 40 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 2 Hydrophytic Vegetation Indicators: 25 299 5 119FAC Yes Alliaria petiolata 2 45 Herb Stratum 5 No (Plot size: FAC 5 Rhamnus cathartica ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover No 42 Indicator Status Dominant Species? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL C2Sampling Point: -88.191542 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624065 Datum: Remarks: Orthents, loamy, undulating (802B) NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species Yes (Plot size: 70 Tree Stratum 30 Absolute % Cover FACW Total % Cover of: 15 ) 2 Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 2 Prevalence Index worksheet: 2 2 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species FACU =Total Cover (Plot size: 30 ) =Total Cover Parthenocissus quinquefolia US Army Corps of Engineers Midwest Region – Version 2.0Page 338 Sampling Point: %%Type1 Loc2 100 Type: Depth (inches):Hydric Soil Present? Yes No X Primary Indicators (minimum of one is required; check all that apply) X ? Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes No X Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 4/4 Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture RemarksColor (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, Gravel sand/silt with clay0-8 Sandy 5 cm Mucky Peat or Peat (S3) Several attempts were made. This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: C2SOIL 8 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 339 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7.X 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland D Acer saccharinum Ulmus americana Salix nigra FACW Total Number of Dominant Species Across All Strata: Dominance Test worksheet: 10 No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Populus deltoides Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Depression 5 2 - Dominance Test is >50% 135 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 20 2.76Prevalence Index = B/A = 5 Multiply by: 50 (Plot size: Lonicera maackii 65 5 UPL 25 5 Yes 5 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 5 Hydrophytic Vegetation Indicators: 25 235 5 85 Acer saccharinum FACW Yes 15 Herb Stratum 5' Yes (Plot size: FAC 5 Yes Rhamnus cathartica ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover 45 Indicator Status Dominant Species? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL D1Sampling Point: -88.183232 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624803 Datum: Remarks: Orthents, loamy, undulating (802B) NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species Yes FACW (Plot size: No 40 Tree Stratum No OBL No 5 30' 10 Absolute % Cover FAC Total % Cover of: 15' ) Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 5 Prevalence Index worksheet: 3 5 60.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species FACU =Total Cover (Plot size: 30' ) =Total Cover Parthenocissus quinquefolia US Army Corps of Engineers Midwest Region – Version 2.0Page 340 Sampling Point: %%Type1 Loc2 100 X Type: Depth (inches):Hydric Soil Present? Yes X No Primary Indicators (minimum of one is required; check all that apply) X X X X X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 2/1 Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture RemarksColor (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, Sandy silt with organic0-7 Sandy 12 0 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: D1SOIL Restrictive Layer (if observed): Remarks: Adjacent to Bass and Gill Club mining pond Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 341 Floristic Quality Assessement Plainfield 143rd Street Extension, Plainfield, Will Co., IL Resource: Wetland D Field Assessment:6/27/2019 Practitioner:Alex Zelles, CMT Weather Notes:Sunny; 89F FQA DB Region: Chicago Region USACE Latitude:41.624803 Duration Notes: FQA Publication:2017 Longitude:-88.183232 Community Type:Forested FQA DB Description: Conservatism-Based Metrics: Total Mean C:1.5 % C value 1-3:33.3 Native Mean C:2.3 % C value 4-6:16.7 Total FQI:3.7 % C value 7-10:0 Native FQI:4.6 Native Tree Mean C:2.3 Adjusted FQI:18.8 Native Shrub Mean C:n/a % C value 0:50 Native Herbaceous Mean C:n/a Species Richness:Species Wetness: Total Species:6 Mean Wetness:-0.3 Native Species:4 66.70%Native Mean Wetness:-1 Non-native Species:2 33.30% Physiognomy Metrics:Duration Metrics: Tree:4 66.70%Annual:0 0% Shrub:2 33.30%Perennial:6 100% Vine:0 0%Biennial:0 0% Forb:0 0%Native Annual:0 0% Grass:0 0%Native Perennial:4 66.70% Sedge:0 0%Native Biennial:0 0% Rush:0 0% Fern:0 0% Bryophyte:0 0% Species: Scientific Name Family Acronym Native?C W Physiognomy Duration Common Name Acer saccharinum Aceraceae ACESAI native 1 -1 tree perennial silver maple Lonicera maackii Caprifoliaceae LONMAA non-native 0 2 shrub perennial amur honeysuckle Populus deltoides Salicaceae POPDEL native 0 0 tree perennial eastern cottonwood Rhamnus cathartica Rhamnaceae RHACAT non-native 0 0 shrub perennial european buckthorn Salix nigra Salicaceae SALNIG native 5 -2 tree perennial black willow Ulmus americana Ulmaceae ULMAME native 3 -1 tree perennial american elm https://www.lrc.usace.army.mil/Missions/Regulatory/FQA.aspx Page 342 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7. 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland D Acer saccharinum Ulmus americana FACW Total Number of Dominant Species Across All Strata: Dominance Test worksheet: 10 No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Populus deltoides Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Depression 5 2 - Dominance Test is >50% 225 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 60 3.20Prevalence Index = B/A = 0 Multiply by: 40 (Plot size: Lonicera maackii 60 0 UPL 20 15 Yes 20 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 25 Yes Hydrophytic Vegetation Indicators: 75 400 15 125 Juniperus virginiana FACU Yes 40 Herb Stratum 5' Yes (Plot size: FAC 15 No Rhamnus cathartica ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover 75 Indicator Status Dominant Species? City/County: Plainfield, Will Co. Sampling Date: 6/27/2019 Plainfield IL D2Sampling Point: -88.183222 NAD 83 Concave Alex Zelles & Ellen Hogrebe (CMT) S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624757 Datum: Remarks: Orthents, loamy, undulating (802B) NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species Yes FACW (Plot size: No 40 Tree Stratum No 30' 10 Absolute % Cover FAC Total % Cover of: 15' ) Hydrophytic Vegetation Present?No Percent of Dominant Species That Are OBL, FACW, or FAC: No 15 Prevalence Index worksheet: 3 5 60.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species FAC =Total Cover (Plot size: 30' ) =Total Cover 10Parthenocissus quinquefolia FACU Toxicodendron radicans US Army Corps of Engineers Midwest Region – Version 2.0Page 343 Sampling Point: %%Type1 Loc2 100 100 Type: Depth (inches):Hydric Soil Present? Yes No X Primary Indicators (minimum of one is required; check all that apply) ? Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes No X Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 7.5YR 3/2 7.5YR 2.5/1 Loamy/Clayey Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3)Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture Remarks 5-12 Color (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, silty loam with organics loam with gravel 0-5 Loamy/Clayey 5 cm Mucky Peat or Peat (S3) This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: D2SOIL 12 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 344 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil X , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7.X 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland E Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? Lake edge 2 - Dominance Test is >50%No No 72 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 0 2.18Prevalence Index = B/A = 5 Multiply by: 148 (Plot size: 5 74 5 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species No 2 No 5 Hydrophytic Vegetation Indicators: 0 225 0 103 Poa palustris No OBL FACW FAC Yes Phragmites australis 55 No 5 Herb Stratum 5' Rumex crispus (Plot size: FACW FACW FACW Plantago rugelii 10Juncus tenuis FAC Prunella vulgaris FACWNo Fraxinus pennsylvanica FACW Carex vulpinoidea 2 5 ) Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover 2 No FAC FAC Yes 24 Indicator Status Dominant Species? 2 City/County: Plainfield, Will Co.Sampling Date: 7/2/2019 Plainfield IL E1Sampling Point: -88.181723 NAD 83 Concave Alex Zelles (CMT)S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624045 Datum: Remarks: Orthents, loamy, undulating (802B)NoneNWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? UPL species (Plot size:Tree Stratum 30' Absolute % Cover Total % Cover of: 15' ) 98 Hydrophytic Vegetation Present? No Percent of Dominant Species That Are OBL, FACW, or FAC: No 0 Prevalence Index worksheet: 2 2 100.0% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species =Total Cover (Plot size: 30' ) =Total Cover No 10 Impatiens capensis Schoenoplectus tabernaemontani 5 Bidens frondosa US Army Corps of Engineers Midwest Region – Version 2.0Page 345 Sampling Point: %%Type1 Loc2 97 3 C PL 50 50 C M X Type: Depth (inches):Hydric Soil Present? Yes X No Primary Indicators (minimum of one is required; check all that apply) X X X X X X Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes X No Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 10YR 3/4 10YR 4/2 Loamy/Clayey Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) 3Indicators of hydrophytic vegetation and Matrix Texture Remarks 10YR 5/8 3-9 Color (moist) Histosol (A1) 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, 10YR 5/8 Clayey silt with sand with sand and gravel 0-3 Loamy/Clayey 1 0 5 cm Mucky Peat or Peat (S3) This wetland is adjacent to a historic mining pond and has likely experienced disturbance. This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: E1SOIL 9 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: US Army Corps of Engineers Midwest Region – Version 2.0Page 346 Floristic Quality Assessement Plainfield 143rd Street Extension, Plainfield, Will Co., IL Resource: Wetland E Field Assessment:7/2/2019 Practitioner:Alex Zelles, CMT Weather Notes:Sunny; 92F FQA DB Region: Chicago Region USACE Latitude:41.624045 Duration Notes: FQA Publication:2017 Longitude:-88.181723 Community Type:Emergent; lake edge FQA DB Description: Conservatism-Based Metrics: Total Mean C:1.8 % C value 1-3:36.4 Native Mean C:2.5 % C value 4-6:9.1 Total FQI:6 % C value 7-10:9.1 Native FQI:7.1 Native Tree Mean C:4 Adjusted FQI:21.3 Native Shrub Mean C:n/a % C value 0:45.5 Native Herbaceous Mean C:2.3 Species Richness:Species Wetness: Total Species:11 Mean Wetness:-0.7 Native Species:8 72.70%Native Mean Wetness:-0.9 Non-native Species:3 27.30% Physiognomy Metrics:Duration Metrics: Tree:1 9.10%Annual:3 27.30% Shrub:0 0%Perennial:8 72.70% Vine:0 0%Biennial:0 0% Forb:6 54.50%Native Annual:3 27.30% Grass:2 18.20%Native Perennial:5 45.50% Sedge:2 18.20%Native Biennial:0 0% Rush:0 0% Fern:0 0% Bryophyte:0 0% Species: Scientific Name Family Acronym Native?C W Physiognomy Duration Common Name Bidens frondosa Asteraceae BIDFRO native 1 -1 forb annual devils-pitchfork Carex vulpinoidea Cyperaceae CXVULP native 2 -1 sedge perennial common fox sedge Fraxinus pennsylvanica Oleaceae FRAPEN native 4 -1 tree perennial green ash Impatiens capensis Balsaminaceae IMPCAP native 3 -1 forb annual spotted touch-me-not Juncus tenuis Juncaceae JUNTEN native 0 0 forb perennial lesser poverty rush Phragmites australis ssp. australis Poaceae PHRAUSU non-native 0 -1 grass perennial common reed Plantago rugelii Plantaginaceae PLARUG native 0 0 forb annual black-seed plantain Poa palustris Poaceae POAPAS native 7 -1 grass perennial fowl blue grass Prunella vulgaris ssp. vulgaris Lamiaceae PRUVULV non-native 0 0 forb perennial common selfheal Rumex crispus Polygonaceae RUMCRI non-native 0 0 forb perennial curly dock Schoenoplectus tabernaemontani Cyperaceae SCHTAB native 3 -2 sedge perennial soft-stem club-rush https://www.lrc.usace.army.mil/Missions/Regulatory/FQA.aspx Page 347 Project/Site: Applicant/Owner:State: Investigator(s): Landform (hillside, terrace, etc.): Slope (%): Lat: Soil Map Unit Name: X Are Vegetation , Soil X , or Hydrology Are “Normal Circumstances” present? Yes X No Are Vegetation , Soil , or Hydrology SUMMARY OF FINDINGS – Attach site map showing sampling point locations, transects, important features, etc. Yes X Yes X Yes X Yes X ) 1. 2.(A) 3. 4.(B) 5. (A/B) Sapling/Shrub Stratum 1. 2. 3.x 1 = 4.x 2 = 5.x 3 = x 4 = x 5 = 1.Column Totals:(A)(B) 2. 3. 4. 5. 6.X 7. 8.4 - Morphological Adaptations1 (Provide supporting 9. 10. Woody Vine Stratum 1. 2. Yes X FAC =Total Cover (Plot size: 30' ) =Total Cover 2 5Parthenocissus quinquefolia FACU Toxicodendron radicans 7 Hydrophytic Vegetation Present?No Percent of Dominant Species That Are OBL, FACW, or FAC: No 5 Prevalence Index worksheet: 5 7 71.4% Number of Dominant Species That Are OBL, FACW, or FAC: data in Remarks or on a separate sheet) 1Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic. 3 - Prevalence Index is ≤3.01 FACU species UPL species Yes OBL (Plot size: 50 Tree Stratum Yes 30' 25 Absolute % Cover FAC Total % Cover of: 15' ) NWI classification: Yes NoAre climatic / hydrologic conditions on the site typical for this time of year?(If no, explain in Remarks.) naturally problematic? (If needed, explain any answers in Remarks.) significantly disturbed? City/County: Plainfield, Will Co. Plainfield IL Sampling Date: 7/2/2019 Sampling Point: E2 -88.182005 NAD 83 Concave Alex Zelles (CMT)S3, T36N, R9ESection, Township, Range: Local relief (concave, convex, none): 2-4 Long:41.624106 Datum: Remarks: Orthents, loamy, undulating (802B)None Remarks: (Include photo numbers here or on a separate sheet.) =Total Cover Yes 57 Indicator Status Dominant Species? (Plot size: UPL Geum canadense Lonicera maackii ) FACW FAC Yes Impatiens capensis 5 40 Herb Stratum 5' 5 Yes 40 Problematic Hydrophytic Vegetation1 (Explain) OBL species FACW species FAC species 10 Yes Hydrophytic Vegetation Indicators: 200 426 40 132 Lake edge 2 - Dominance Test is >50% Yes 171 =Total Cover 1 - Rapid Test for Hydrophytic Vegetation 20 3.23Prevalence Index = B/A = 25 Multiply by: 10 (Plot size: 75 25 5 WETLAND DETERMINATION DATA FORM – Midwest Region Plainfield 143rd Street Extension - Wetland E Salix nigra Total Number of Dominant Species Across All Strata: Dominance Test worksheet: No No No VEGETATION – Use scientific names of plants. Is the Sampled Area within a Wetland? Morus alba Hydrophytic Vegetation Present? Hydric Soil Present? Wetland Hydrology Present? US Army Corps of Engineers Midwest Region – Version 2.0Page 348 Sampling Point: %%Type1 Loc2 100 100 Type: Depth (inches):Hydric Soil Present? Yes No X Primary Indicators (minimum of one is required; check all that apply) Sparsely Vegetated Concave Surface (B8) Surface Water Present? Yes X Water Table Present? Yes X Saturation Present? Yes X Wetland Hydrology Present? Yes No X Geomorphic Position (D2) 0 No No No Depth (inches): Depth (inches): Depth (inches): Field Observations: E2SOIL 11 Restrictive Layer (if observed): Remarks: Dry-Season Water Table (C2) Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) FAC-Neutral Test (D5) Algal Mat or Crust (B4) Sediment Deposits (B2) Drift Deposits (B3) Water Marks (B1) Iron Deposits (B5) Inundation Visible on Aerial Imagery (B7) (includes capillary fringe) 5 cm Mucky Peat or Peat (S3) This wetland is adjacent to a historic mining pond and has likely experienced disturbance. This data form is revised from Midwest Regional Supplement Version 2.0 to include the NRCS Field Indicators of Hydric Soils, Version 7.0, 2015 Errata. (http://www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_051293.docx) Describe Recorded Data (stream gauge, monitoring well, aerial photos, previous inspections), if available: HYDROLOGY Water-Stained Leaves (B9) Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Oxidized Rhizospheres on Living Roots (C3) Presence of Reduced Iron (C4) Recent Iron Reduction in Tilled Soils (C6) Thin Muck Surface (C7) Gauge or Well Data (D9) Other (Explain in Remarks) Surface Soil Cracks (B6) Drainage Patterns (B10) Stunted or Stressed Plants (D1) Remarks: Surface Water (A1) High Water Table (A2) Saturation (A3) Wetland Hydrology Indicators: Secondary Indicators (minimum of two required) unless disturbed or problematic. wetland hydrology must be present, Silty clay with sand and gravel 0-4 Loamy/Clayey 1Type: C=Concentration, D=Depletion, RM=Reduced Matrix, MS=Masked Sand Grains.2Location: PL=Pore Lining, M=Matrix. Hydric Soil Indicators:Indicators for Problematic Hydric Soils3: Coast Prairie Redox (A16) Iron-Manganese Masses (F12) Red Parent Material (F21) Very Shallow Dark Surface (F22) Other (Explain in Remarks) Sandy Mucky Mineral (S1) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Hydrogen Sulfide (A4) Stratified Layers (A5) 2 cm Muck (A10) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Gravel Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) 3Indicators of hydrophytic vegetation and Matrix Texture Remarks 4-11 Color (moist) Histosol (A1) Loamy Gleyed Matrix (F2) Histic Epipedon (A2) Black Histic (A3) Stripped Matrix (S6) Loamy Mucky Mineral (F1) Dark Surface (S7) Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Redox FeaturesDepth (inches) Color (moist) 7.5YR 4/3 7.5YR 3/2 Loamy/Clayey US Army Corps of Engineers Midwest Region – Version 2.0Page 349 143rd Street Extension APPENDIX C: PHOTOGRAPHS Page 350 Wetland ADuPage RiverPond 1 1 2 3 4 22 23 24 25 26 27 28 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES PHOTO KEY (1 of 2) 0 200 400100 Feet Photo Location & Direction Addendum D ESR Limits (Final 2018) Addendum D ESR Limits (Proposed 2016) Wetlands (CMT 2019) Wetland Data Point (CMT 2019) Upland Data Point (CMT 2019) Stream OHWM (CMT 2019) H&H Waters (2016) Ditch Mining Pond Pond Retention pond Stream Wetland Service Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Page 351 DuPage RiverWetland B Wetland C Wetland D Wetland E Mining Pond 1 (Fletcher Lake) Mining Pond 2 (Main Lake) 29 56 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 30 143rd Street Extension - Plainfield, Will Co., ILWATER RESOURCES PHOTO KEY (2 of 2) 0 200 400100 Feet Photo Location & Direction Addendum D ESR Limits (Final 2018) Addendum D ESR Limits (Proposed 2016) Wetlands (CMT 2019) Wetland Data Point (CMT 2019) Upland Data Point (CMT 2019) Stream OHWM (CMT 2019) H&H Waters (2016) Ditch Mining Pond Pond Retention pond Stream Wetland Service Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community Page 352 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 1 1. Wetland A; view north 2. Wetland A; view west Page 353 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 2 3. Wetland A data point 4. Wetland A upland data point Page 354 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 3 5. Wetland B; view west 6. Wetland B; view east Page 355 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 4 7. Wetland B data point 8. Wetland B upland data point Page 356 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 5 9. Wetland C; view northeast 10. Wetland C data point Page 357 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 6 11. Wetland C upland data point 12. Wetland D; view southeast Page 358 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 7 13. Wetland D; view southwest 14. Wetland D; view east Page 359 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 8 15. Wetland D data point 16. Wetland D upland data point Page 360 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 9 17. Wetland E; view south 18. Wetland E; view northwest Page 361 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 10 19. Wetland E; view east 20. Wetland E data point Page 362 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 11 21. Wetland E upland data point 22. DuPage River; view downstream Page 363 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 12 23. DuPage River; view upstream 24. DuPage River; view downstream Page 364 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 13 25. DuPage River; view upstream 26. Pond 1; view west Page 365 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 14 27. Pond 1; view east 28. Pond 1; view northeast Page 366 143rd Street Extension – Plainfield, Will Co., IL Photographic Log 15 29. Mining Pond 1 (Fletcher Lake) 30. Mining Pond 2 (Main Lake) Page 367 143rd Street Extension APPENDIX D: H&H WETLAND DELINEATION (2016) Page 368 Wetland Delineation Report Wetland and WOUS Investigation Village of Plainfield 143rd Street Extension Illinois Route 59 to Illinois Route 126 Village of Plainfield, Will County, Illinois October 2016 File No. 81.0220102.05 PREPARED FOR: Crawford, Murphy, and Tilly, Inc. (CMT) Aurora, Illinois Huff & Huff, A Subsidiary of GZA 915 Harger Road, Suite 330 │ Oak Brook, IL 60523 630‐684‐9100 GZA has 28 Offices Nationwide www.huffnhuff.com www.gza.com Page 369 October 2016 Wetland and WOUS Investigation 81.0220102.05 TOC | i TABLE OF CONTENTS 1.0 INTRODUCTION ............................................................................................................................................... 1 2.0 METHODOLOGY ............................................................................................................................................... 2 2.1 HYDROPHYTIC VEGETATION ......................................................................................................................... 2 2.2 HYDRIC SOIL .................................................................................................................................................. 3 2.3 WETLAND HYDROLOGY ................................................................................................................................. 3 2.4 “WATERS OF THE U.S.” ASSESSMENT ........................................................................................................... 4 2.5 FLORISTIC QUALITY ASSESSMENT ................................................................................................................. 5 2.6 FARMED WETLAND DETERMINATION .......................................................................................................... 5 3.0 WETLAND FINDINGS ........................................................................................................................................ 6 3.1 PUBLISHED MAP DATA .................................................................................................................................. 6 3.2 FIELD INVESTIGATION ................................................................................................................................... 9 3.3 FARMED WETLAND DETERMINATION ........................................................................................................ 14 4.0 SUMMARY OF WETLAND INVESTIGATION ...................................................................................................... 15 5.0 COORDINATION/PERMITS REQUIRED ............................................................................................................ 18 5.1 PERMITTING AGENCIES ............................................................................................................................... 18 5.2 INTERAGENCY WETLAND POLICY ACT (IWPA) ............................................................................................ 20 5.3 THREATENED AND ENDANGERED SPECIES ................................................................................................. 20 5.4 ILLINOIS HISTORIC PRESERVATION AGENCY ............................................................................................... 21 5.5 NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEM (NPDES) PERMIT ........................................... 21 5.6 FARMED WETLAND DETERMINATION ........................................................................................................ 21 5.7 COASTAL ZONE MANAGEMENT AREAS ...................................................................................................... 21 6.0 MITIGATION OF WETLAND IMPACTS .............................................................................................................. 22 7.0 LIMITATIONS AND EXCEPTIONS ....................................................................................................................... 25 REFERENCES ............................................................................................................................................................... 26 Page 370 October 2016 Wetland and WOUS Investigation 81.0220102.05 TOC | ii TABLE OF CONTENTS TABLES TABLE 2‐1 VEGETATION STRATA AND PLOT SIZE FOR THE MIDWEST REGION PAGE 2 TABLE 2‐2 WETLAND HYDROLOGY INDICATORS FOR THE MIDWEST REGION PAGE 4 TABLE 3‐1 MAPPED SOILS WITHIN THE SURVEY LIMITS PAGE 6 TABLE 3‐2 FWD CHECK SHEET PAGE 14 TABLE 4‐1 WETLAND SUMMARY PAGE 16 TABLE 4‐2 WOUS SUMMARY PAGE 17 TABLE 6‐1 IWPA MITIGATION RATIOS PAGE 22 APPENDICES APPENDIX A FIGURES: FIGURE 1 ‐ SITE LOCATION MAP FIGURE 2 ‐ SOIL SURVEY MAP FIGURE 3 ‐ NATIONAL WETLANDS INVENTORY MAP FIGURE 4 ‐ FLOOD INSURANCE RATE MAP FIGURE 5 ‐ WETLANDS AND WOUS LOCATION MAP FIGURE 6 ‐ CONSTRUCTION STORMWATER FEATURES MAP APPENDIX B DATASHEETS AND FQI APPENDIX C PHOTOGRAPHS APPENDIX D JURISDICTIONAL SUMMARY APPENDIX E FARMED WETLAND DETERMINTAION J:\81.0220102.05 CMT 143rd Street\Reports\CMT 143rd.docx Page 371 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 1 1.0 INTRODUCTION The Village of Plainfield (Village) is proposing to extend 143rd Street from its current terminus at Illinois Route 59 (IL 59) east to Illinois Route 126 (IL 126) in Plainfield, Will County, Illinois (T36N, R9E, and Sections 2, 3, 4, 9, 10, and 11). The proposed roadway extension will include a new alignment within an existing Commonwealth Edison (ComEd) utility right‐ of‐way (ROW). Land use adjacent to the proposed project includes residential, former gravel pits (now used as private hunting/fishing clubs), and a cemetery at the proposed 143rd Street and Plainfield/Naperville Road intersection. One commercial establishment is located at the intersection of IL 59 and 143rd Street. The area investigated is depicted on Figure 1 in Appendix A. The U.S. Army Corps of Engineers (USACE; Federal Register 1982) and the U.S. Environmental Protection Agency (EPA; Federal Register 1980) jointly define wetlands as: “Those areas that are inundated or saturated by surface or ground water at a frequency and duration sufficient to support, and that under normal circumstances do support, a prevalence of vegetation typically adapted for life in saturated soil conditions.” Identification of wetlands is based on a three‐factor approach involving indicators of hydrophytic vegetation, hydric soil, and wetland hydrology, originally set forth by the USACE in the 1987 Environmental Laboratory publication entitled Corps of Engineers Wetlands Delineation Manual: Technical Report Y‐87‐1, commonly referred to as the 1987 Wetlands Delineation Manual. The Midwest Region supplement to the 1987 Wetlands Delineation Manual was released in 2010 outlining updated technical guidance and procedures for identifying and delineating wetlands that may be subject to regulatory jurisdiction under Section 404 of the Clean Water Act (CWA) or Section 10 of the Rivers and Harbors Act. This wetland delineation was conducted using methodology presented in the Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Midwest Region (2010, USACE Midwest Region Manual). On May 27, 2015, the EPA and the USACE finalized the Clean Water Rule (CWR) which clarifies protection of “Waters of the U.S.” (WOUS) under the CWA. The CWR went into effect on August 28, 2015; however, the U.S. Court of Appeals for the Sixth Circuit issued a nationwide stay of the CWR on October 9, 2015 while the CWR is being challenged. WOUS are generally open water areas such as rivers and lakes including wetlands that are connected to navigable waterways and their tributaries. Huff & Huff, Inc. (H&H) conducted wetland delineations for the project on July 18, 2006, October 15, 2006, April 27, 2007, and May 24, 2007. Three sites were originally identified: Sites 1 and 2, both floodplain wetlands, and Site 3, a constructed detention pond. Since the wetland delineation was conducted, the survey limits have been expanded and the five‐year wetland delineation period has expired. Therefore, H&H updated the original wetland delineation and investigated areas within the expanded survey limits on June 8, and 17, 2016 and September 9, 2016. Three wetlands (Sites 1, 2, and 3) and three WOUS (Sites W1, W2, and W3) were identified during the site visit. Site 1 is a wet meadow, forested wetland, and marsh associated with the West and East Norman Drains and the DuPage River. Sites 2 and 3 are seasonal depressional wetlands. Site W1 is the West Norman Drain. Site W2 is the East Norman Drain. Site W3 is the DuPage River. This project lies within the Des Plaines River Watershed (HUC Code 07120004). During the site inspection, two constructed stormwater storage and two constructed conveyance features were observed within the survey limits. These features were constructed for the purposes of stormwater conveyance or storage. In most cases the USACE does not require mitigation of constructed stormwater features that will be replaced at a 1:1 ratio. One pond (Pond 1) was observed in addition to four mining ponds (Mining Ponds 1, 2, 3, and 4). This report summarizes the findings of the field visit and the general site conditions. Page 372 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 2 2.0 METHODOLOGY This wetland and WOUS delineation was conducted based on the 2010 USACE Midwest Region Manual. Each potential wetland and WOUS area is evaluated for the presence of wetland indicators comprised of hydrophytic vegetation, hydric soils, and wetland hydrology as discussed in the following sections. 2.1 HYDROPHYTIC VEGETATION To evaluate the presence of hydrophytic vegetation, data are gathered using a graduated series of plots, one for each vegetation stratum. Plot shape and size are dictated by vegetation type as well as the shape and size of the plant community being evaluated. Table 2‐1 presents vegetation strata and standard plot/sample sizes used for sampling purposes as defined by the 2010 USACE Midwest Region Manual: Hydrophytic Vegetation Indicators, Chapter 2. Table 2‐1 Vegetation Strata and Plot Size for the Midwest Region Stratum Description Plot and Sample Size Standards* Trees Woody plants 3 inches (7.6 cm) or more in diameter at breast height (DBH), regardless of height. 30 feet (9.1 m) radius Saplings/Shrubs Woody plants less than 3 inches DBH and greater than 3.28 feet (1 m) tall. 15 feet (4.6 m) radius Herbaceous Herbaceous (non‐woody) plants, including herbaceous vines, regardless of size, and woody plants less than 3.28 feet tall. 5 feet (1.5 m) radius or 3.28 by 3.28 square feet (1 m2) quadrat Woody Vines Woody vines greater than 3.28 feet in height. 30 feet (9.1 m) radius * Plot size and shape may vary depending on field conditions. The indicator status and percent absolute cover for plants within plots for all vegetation strata are recorded. The indicator status for plant species are rated based on an estimated probability of occurring in wetlands. This rating system, published by Lichvar et al. in 2016 under the title “The National Wetland Plant List: 2016 Wetland Ratings”, consists of obligate wetland plants (OBL), facultative‐wet plants (FACW), facultative plants (FAC), facultative upland plants (FACU), and upland plants (UPL). Obligate plant species generally grow in water. Facultative plant species can exist in saturated or dry soil conditions, and upland plants typically require dry soil conditions to exist. The rapid test for hydrophytic vegetation (Indicator 1), the dominance test (Indicator 2), the prevalence index (Indicator 3), and morphological adaptations (Indicator 4) determine the presence or absence of hydrophytic vegetation within plots for all vegetation strata. The rapid test for hydrophytic vegetation is intended to be used as a quick confirmation in obvious cases that the site being investigated has hydrophytic vegetation, without the need for more intensive sampling. To pass the rapid test, all the dominant species across all strata must be rated OBL or FACW, or a combination of the two, based on a visual assessment. To pass the dominance test, more than 50 percent of the dominant plant species across all strata must be rated OBL, FACW, or FAC. The “50/20 rule”, as outlined by the 2010 USACE Midwest Region Manual, provides an objective procedure Page 373 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 3 for the selection of dominant plant species within each stratum. In general, dominants are the most abundant species that individually or collectively account for more than 50 percent of the total coverage of vegetation in the stratum, plus any other species that, by itself, accounts for at least 20 percent of the total. The prevalence index is a weighted average wetland indicator status of all plants, both dominant and non‐dominant species, within a sampling plot. Each indicator status category is given a numeric value (OBL = 1, FACW = 2, FAC = 3, FACU = 4, and UPL = 5) and weighted by its abundance (absolute percent cover). A prevalence index of 3.0 or less confirms hydrophytic vegetation. Morphological adaptations are often present in plants adapted to wetland areas as these adaptations aide in plant survival during prolonged inundation and saturation in the root zone. Morphological adaptations are indicative of hydrophytic vegetation when observed in more than 50 percent of FACU individuals. Morphological adaptations can only be used as a hydrophytic vegetation indicator if hydric soils and wetland hydrology are also present. 2.2 HYDRIC SOIL A description of the soil profile is used to evaluate the presence of hydric soil. Hydric soil indicators include the following as defined by the 2010 USACE Midwest Region Manual; Hydric Soil Indicators, Chapter 3: Indicator Indicator A1. Histosol S5. Sandy Redox A2. Histic Epipedon S6. Stripped Matrix A3. Black Histic F1. Loamy Mucky Material A4. Hydrogen Sulfide F2. Loamy Gleyed Matrix A5. Stratified Layers F3. Depleted Matrix A10. 2 cm Muck F6. Redox Dark Surface A11. Depleted Below Dark Surface F7. Depleted Dark Surface A12. Thick Dark Surface F8. Redox Depressions S1. Sandy Mucky Mineral A16. Coast Prairie Redox S3. 5 cm Mucky Peat or Peat F12. Iron‐Manganese Masses S4. Sandy Gleyed Matrix TF12.Very Shallow Dark Surface The indicators presented above are a subset of the National Technical Committee for Hydric Soils (NTCHS) Field Indicators of Hydric Soils in the United States (U.S. Department of Agriculture [USDA] Natural Resources Conservation Service [NRCS] 2010). These indicators are applicable to other land resource regions and are not limited to the Midwest region. Hydric indicators are regularly modified. Therefore, the above list may not reflect all applicable indicators. The most current version or the list of indicators was used for delineation purposes and can be found on the NRCS website. 2.3 WETLAND HYDROLOGY Wetland hydrology indicators, outlined by the 2010 USACE Midwest Region Manual: Wetland Hydrology Indicators, Chapter 4, are separated into four groups and divided into a primary or secondary category based on their estimated reliability in this region. Primary indicators provide stand‐alone evidence of a current or recent hydrological event. Secondary indicators provide evidence of recent inundation or saturation when supported by one or more other primary indicators or secondary wetland hydrology indicators, but should not be used alone. Documentation of wetland indicators determines wetland hydrology during the site investigation. Table 2‐2 presents the wetland hydrology indicators for the Midwest Region. Page 374 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 4 Table 2–2. Wetland Hydrology Indicators for the Midwest Region Indicator Category Primary Secondary Group A – Observation of Surface Water or Saturated Soils A1 – Surface water X A2 – High water table X A3 – Saturation X Group B – Evidence of Recent Inundation B1 – Water marks X B2 – Sediment deposits X B3 – Drift deposits X B4 – Algal mat or crust X B5 – Iron deposits X B6 – Surface soil cracks X B7 – Inundation visible on aerial imagery X B8 – Sparsely vegetated concave surface X B9 – Water‐stained leaves X B10 – Drainage patterns X B13 – Aquatic fauna X B14 – True aquatic plants X Group C – Evidence of Current or Recent Soil Saturation C1 – Hydrogen sulfide odor X C2 – Dry‐season water table X C3 – Oxidized rhizospheres along living roots X C4 – Presence of reduced iron X C6 – Recent iron reduction in tilled soils X C7 – Thin muck surface X C8 – Crayfish burrows X C9 – Saturation visible on aerial imagery X Group D – Evidence from Other Site Conditions or Data D1 – Stunted or stressed plants X D2 – Geomorphic position X D5 – FAC‐neutral test X D9 – Gauge or well data X 2.4 “WATERS OF THE U.S.” ASSESSMENT WOUS may only have one or two of the wetland criteria listed above. The USACE defines the ordinary high water mark (OHWM) as the boundary of WOUS. The OHWM is the line on the shore established by fluctuations of water and is indicated by physical characteristics such as: A clear, natural line impressed on the bank Shelving; Page 375 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 5 Changes in the character of soil; Destruction of terrestrial vegetation; The presence of litter and debris; or Other appropriate means that consider the characteristics of the surrounding areas. During low stream flow or drought conditions, the OHWM is used to determine the boundary of a WOUS. During extremely high stream flow conditions or flood conditions the boundaries of WOUS cannot accurately be determined. Therefore, WOUS boundaries should be delineated when normal stream flow conditions are present. To differentiate boundaries between WOUS and adjacent wetlands, evidence of the OHWM is utilized. Changes in vegetation can also be evaluated to determine where true hydrophytic (FAC and FACW) plant species are present versus aquatic or OBL species; however, it should be noted that in many cases vegetation is not present within the channels of WOUS. Vegetation adjacent to WOUS may be limited to species overhanging the banks and channel. If the presence of a WOUS is questionable, the USACE will typically conduct a review of historic aerial photographs and historic U.S. Geological Survey (USGS) topographic maps to confirm the current or historic presence of a WOUS. This can include segments of streams that are entirely enclosed. 2.5 FLORISTIC QUALITY ASSESSMENT Observed plant species are noted to obtain the Floristic Quality Index (FQI) and native mean C‐ value (coefficient of conservatism). Areas of high natural quality include native plants with C‐ values ranging from approximately 4 to 10. C‐ values are assigned to native plants as listed in Plants of the Chicago Region (Swink and Wilhelm, 1994). A low C‐value indicates that a plant is generally not considered high quality or is a habitat generalist. An FQI for each site is obtained by multiplying mean C‐value of all native plants encountered in a quadrat by the square root of the number (N) of native species. FQI values of 0 to 5.0 are considered severely degraded, 5.1 to 9.9 as degraded, 10 to 19.9 are moderate quality with some native character, and those with values greater than 20 have natural characteristics and are considered to be an environmental asset. 2.6 FARMED WETLAND DETERMINATION Because there is actively farmed agricultural land within the survey limits, a Farmed Wetland Determination (FWD) is required. A FWD is conducted using methodologies outlined in the National Food Security Act Manual (2010). Climate data, from the closest Illinois station, is used to determine relative rainfall volume and subsequently define normal and above normal precipitation years. This rainfall and precipitation information is used to create a NRCS Climate Analysis for Wetlands Table (WETS table) which classifies each year as a wet, normal, or dry year. A “Wet Year” indicator slide is selected and serves as a base map to evaluate potential farmed wetland signatures. Then five “Normal Years” of Farm Service Agency (FSA) aerial slides area are selected and reviewed to determine if the signatures identified from the base map are present. Field investigations are not required for farmed wetland signatures that are not present on three or more “Normal Year” slides out of five, or two of five “Normal Year” slides if the signature is also depicted as a wetland on the National Wetlands Inventory (NWI) Map. Page 376 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 6 3.0 WETLAND FINDINGS 3.1 PUBLISHED MAP DATA Data were gathered from the Will County Soil Survey, the U.S. Department of the Interior, U.S. Fish and Wildlife Service (FWS) NWI Map, and the Federal Emergency Management Agency (FEMA) Flood Insurance Rate Map (FIRM) to provide an indication of areas where wetlands and WOUS potentially occur. Figures are located in Appendix A. Soil Survey The NRCS Web Soil Survey is generated from USDA‐NRCS certified data of Will County. Table 3‐1 summarizes the mapped soils within the survey limits as depicted on Figure 2. Table 3‐1. Mapped Soils within the Survey Limits Soil Unit Soil Type Percent Slope Potential Hydric Inclusion (Component Representative Percentage) Landform 152A Drummer silty clay loam 0‐2 Drummer, drained (94%) Harpster, drained (3%) Peotone, drained (3%) Outwash Plains Depressions 223C2 Varna silt loam 4‐6 ‐‐‐‐ 290A Warsaw silt loam 0‐2 Will (<1%)Outwash Plains 290B Warsaw silt loam 2‐4 ‐‐‐‐ 318C2 Lorenzo loam 4‐6 ‐‐‐‐ 356A Elpaso silty clay loam 0‐2 Elpaso, drained (94%) Harpster, drained (4%) Peotone, drained (2%) Till Plains Depressions 523A Dunham silty clay loam 0‐2 Dunham (92%) Houghton (2%) Millsdale (2%) Outwash Plains Ground Moraines Swales 541B Graymont silt loam 2‐5 Elpaso (4%)End Moraines 541C2 Graymont silt loam, eroded 5‐10 Elpaso, drained (3%) Till Plains 614A Chenoa silty clay loam 0‐2 Elpaso, drained (3%) Ashkum, drained (3%) Swales 802B Orthents, loamy, undulating N/A Pella (1%) Drummer (1%) Outwash Plains 802D Orthents, loamy, rolling N/A ‐‐ ‐‐ 8321A DuPage silt loam, occasionally flooded 0‐2 Millington (<1%) Flood Plains W Water N/A ‐‐ ‐‐ According to the NRCS 2015 National Hydric Soil List by State for Will County, Drummer silty clay loam (152A), Elpaso silty clay loam (356A), and Dunham silt clay loam (523A) have a high likelihood of being a hydric soil within the specific landform noted in Table 3‐1. Page 377 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 7 Warsaw silt loam (290A), Graymont silt loam (541B), Graymont silt loam, eroded (541C2), Chenoa silty clay loam (614A), Orthents, loamy, undulating (802B), and DuPage silt loam, occasionally flooded (8321A) are listed as containing hydric inclusions that represent less than 10 percent of the soil type according to the NRCS 2015 National Hydric Soil List by State for Will County. Typically, soils that contain hydric inclusions that represent less than 10 percent of the soil type would be considered upland soils. However, it should be noted that field analyses of soils supersede the mapped soils data as presented within the NRCS 2015 National Hydric Soil List by State. National Wetlands Inventory The digital format NWI maps were developed by FWS in collaboration with the USGS Water Resources Division using data from 1987. The maps were prepared primarily by stereoscopic analysis of high altitude aerial photographs. All wetlands are identified based on vegetation, visible hydrology, and geography in accordance with the Cowardin System. According to the FWS, the aerial photographs typically reflect conditions during the year and season they were taken, and there is a margin of error inherent in the use of aerial photographs to delineate wetlands. Therefore, wetland boundaries established through interpretation of aerial photographs may be revised based upon detailed ground surveys and historical analysis of an individual site. The digital NWI Map (Figure 3 in Appendix A) depicts the following mapped wetlands within the survey limits: One Palustrine, Emergent, Persistent, Temporary Flooded (PEM1A) Two Palustrine, Emergent, Persistent, Seasonally Flooded, Excavated (PEM1Cx) One Riverine, Lower Perennial, Unconsolidated Bottom, Permanently Flooded (R2UBH) One Palustrine, Unconsolidated Bottom, Intermittently Exposed, Excavated (PUBGx) One Lacustrine, Limnetic, Unconsolidated Bottom, Permanently Flooded, Excavated (L1UBHx) FEMA FIRM The FEMA FIRM (Figure 4 in Appendix A) depicts Zones X500, Zone X (other areas), Zone A (floodplain), and Zone AE (floodplain & floodway) within the survey limits. Zone A (floodplain) is defined as a special flood hazard area inundated by the 100‐year flood, no base flood elevations determined. Zone AE (floodplain) is defined as a special flood hazard area inundated by the 100‐year flood, base flood elevations determined. Zone AE (floodway) is defined as special flood hazard areas (SFHAs) subject to inundation by the 1% annual chance flood, base flood elevations determined. Floodways within Zone AE are defined as the channel of a stream plus any adjacent floodplain areas that must be kept free of encroachment so that the 1% annual chance flood can be carried without substantial increases in flood heights. Page 378 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 8 Zone X500 is defined as areas of 500‐year flood; areas of 100‐year flood with average depths of less than 1 foot or with drainage areas less than 1 square mile; and areas protected by levees from 100‐year flood. An area inundated by 0.2% annual chance flooding. Zone X (other flood areas) is defined as areas determined to be outside 500‐year floodplain determined to be outside the 1% and 0.2% annual chance floodplains. Section 303(d) and Total Maximum Daily Load (TMDL) Waters are designated by the Illinois Environmental Protection Agency (IEPA) for a variety of uses including drinking water, aquatic life, primary contact (e.g., swimming), secondary contact (e.g., boating), wildlife, agricultural use, industrial use, food‐processing water supply, and aesthetic quality. Section 303(d) of the CWA requires states to identify waters that do not meet applicable water quality standards or do not fully support their designated uses by providing a prioritized list of impaired waters, known as the Section 303(d) List, to the EPA for review and approval. The CWA also requires that a Total Maximum Daily Load (TMDL) be developed for each pollutant of an impaired water body. A TMDL sets a maximum limit of a given pollutant that a water body can receive without violating water quality standards and designated uses. According to the IEPA 2016 Illinois Integrated Water Quality Report and Section 303(d) List, portions of the West and East Norman Drains within the survey limits are not listed on the 303(d) list. A portion of the West Norman Drain has a Class D diversity rating, but it does not have a rating for integrity nor is it considered a biologically significant stream as part of the Biological Stream Characterization (BSC) (IDNR 2008). The DuPage River (Assessment Unit [AUID], IL_GB‐16), is non‐supportive of aquatic life, fish consumption, and primary contact. Impairments to the DuPage River include: other flow regime alterations, oxygen (dissolved), phosphorus (total), mercury, polychlorinated biphenyls, and fecal coliform. Fecal coliform and oxygen (dissolved) have a Stage 3 TMDL status. Sources of impairments are: Impacts from Hydrostructure Flow Regulation/modification Municipal Point Source Discharges Site Clearance (Land Development or Redevelopment) Urban Runoff/Storm Sewers Atmospheric Deposition – Toxics Source Unknown The portion of the DuPage River within the survey limits is not considered a biologically significant stream nor does it have stream class ratings for diversity or integrity as part of the Biological Stream Characterization (BSC) (IDNR 2008). Jurisdictional Determination/Waters Upload A jurisdictional determination (JD) is required from the USACE to determine whether on‐site wetlands/WOUS are under the jurisdiction of the USACE. A JD is requested by submitting the delineation report and a request for the determination by the applicant. In addition to these materials, a USACE approved jurisdictional summary spreadsheet also known as the “Waters Upload” is submitted. The Waters Upload includes information about each identified wetland or WOUS including Page 379 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 9 acreage, geographic location, nearest local waterway, Hydrogeomorphic (HGM) Code, Cowardin Code, and Waters Type. The Waters Upload is included in Appendix D. The HGM Code is a code assigned to each wetland or WOUS based on a wetland classification system (developed by the NRCS) that places emphasis on the geomorphic and hydrologic functional attributes of wetlands. Seven main classes describe a wetland or WOUS with regard to its position in the landscape: Depressional, Estuarine Fringe, Lacustrine Fringe, Mineral Soil Flats, Organic Soil Flats, Riverine, and Slope. The subclass level further classifies each complex by the influence of its morphological characteristics, water source, and hydrodynamics. The Cowardin Code is a code assigned to each wetland or WOUS based on the Cowardin System (developed by the FWS) which classifies wetlands with a hierarchical approach. Wetlands or WOUS are initially characterized as either: Marine, Estuarine, Riverine, Lacustrine, or Palustrine systems, then by water flow (subsystem), substrate types (class), vegetation types and dominant species (subclass), and flooding regimes and salinity levels (modifiers). Waters Type is a code developed by the USACE and EPA that classifies a wetland or WOUS as a traditional navigable water (TNW), relatively permanent waterway (RPW), upland, or isolated complex. The code is modified if wetlands or non‐RPWS are located adjacent to or abutting TNWs and RPWs. 3.2 FIELD INVESTIGATION Three wetlands (Sites 1, 2, and 3) were identified within the survey limits based on soil properties, hydrology, and vegetative composition. In addition, three WOUS (Sites W1, W2, and W3) were identified within the survey limits at the time of the site visit. The sites are described below and are mapped on Figure 5 in Appendix A. Field data sheets and FQI are included in Appendix B. Photographic documentation is included in Appendix C. In addition to the sites described below, two constructed storage features, two constructed conveyance features, a pond, and four mining ponds were investigated within the survey limits and are mapped on Figure 6, in Appendix A. Retention Pond 1 (RP1) is associated with a signature on the FWD and was constructed as part of a development. Pond 1 is located east of the DuPage River, north of the ComED ROW and appears to have been excavated between 1974 and 1988 based on a review of historic aerials. Four mining ponds (Mining Ponds 1, 2, 3, and 4) were observed within and adjacent to the survey limits east of the DuPage River. These areas are former gravel pits excavated between 1952 and 1961 which are now owned by the Bass and Gill Club, Inc. Constructed stormwater features met all three wetland criteria. Because the stormwater features are constructed for stormwater storage and conveyance, they will not be considered wetlands and are not included in the total wetland summary. In most cases the USACE does not require mitigation of constructed stormwater features that will be replaced at a 1:1 ratio. Site 1 is a wet meadow, forested wetland, and marsh located along the West Norman Drain, East Norman Drain, and the DuPage River. A total of 8.47 acres of wetland are located within the survey limits. Site 1 provides the functions of flood control, conveyance, treatment of surface runoff, sediment and nutrient uptake, erosion control, and wildlife habitat. Page 380 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 10 Dominant vegetation within Site 1 includes: Tree stratum – silver maple (Acer saccharinum) Sapling/shrub stratum – none Herb stratum – reed canary grass (Phalaris arundinacea), Canadian clearweed (Pilea pumila), barnyard grass (Echinochloa crus‐galli), witch grass (Panicum capillare), white amaranth (Amaranthus albus), yellow nutsedge (Cyperus esculentus) Woody vine stratum – none Hydrophytic vegetation was confirmed by the Rapid Test for Hydrophytic Vegetation at Data Points 1‐1, 1‐5, and 1‐11 and the Dominance Test at Data Points 1‐7 and 1‐9. The native FQI and native mean C‐value for Site 1 are 13.9 and 2.3, respectively, indicating moderate floristic quality. Site 1 is mapped as: Drummer silty clay loam (152A), which is listed as a hydric soil in till plains and depressions Water (W) Elpaso silty clay loam (356A), which is listed as hydric in till plains and depressions DuPage silt loam, occasionally flooded (8321A), which is listed as hydric in floodplains Dunham silty clay loam (523A), which is listed as hydric in outwash plains, ground moraines, and swales Hydric soil was confirmed by Redox Dark Surface (F6) at Data Point 1‐1, Depleted Dark Surface (F7) at Data Points 1‐5, 1‐ 7, and 1‐9, and Depleted Matrix (F3) at 11‐1. Site 1 receives surface water from adjacent uplands and impervious surfaces. Primary wetland hydrology indicators present at the time of the site visit include Saturation (A3), Algal Mat or Crust (B4), and Drift Deposits (B3). Secondary indicators of wetland hydrology present include Crayfish Burrows (C8), Saturation Visible on Aerial Imagery (C9), Geomorphic Position (D2), and FAC‐Neutral Test (D5). Site 1 is mapped as a PEM1A wetland on the NWI Map. Site 1 is mapped as Zones AE (floodway and floodplain) and X500 on the FIRM. All three wetland criteria are present. Therefore, Site 1 was considered a wetland. Site 1 abuts the East and West Norman Drains and the DuPage River, which have direct surface water connections to the Des Plaines River, a TNW, and will be considered jurisdictional. See data sheets 1‐1 through 1‐11 for findings. Site 2 is a seasonal depressional wetland, located approximately 0.18 mile east of IL 59 and approximately 0.17 mile south of West Hazelcrest Drive. Site 2 has some characteristics of an ephemeral wetland as it is seasonally inundated and is located in a closed depression within a forest, situated in an outwash plain (USGS Quaternary Geologic Map of the Chicago 4x6 Quadrangle, 1983). Several dragonflies (Anisoptera) and damsel flies (Zygoptera) were observed within Site 2 during the June site visits. However faunal surveys were not conducted at the time of the site visits to support an ephemeral wetland designation. A total of 0.03 acre of wetland is located within the survey limits. Site 2 provides the functions of flood control, treatment of surface runoff, and sediment and nutrient uptake, and wildlife habitat. Page 381 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 11 Dominant vegetation within Site 2 includes: Tree stratum – eastern cottonwood (Populus deltoides), white mulberry (Morus alba) Sapling/shrub stratum – common buckthorn (Rhamnus cathartica) Herb stratum – aster species (Symphyotrichum sp.), jumpseed (Persicaria virginiana) Woody vine stratum – none Hydrophytic vegetation was confirmed by the Dominance Test. The native FQI and native mean C‐value of Site 2 are 4.6 and 2.7 respectively, indicating degraded floristic quality. Site 2 is mapped as Graymont silt loam (541B), which is not listed as a hydric soil in Will County. Hydric soil was confirmed by 2cm Muck (A10) and Depleted Dark Surface (F7). Rocks were encountered at eight inches below the soil surface. The soil appears to have been disturbed in the past by construction. Site 2 receives surface water from adjacent uplands. Primary wetland hydrology indicators present at the time of the site visit include Inundation Visible on Aerial Imagery (B7) and Oxidized Rhizospheres on Living Roots (C3). Secondary indicators of wetland hydrology present include Geomorphic Position (D2). Site 2 is not depicted on the NWI Map. Site 2 is mapped as Zone X on the FIRM. All three wetland criteria are present. Therefore, Site 2 will be considered a wetland. Site 2 appears to be isolated. See data sheets 2‐1 and 2‐2 for findings. Site 3 is a seasonal depressional wetland located on the south side of East 143rd Street, east of IL 126. A total of 0.002 acre of wetland are located within the survey limits. Site 3 has some characteristics of an ephemeral wetland as it is seasonally inundated within an enclosed depression within a forest, situated in a ground moraine (USGS Quaternary Geologic Map of the Chicago 4x6 Quadrangle, 1983). However faunal surveys were not conducted at the time of the site visits to support an ephemeral wetland designation. As Site 3 is located on a former quarry property, and may be a quarry test pit. However, evidence to support or refute this possibility is not available. Site 3 provides the functions of flood control, treatment of surface runoff, and sediment and nutrient uptake, and wildlife habitat. Dominant vegetation within Site 3 includes: Tree stratum – eastern cottonwood Sapling/shrub stratum – Tatarian honeysuckle (Lonicera tatarica), white mulberry Herb stratum – none Woody vine stratum – none Hydrophytic vegetation was confirmed by the Dominance Test. The native FQI and native mean C‐value for Site 3 are 5.7 and 1.7, respectively, indicating degraded floristic quality. Site 3 is mapped as Orthents, loamy, undulating (802B), which has hydric inclusions in outwash plains in Will County. Hydric soil was confirmed by Histosol (A1). Page 382 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 12 Site 3 receives surface water from adjacent uplands and impervious surfaces. Primary wetland hydrology indicators present at the time of the site visit include a High Water Table (A2), Saturation (A3), and Sparsely Vegetated Concave Surface (B8). Secondary indicators of wetland hydrology present include Geomorphic Position (D2). Site 3 is not depicted on the NWI Map. Site 3 is mapped as Zone X on the FIRM. All three wetland criteria are present. Therefore, Site 3 will be considered a wetland. Site 3 appears to isolated. See data sheets 3‐1 and 3‐2 for findings. Site W1 is the West Norman Drain, a WOUS, that crosses IL 59 approximately 355 feet south of the IL 59 at 143rd Street intersection and approximately 540 feet west of the IL 59 and 143rd Street intersection. Data Point W1 is located within the West Norman Drain, on the east side of IL 59, south of West 143rd Street. Site W1 is mapped as a perennial stream on the USGS topographic map. Site W1 receives surface water from adjacent uplands and impervious surfaces. Site W1 is a WOUS and will be considered a USACE jurisdictional WOUS. See datasheet W1‐1 for findings. The following summarizes the WOUS characteristics of Site W1. Acreage within survey limits: 1.28 acre Flow Regime (Perennial, Intermittent, Ephemeral): Perennial Flow direction: East Flow strength (Low, Moderate, or High): Moderate OHWM indicators: A clear, natural line impressed on the bank, shelving, changes in the character of the soil, destruction of terrestrial vegetation, extended inundation Approximate width: 20 feet Approximate depth: Up to 12 inches Adjacent land cover: Wet Meadow, Forested Riparian Substrate: Cobbles, silt, and clay Riffles observed? No Pools observed? No Bank vegetation: silver maple (Acer saccharinum), box elder (Acer negundo) Mapped hydric soil: Elpaso silty clay loam (356A), Dunham silty clay loam (523A), Drummer silty clay loam (152A) Mapped non‐hydric soil: N/A USGS 8‐Digit HUC: 07120004 Waters Type: Relatively Permanent Water (RPW) HGM Code: Riverine National Wetland Inventory Code: PEMC1X USGS Topographic Map: Perennial Stream FEMA FIRM: Zone AE (Floodway and Floodplain) Is the stream classified as a BSS? No BSC Diversity Rating: D BSC Integrity rating: None Navigable Section 10: No Navigable Section 9: No Site W2 is the East Norman Drain, a WOUS, located east of IL 59, north of 143rd Street. Site W2 flows south into Site W3. Site W2 is mapped as a perennial stream on the USGS topographic map. Site W2 receives surface water from adjacent uplands and impervious surfaces. Site W2 is a WOUS and will be considered a USACE jurisdictional WOUS. See datasheet W2‐1 for findings. The following summarizes the WOUS characteristics of Site W2. Page 383 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 13 Acreage within survey limits: 0.03 acre Flow Regime (Perennial, Intermittent, Ephemeral): Perennial Flow direction: South Flow strength (Low, Moderate, or High): Low OHWM indicators: A clear, natural line impressed on the bank, shelving, changes in the character of the soil, destruction of terrestrial vegetation, extended inundation Approximate width: 15‐20 feet Approximate depth: 18‐24 inches Adjacent land cover: Wet Meadow, Forested Riparian Substrate: Cobble and silt Riffles observed? No Pools observed? No Bank vegetation: Tatarian honeysuckle, common buckthorn Mapped hydric soil: Drummer silty clay loam (152A) Mapped non‐hydric soil: N/A USGS 8‐Digit HUC: 07120004 Waters Type: Relatively Permanent Water (RPW) HGM Code: Riverine National Wetland Inventory Code: None USGS Topographic Map: Perennial Stream FEMA FIRM: Zone AE (Floodway) Is the stream classified as a BSS? No BSC Diversity Rating: None BSC Integrity rating: None Navigable Section 10: No Navigable Section 9: No Site W3 is the DuPage River, a WOUS, east of IL 59. Site W3 is mapped as a perennial river on the USGS topographic map. Site W3 receives surface water from adjacent uplands and impervious surfaces. Site W3 is a WOUS and will be considered a USACE jurisdictional WOUS. See datasheet W3‐1 for findings. The following summarizes the WOUS characteristics of Site W3. Acreage within survey limits: 1.96 Flow Regime (Perennial, Intermittent, Ephemeral): Perennial Flow direction: South Flow strength (Low, Moderate, or High): Moderate to High OHWM indicators: A clear, natural line impressed on the bank, shelving, changes in the character of the soil, destruction of terrestrial vegetation, extended inundation, litter or debris Approximate width: 80‐140 feet Approximate depth: 48‐60 inches Adjacent land cover: Wet Meadow, Forested Riparian, Marsh Substrate: Gravel and silt Riffles observed? Yes Pools observed? Yes Bank vegetation: reed canary grass Mapped hydric soil: Water (W), Drummer silty clay loam (152A) Mapped non‐hydric soil: N/A Page 384 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 14 USGS 8‐Digit HUC: 07120004 Waters Type: Relatively Permanent Water (RPW) HGM Code: Riverine National Wetland Inventory Code: R2UBH USGS Topographic Map: Perennial River FEMA FIRM: Zone AE (Floodway) Is the stream classified as a BSS? No BSC Diversity Rating: None BSC Integrity rating: None Navigable Section 10: Yes Navigable Section 9: No 3.3 FARMED WETLAND DETERMINATION The closest Illinois station to the survey limits is the Joliet Station. According to the NRCS precipitation data for Joliet, the preferred “normal” year FSA slides are 1995, 1998, 2001 2002, and 2003. The preferred “wet” year FSA slide is 2000. The results of the FWD are summarized in Table 3‐2. The FSA slides are in Appendix E. Table 3–2 FWD Check Sheet Signature # of Signatures Present on Normal Year Slides Present on Wet Year Slide (Y/N) Mapped NWI/ADID (Y/N) Meets FWD Requirements* (Y/N) Met Wetland Criteria Site Number 1 5 Y N Y Y RP1 *The minimum requirement of three or more years of farmed wetland signatures on preferred “Normal Year” slides or two years of farmed wetland signatures if the signature is also depicted as a wetland on the NWI Map. Prior converted croplands1 are not considered WOUS (33 CFR Part 328). However, if the land changes to a non‐agricultural use, or is abandoned, according to the criteria established by the USACE and EPA, it may be regulated under the Section 404 of the CWA One signature (Signature #1) was identified on the FSA slides approximately 0.15 mile east of IL 59. Signature #1 is associated with a constructed stormwater feature (Retention Pond 1) and will not be considered a farmed wetland. No other signatures were identified. The results of the field investigation of wetlands identified by the FWD supersede the FWD. 1 “Wetland converted to cropland before December 23, 1985, and as of December 23, 1985, was capable of being cropped and did not meet farmed wetland hydrology criteria.” (USDA, 2010) Page 385 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 15 4.0 SUMMARY OF WETLAND INVESTIGATION Three wetlands (Sites 1, 2, and 3) and three WOUS (Sites W1, W2, and W3) were identified within the survey limits. Site 1 is a wet meadow, forested wetland, and marsh that directly abuts Sites W1, W2, and W3. Sites 2 and 3 are seasonal depressional wetlands. Site W1 is the West Norman Drain, a WOUS. Site W2 is the East Norman Drain, a WOUS. Site W3 is the DuPage River, a WOUS. Site 1 will be considered jurisdictional as it abuts Sites W1, W2, and W3. Sites 2 and 3 appears to be isolated. Sites W1, W2, and W3 all have a direct surface water connection to the Des Plaines River, a TNW and will be considered jurisdictional. Any work that includes dredge or fill of Sites 1 through 3 and Sites W1 through W3 or significantly alters drainage, may require a permit from the USACE and/or the Village. The USACE verifies jurisdictional wetlands and determines mitigation ratios. If any portion of this project is sponsored by a state agency, the project must comply with the Interagency Wetland Policy Act (IWPA). It is anticipated that this project is not funded by a state agency or receives state pass‐through funding. Impacts to Sites 1 through 3 and Sites W1 through W3 will be verified and finalized when the construction plans are developed prior to any permitting activities. Table 4‐1 summarizes the characteristics of Sites 1 through 3 and Table 4‐2 summarizes the characteristics of Sites W1 through W3. Page 386 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 16 Table 4‐1 Wetland Summary Site # Type1 Function2 Dominant Vegetation (all strata) FQI/ C‐Value Mapped Soil Type NWI Classification Isolated? (Y/N) 3 Acreage Within Survey Limits 1 Wet meadow F, C, T, S, E, WH Silver mapleReed canary grass Canadian clearweed White amaranth Yellow nutsedge Barnyard grass Witch grass 13.9/2.3 Elpaso silty clay loam (356A) Drummer silty clay loam (152A) Dunham silty clay loam (356A) Water (W) DuPage silt loam, occasionally flooded (8321A) PEM1A No 8.47 2 Seasonal depressional wetland F, T, S, WH Eastern cottonwoodWhite mulberry Common buckthorn Aster species Jumpseed 4.6/2.7 Graymont silt loam (541B) None Yes 0.03 3 Seasonal depressional wetland F, T, S, WH Eastern cottonwoodTatarian honeysuckle White mulberry 5.7/1.7 Orthents, loamy, undulating (802B) None Yes 0.002 1 Wetland type is listed by IDOT classification on wetland impact evaluation (WIE) forms. 2 F = flood control, C = conveyance, T = treatment of surface runoff, S = sediment and nutrient uptake, E = erosion control, WH = wildlife habitat. 3Isolated is based on professional judgment in the field. The USACE makes all final jurisdictional determinations. Isolated applies to the lack of hydrological connection to a “Waters of the U.S.”. Page 387 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 17 Table 4 – 2. WOUS Summary *Number assigned by H&H during wetland delineations. **N=Natural line impression, S=shelving, soil changes, D=destruction/lack of vegetation, L=litter or debris, E=extended inundation, O=other (provide explanation). *** RPW=Relatively Permanent Water. Site#* WOUS Name Flow Regime(Perennial, Intermittent, Ephemeral) Approx. Width (feet) Approx. Depth (inches) OHWM Indicator** Bank Vegetation NWI & USGS Topographic Map Classification Waters Type*** Acreage Within Survey Limits W1 West Norman Drain Perennial 20 8‐12 N, S, D, E, Silver maple Box elder PEM1Cx /Perennial Stream RPW 1.28 W2 East Norman Drain Perennial 15‐20 18‐24 N, S, D, E, Common buckthorn Tatarian honeysuckle PEM1Cx /Perennial Stream RPW 0.03 W3 DuPage River Perennial 80‐140 48‐60 N, S, D, E, L Reed canary grass R2UBH/ Perennial River RPW 1.96 Page 388 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 18 P 5.0 COORDINATION/PERMITS REQUIRED Avoidance of wetlands and WOUS should be considered in project planning. If avoidance is not possible, permits for impacts will be required. 5.1 PERMITTING AGENCIES Permits for wetland and WOUS impacts are issued through the Chicago District USACE, in Will County. The USACE regulates all wetlands connected to WOUS. WOUS are generally open water areas such as rivers and lakes including wetlands that are connected to navigable waterways and their tributaries. Wetlands and associated buffers that are classified as WOUS would be under the regulatory jurisdiction of the USACE, in compliance with Section 404 of the CWA. Impacts to WOUS will require permitting through the USACE. The USACE makes all final determinations of jurisdiction. Regional Permit Program A JD is required to establish the jurisdictional status of onsite wetlands. A JD request is initiated via the submittal of the wetland delineation report and JD Request Form(s), which must be signed by the property owner on which the wetland(s) in question lie(s). In addition to the submittal of a wetland delineation report and JD Request Form(s), a USACE approved jurisdictional summary spreadsheet (also known as the “Waters Upload”) may be submitted to the USACE as part of the JD process. The Waters Upload provides the acreage, geographic location, nearest local waterway, HGM Code, Cowardin Code, and Waters Type for each wetland and/or WOUS identified within the survey limits. The jurisdictional summary table (Waters Upload) is attached in Appendix D. The Supreme Court decision of January 2001 (known as Solid Waste Agency of Northern Cook County, SWANCC) reduced the USACE authority over wetlands to areas immediately adjacent to navigable waterbodies that include streams and their tributaries. This ruling has changed the regulatory status of some wetlands, mainly those considered isolated from jurisdictional WOUS. Additionally, in the Rapanos and Carabell decisions of 2005 (referred to as Rapanos), the Supreme Court established new standards by which the USACE can establish jurisdiction over a water body. On May 27, 2015, the EPA and the USACE finalized the CWR which clarifies protection of WOUS under the CWA. The CWR went into effect on August 28, 2015; however, the U.S. Court of Appeals for the Sixth Circuit issued a nationwide stay of the CWR on October 9, 2015 while the CWR is being challenged. The Chicago District of the USACE has a regional permit program meant to simplify and expedite specific types of projects. Most regional permits have automatically authorized Section 401 Water Quality Certification (WQC) from the IEPA. If the project does not qualify for a regional permit, an individual permit will be required. Individual permits require a public notice period as well as separate WQC from the IEPA. The individual permit process can take significantly more time than the regional permit process. Within the regional permit program, permits are classified as either Category I or Category II. Category I includes activities with minimal impacts requiring review by the USACE. Category II includes activities with minimal impacts requiring more rigorous review by the USACE and coordination with the resource agencies. Regional Permit 3 authorizes transportation projects, including roads, bridges, runways, and railroads. To meet the requirements of the regional permit, the impact to WOUS shall not exceed 0.25 acre for any single crossing and the cumulative impacts cannot exceed one acre. Page 389 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 19 P Projects that impact less than 0.5 acre of WOUS and do not impact High Quality Aquatic Resources (HQAR) qualify for a Category I RP. Projects that impact greater than 0.5 acre of WOUS or impact an HQAR qualify for a Category II RP. Additional specifications regarding best management practices, buffers, dewatering, and design are listed in the RP. The USACE defines HQARs as: The USACE defines HQARs as the following: “aquatic areas considered to be regionally critical due to their uniqueness, scarcity, and/or value, and other wetlands considered to perform functions important to the public interest, as defined in 33 CFR Part 320.4(b)(2). These resources include ADID sites, bogs, ephemeral pools, fens, forested wetlands, sedge meadows, wet meadows, seeps, streams rated Class A or B in the Illinois Biological Stream Characterization study, streamside marshes, wet prairies, wetlands supporting Federal or Illinois endangered or threatened species, and wetlands with a floristic quality index of 20 or greater or mean C‐value of 3.5 or greater. These areas are generally considered unsuitable for dredge or fill activities.” According to this definition, Sites 1 and W1 through W3 are not HQARs. Sites 2 and 3 are seasonal depressional wetlands with characteristics of ephemeral wetlands. However due to a lack of evidence supporting the classification of Sites 2 and 3 as ephemeral, Sites 2 and 3 will not be considered HQAR at this time. The permitting process for jurisdictional wetlands is initiated by the submittal of the Joint Application to the USACE. Once the application is submitted to the USACE, the USACE initiates coordination with the following agencies: U.S. Fish and Wildlife Service (FWS) Illinois Environmental Protection Agency (401 Water Quality Certification) Illinois Department of Natural Resources (IDNR) Illinois Department of Natural Resources/Office of Water Resources (IDNR/OWR) Illinois Historic Preservation Agency (IHPA) Several other agencies are involved in the permitting process through external reviews related to the natural resources of the wetland. The following summarizes additional requirements: Will County Land Use Department (WCLUD) The WCLUD regulates isolated wetlands, WOUS, and their associated wetland buffers under the Will County Stormwater Management Ordinance (WCSMO) within Will County. Communities within Will County either adopt and enforce the WCSMO or adopt and enforce a municipal ordinance that is consistent with and is at least as strict as the WCSMO regulations. Development activities that impact isolated wetlands and WOUS, and/or their associated buffers, regardless of USACE jurisdiction, must submit a Site Development Permit application to the WCLUD or municipality when said activities are within Will County. It should be noted that all existing roadside ditches, improvement to existing public roads, trail developments, and utility projects that are located in a public right‐of‐way (ROW) are exempt from buffer requirements. Page 390 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 20 P A Special Use Permit for floodplain development is required from the WCLUD if there are impacts below the base flood elevation. If fill is placed within a floodplain, compensatory storage is required at a 1.25:1 ratio. Typically, a Variance to the Stream and Wetland Protection Ordinance is required from the WCLUD for impacts to isolated wetlands; however, highway projects are exempt from this requirement. Village of Plainfield In addition to the requirements of the WCSMO, the Village has a Stream and Wetland Protection Ordinance (Ordinance #1749), which is referred to as the Plainfield Lowland Conservancy Overlay District Ordinance (Ordinance). This Ordinance requires the submittal of a Special Use Permit for any development within the Lowland Conservation Overlay District within the Village. The Ordinance requires a minimum setback of 75 feet away from the OHWM of streams, lakes and ponds, the edge of wetlands, or within a designated depressional area. In addition, a natural vegetation buffer strip is required for a minimum of 25 feet from the OHWM of streams, lakes and ponds, and the edge of wetlands. Environmental Class Action Determination (ECAD) The Environmental Class of Action Determination (ECAD) document was used in Illinois on highway projects which met the Categorical Exclusion (CE) definition (where a category of actions does not individually or cumulatively have a significant effect on the human environment where an Environmental Impact Statement [EIS] or Environmental Assessment [EA] is not required), but which historically have been processed with EA. The ECAD for the 143rd Street Extension project was updated as of March 2010. The project was determined to meet the CE definition contained in 23 CFR 771.117. Specifically, the project will not induce significant impacts to planned growth or land use for the area; will not require the relocation of significant numbers of people; will not have significant impact on any natural, cultural, recreational, historic, or other resource; will not involve significant air, noise, or water quality impacts; will not have significant impacts on travel patterns; and will not otherwise have any significant environmental impact. Several other agencies are involved in the permitting process through external reviews related to the natural resources of wetlands. The following summarizes additional requirements: 5.2 INTERAGENCY WETLAND POLICY ACT (IWPA) As the project is utilizing state or state pass through funding, the project will be required to meet the guidelines of the IWPA. All projects utilizing state or state pass through funding are required to mitigate for all wetland impacts, regardless of size, amount, or jurisdictional status. Additionally, the IWPA recognizes all wetlands and is not subject to the limitations on isolated wetlands that is the current policy of the USACE. 5.3 THREATENED AND ENDANGERED SPECIES Endangered species review is also required through the FWS and the IDNR for federal and state listed species, respectively. Endangered species surveys may be required, which can only be completed during certain portions of the year, depending on the species. Page 391 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 21 P The FWS no longer conducts project‐by‐project review upon request; rather, the applicant is required to conduct an assessment and determine if impacts to federally listed species will occur as a result of the proposed project. To conduct this review, applicants are required to conduct the FWS Section 7 Consultation and document their findings. Guidelines for the Section 7 Consultation process can be found on the FWS website. Endangered species review through the IDNR for state listed species is initiated through the Ecological Compliance Assessment Tool (EcoCAT) found on the IDNR website. During the development of the ECAD document, no threatened or endangered species were identified within the project limits. Due to the age of the ECAD document, this information will need to be updated. 5.4 ILLINOIS HISTORIC PRESERVATION AGENCY As part of the permitting process through the USACE and the WCLUD, the project must be reviewed by the Illinois Historic Preservation Agency (IHPA) if a portion of the land proposed for development is considered undeveloped. This agency may require a Phase 1 archeological survey to determine the potential impact to archeological resources prior to approving the project. A qualified archeological firm will be required to conduct this study if required. This agency’s approval must be obtained prior to obtaining the final Section 404 permit. During the development of the ECAD document, no historic or archeological resources were identified within the project limits. Due to the age of the ECAD document, this information will need to be updated. 5.5 NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEM (NPDES) PERMIT If the one‐acre soil disturbance threshold is exceeded, an NPDES permit will be required. Final determination on this item will need to be addressed prior to construction commencement. 5.6 FARMED WETLAND DETERMINATION Current guidance indicates the NRCS is no longer conducting farmed wetland determinations. The project area includes agricultural land. Therefore, a farmed wetland determination was completed. The farmed wetland determination is presented in Sections 2.6 and 3.3, and Appendix E. 5.7 COASTAL ZONE MANAGEMENT AREAS This project is not located within an Illinois Coastal Zone as identified by the IDNR. Through the Section 404 permitting process, the ICMP will be taken into account by the reviewing agencies. A separate permit will not be required for the ICMP. Page 392 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 22 P 6.0 MITIGATION OF WETLAND IMPACTS Current wetland regulations require a sequencing of options concerning the development of wetlands. These options need to be addressed concerning the potential or possible development of existing wetlands. These options are: avoidance, minimization, and mitigation. USACE Mitigation will be required if the wetlands and waterways are considered jurisdictional under the Section 404 program. If impacts are less than 0.10 acre, mitigation through the USACE may not be required. If impacts are greater than 0.10 acre, it is anticipated that a mitigation ratio of 1.5:1 will be required for WOUS impacts. IWPA As the project is utilizing state or state pass through funds, the project must comply with the IWPA. Under the IWPA, all impacts to wetlands regardless of size must be mitigated within the affected drainage basin or within one mile of the proposed survey limits. Although USACE would allow for other mitigation options, the IWPA does not. On‐site, in‐basin mitigation is preferred, but wetland banking can be utilized. The IWPA is regulated by the IDNR. Table 6‐1 summarizes the mitigation ratios required under the IWPA. Table 6–1 IWPA Mitigation Ratios Degree of Adverse Impact Location of the Replacement Wetland Onsite Offsite Out‐of‐Basin Minimal Alteration 1.0:1 1.5:1 1.5:1 2.0:1 Significant Alteration 1.5:1 2.0:1 3.0:1 Destruction 2.5:1 4.0:1 5.5:1 The IWPA defines “minimal alteration” as an adverse wetland impact that: meets the criteria to be defined as a programmatic action; or causes the removal or loss of 0.5 acre or less of wetland vegetation but that does not alter the preexisting hydrology of the wetland for a period of more than 12 months. The IWPA defines “significant alteration” as an adverse wetland impact that does not meet the criteria to be defined as a programmatic action and that causes either: the removal or loss of more than 0.5 acre but less than two acres of wetland vegetation but that does not alter the preexisting hydrology of the wetland for a period of more than 12 months; or the alteration of preexisting hydrology or soils of 0.5 acre or less of a wetland for more than 12 months. This includes, but is not limited to the placement of dredge or fill material into a wetland, the drainage of a wetland, filling in of a wetland through sedimentation, etc. Page 393 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 23 P The IWPA defines “destruction” as an adverse wetland impact that does not meet the criteria to be defined as a programmatic action and that causes either: the removal or loss of two or more acres of wetland vegetation; or the alteration of preexisting hydrology or soils of more than 0.5 acre of a wetland for more than 12 months. This includes, but is not limited to, the placement of dredge or fill material into a wetland, the drainage of a wetland, filling in of a wetland through sedimentation, etc. “Programmatic Actions” are those actions as defined by the IDOT Action Plan, which involve impacts to wetlands only in areas where construction is within existing rights‐of‐way (ROW) or in new ROW which is contiguous to (i.e., does not separate from) the existing ROW and for which there is no practicable alternative which would avoid adverse wetlands impacts. Examples of project types that could qualify as Programmatic Actions if they meet the preceding criteria include, but are not limited to, the following: adding through or auxiliary lanes to an existing highway, widening and resurfacing existing pavements, widening shoulders on an existing highway, realigning an existing intersection, reconstructing or replacing an existing bridge, constructing runaround detours or temporary stream crossings, and installing scour countermeasures (e.g., flexible revetment, rigid revetment, or flow control structures) for existing bridges. As the project is utilizing state funding, the project is subject to the Illinois Department of Transportation’s (IDOT) Action Plan. Mitigation Methods There are currently mitigation methods by which mitigation criteria can be met: 1) the use of a wetland bank, or 2) new wetland construction. As discussed above, avoidance of the wetlands is preferable; however, this may not be practical for all jurisdictional sites. Wetland banking is typically the best way to provide mitigation for wetland impacts. The creation of small isolated mitigated wetlands does not replace the functions of wetlands as well as a large scale wetland bank. In many cases, the regulatory community prefers the use of wetland banks to mitigate impacts. The most recent Interagency Coordination Agreement (ICA) states that wetland banking is the preferred mitigation option. Will County Will County defers to the USACE regarding mitigation for USACE jurisdictional wetlands and WOUS. Mitigation for impacts to USACE jurisdictional wetlands and WOUS is administered by the USACE RP, as discussed above. For Isolated Waters of Will County mitigation is required for all impacts to HQARs greater than 0.10 acre and impacts greater than 0.25 acre for non‐HQAR Isolated Waters of Will County. Mitigation ratios for impacts to Isolated Waters of Will County should provide for the replacement of the lost wetland at the following ratios: 1.5:1 for impacts to non‐HQAR wetlands 3:1 for impacts to HQAR wetlands 6:1 for impacts to Forested or Fen HQAR wetlands 1:1 for impacts to open waters that are not HQAR Page 394 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 24 P Mitigation for impacts to Isolated Waters of Will County is required to occur in Will County. Mitigation is required to use the following hierarchy with on‐site mitigation preferred. Allowance to the next lower step is permitted only when justified through sequencing specified or when the higher step is not available: On‐site wetland mitigation meeting the requirements of the WCSMO; In the same watershed as wetland impact in a Will County approved Wetland Mitigation Bank, Will County Forest Preserve District Wetland Restoration Funds. This mitigation option may only be used for wetland impacts where there are no available mitigation credits within the County. A USACE approved Wetland Mitigation Bank. Village of Plainfield The Village must enforce the minimum mitigation requirements of the WCSMO (see above). During the engineering permit review process, isolated wetlands and mitigation ratios are evaluated on a case by case basis by the Village of Plainfield planning department. The Village has the authority to require higher mitigation ratios for isolated wetlands. The IWPA does not accept fee‐in‐lieu for wetland mitigation. Page 395 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 25 P 7.0 LIMITATIONS AND EXCEPTIONS The wetland delineation detailed in this report was performed in accordance with accepted methods and practices of the “USACE Midwest Region Manual” (USACE, 2010). The scope and depth of this study are consistent with H&H representations, and have been agreed to by the Village of Plainfield (Village) and Crawford, Murphy, and Tilley, Inc. (CMT). The following limitations and exceptions apply: This document has been prepared specifically for the Village and CMT by H&H. No additional party other than the Village or CMT may use the information contained in this document without written permission from the Village and CMT and H&H. This document must be read and interpreted as a whole. Specific individual sections of this document are dependent upon the balance of this document, and upon terms, conditions, and stipulations contained in the associated proposal and any written amendments thereto accepted by H&H. This document is time sensitive in the fact that the field delineations are only acceptable for a maximum of five years, and in some states and counties with local ordinances, a shorter time frame than five years. Page 396 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 26 P REFERENCES Cowardin, L.M., V. Carter, F.C. Golet, and E.T. LaRoe. “Classification of Wetlands and Deepwater Habitats of the United States,” U.S. Department of Interior, Fish and Wildlife Service, Washington, DC. 131. 1979. Federal Emergency Management Agency. Flood Insurance Rate Map, Will County, Illinois. 2003. Federal Register. “40 CFR Part 230: Section 404(b)(1) Guidelines for Specification of Disposal Sites for Dredged or Fill Material,” U.S. Government Printing Office, Washington, DC, 45(249), 85, 352‐85, 353. 1980. Federal Register. “Title 33: Navigation and Navigable Waters; Chapter 2. Regulatory Programs of the Corps of Engineers,” U.S. Government Printing Office, Washington, DC, 47(138), 31, 810. 1982. Herman, B., Sliwinski, R. and S. Whitaker. 2013. Chicago Region FQA (Floristic Quality Assessment) Calculator. U.S. Army Corps of Engineers, Chicago, IL. Illinois Department of Natural Resources (IDNR), 2008. Integrating Multiple Taxa in a Biological Stream Rating System. Accessed 8/26/16.http://www.dnr.illinois.gov/conservation/BiologicalStreamratings/Pages/default.aspx. Illinois Environmental Protection Agency (IEPA) Bureau of Water, 2016. Illinois Integrated Water Quality Report and Section 303(d) List, 2016. Clean Water Act Sections 303(d), 305(b) and 314, Water Resource Assessment Information and List of Impaired Waters, Volume I: Surface Water. February, 2016. http://www.epa.state.il.us/water/tmdl/303d‐list.html. Accessed 08/26/2016. Lichvar, R.W., D.L. Banks, W.N. Kirchner and N.C. Melvin, 2016. The National Wetland Plant List: 2016 wetland ratings. Phytoneuron 2016‐30: 1‐17. (http://wetland‐plants.usace.army.mil/) U.S. Army Corps of Engineers, Engineer Research and Development Center, Cold Regions Research and Engineering Laboratory, Hanover, NH, and BONAP, Chapel Hill, NC. (Accessed 8/26/2016). Reed, P.B. National List of Plant Species that Occur in Wetlands, North Central Region. U.S. Fish and Wildlife Service, Washington D.C., 1988. Soil Survey Staff, Natural Resources Conservation Service, United States Department of Agriculture. Web Soil Survey. http://websoilsurvey.nrcs.usda.gov/ Accessed 08/26/2016. Swink, Floyd and Gerould Wilhelm. Plants of the Chicago Region. 4th ed. Indianapolis: Indiana Academy of Science, 1994. U.S. Army Corps of Engineers. Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Midwest Region (2010 USACE Midwest Region Manual), Environmental Laboratory, Department of the Army, 2010. U.S. Army Corps of Engineers. Technical Report Y‐87‐2, Corps of Engineers Wetlands Delineation Manual, Environmental Laboratory, Department of the Army, 1988. U.S. Army Corps of Engineers. U.S. Army Corps of Engineers Jurisdictional Determination Form Instructional Guidebook, Environmental Laboratory, Department of the Army, 2007. Page 397 October 2016 Wetland and WOUS Investigation 143rd Street Extension 81.0220102.05 Page | 27 P U.S. Department of Agriculture, Natural Resource Conservation Service, List of Hydric Soils, Washington D.C., December 2015. http://www.nrcs.usda.gov/wps/portal/nrcs/main/soils/use/hydric/. Accessed 8/26/2016. U.S. Department of Agriculture, Natural Resource Conservation Service, National Food Security Act Manual, Washington D.C., September, 1998. U.S. Environmental Protection Agency (USEPA), 2015. Clean Water Rule: Definition of “Waters of the United States”. 40 CFR Parts 110, 112, 116, 117, 122, 230, 300, 302 and 401. U.S. Department of Agriculture, Natural Resources Conservation Service. Technical Note No. 190‐8‐76. Hydrogeomorphic Wetland Classification System: An Overview and Modification to Better Meet the Needs of the Natural Resources Conservation Service, February 1998. U.S. Fish and Wildlife Service. August 4, 2008. National Wetlands Inventory website. U.S. Department of the Interior, Fish and Wildlife Service, Washington, D.C. http://www.fws.gov/nwi/. Accessed 8/26/2016. Normantown and Plainfield, Illinois Quadrangles. U.S. Department of the Interior, Geological Survey. 7.5 minute topographic map. Normantown and Plainfield, Illinois Quadrangles. U.S.G.S. 1983. Quaternary Geologic Map of the Chicago 4x6 Quadrangle, United States, Map I‐1420 (NK‐16). Village of Plainfield. July 18, 1988. General Ordinances of the Village. https://www.municode.com/library/il/plainfield/codes/code_of_ordinances?nodeId=COOR_CH7PLDE Will County Stormwater management Planning Committee. July 1, 2004. Will County Stormwater Management Ordinance. Revised March 25, 2010. Young, Dick. Kane County Wild Plants and Natural Areas. Kane County Forest Preserve District. Geneva, Illinois. 1994. Page 398 Appendix A – Figures Page 399 126 £¤30 ¬«59 Van Dyke RdLockport St Renwick Rd 13 5 th St US-3014 3 rd St Plainfield-Naperville RdP l a i n fi e l d Rd Figure 1 Site Location Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois - Huff & Huff, Inc.Huff & Huff, Inc.Huff & Huff, Inc.Huff & Huff, Inc. Topo Source: INHS/USGS 7.5-minute DRG, Normantown and Plainfield 1:24,000 Quadrangles, 1998 0 4,0002,000 Feet Legend Survey Limits J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_SLM.mxd Page 400 vv Joseph Hillcrest 541e-2 54162 22362 8321A r' -"malt f4.14 8321A 8321A cVvo 9362 2906 31862 'it; All FIE Copper it '14 Pennington ,_ • G9 "- V o 0. CD 290d* too 9362 t43rd St 0 500 Aerial Source: ESRI Online World Imagery Feet Data Source: U.S. Department of Agriculture Natural Resource Conservation Service Soil Survey for Will County Legend Survey Limits CZ Soil Survey 1,000 W N Huff & Huff, Inc. Figure 2 Soil Survey Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois 126¬«59L1UBHxPFO1AL1UBHxR2UBHPFO1APFO1APEM1APFO1APFO1AL1UBHxL1UBHxL1UBHxL1UBHxL1UBHxL1UBHxPUBGxMain StPlainfield-Naperville Rd143rd StPlainfield Rd143rd StPEM1AL1UBHxPFO1APFO1APFO1CPFO1APSS1CPEM1CxPFO1APFO1AL1UBHxPEM1CxPUBGxL1UBHxPFO1AL1UBHR5UBHPEM1CxPUBGxR5UBHR5UBHR5UBHR5UBHR5UBHR5UBHR5UBHFigure 3National Wetlands Inventory Map143rd Street ExtensionIllinois Route 59 to Illinois Route 126Plainfield, Unincorporated Will County, Illinois-Huff & Huff, Inc.Huff & Huff, Inc.Huff & Huff, Inc.Huff & Huff, Inc.NWI Source: U.S. Fish & Wildlife Service, State of IllinoisTopo Source: INHS/USGS 7.5-minute DRG, Normantown and Plainfield 1:24,000 Quadrangles, 199801,000500FeetLegendSurvey Limits J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_NWI.mxdPage 402 Figure 4 Flood Insurance Rate Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois J'\S1 0220102 05 CMT 143rd Street\Fgumr f IT_ 14 W3WOUS: 1.96+ acres Site 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acresSite 1Wetland: 8.47+ acres W1WOUS: 1.28+ acresW1WOUS: 1.28+ acresW1WOUS: 1.28+ acres W2WOUS: 0.03+ acreSite 2Wetland: 0.03+ acre £¤30 W3-1 W2-1 W1-1 DP2-2 DP2-1 DP1-9 DP1-8 DP1-7 DP1-6 DP1-5 DP1-4 DP1-3 DP1-1 DP11-1 DP10-1 DP 1-2 143rd St Figure 5.1 Wetlands and WOUS Location Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois - Huff & Huff, Inc. Aerial Source: ESRI Online World Imagery 0 300150 Feet Legend Survey Limits Data Point Gully WOUS Wetland J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_WLM.mxd Sheet 1 Sheet 2 Page 404 Site 3Wetland: 0.002+ acre DP3-2 DP3-1 Main StCopper 143rd StPlainfield RdGolden LnPennington Ln Figure 5.2 Wetlands and WOUS Location Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois - Huff & Huff, Inc. Aerial Source: ESRI Online World Imagery 0 300150 Feet Legend Survey Limits Data Point Gully WOUS Wetland J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_WLM.mxd Sheet 1 Sheet 2 Page 405 Pond 1 RP1 RD2 RD1 £¤30 RDDP2-1 RDDP1-1 RPDP1-1 143rd St Figure 6.1 Stormwater Features Location Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois - Huff & Huff, Inc. Aerial Source: ESRI Online World Imagery 0 300150 Feet Legend Survey Limits Data Point Pond Mining Pond Retention Pond Roadside Ditch J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_SWLM.mxd Sheet 1 Sheet 2 Page 406 Mining Pond 4 Mining Pond 3 RP2 Mining Pond 2 Mining Pond 1 RPDP2-1 Main StCopper 143rd StPlainfield RdGolden LnFigure 6.2 Stormwater Features Location Map 143rd Street Extension Illinois Route 59 to Illinois Route 126 Plainfield, Unincorporated Will County, Illinois - Huff & Huff, Inc. Aerial Source: ESRI Online World Imagery 0 300150 Feet Legend Survey Limits Data Point Pond Mining Pond Retention Pond Roadside Ditch J:\81.0220102.05 CMT 143rd Street\Figures\CMT_143rd_St_SWLM.mxd Sheet 1 Sheet 2 Page 407 Appendix B – Datasheets and FQI Page 408 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 X Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 75 YPhalaris arundinacea 0 FACW Site 1 Site 1 is a wet meadow, forested wetland, and marsh associated with the West Norman Drain (Site W1), East Norman Drain (Site W2), and DuPage River (Site W3). Data Point 1-1 was taken in the meadow. Y If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-1Illinois None , or hydrology , or hydrology -88.199235 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 6/8/2016 S3, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 PEM1A Local relief (concave, convex, none):Terrace 0 Lat:Long: Applicant/Owner: Dominant Species Indicator Status None Y (If needed, explain any answers in remarks.) Hydrophytic vegetation was confirmed by the Rapid Test for Hydrophytic Vegetation. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 1 1 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 100% Hydrophytic vegetation present? 30 ft. x 30 ft. 77 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 N OBL Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. 2Persicaria amphibia Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y Y Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Drummer silty clay loam, 0 to 2 percent slopes (152A) State: 41.622967 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 409 X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) X X Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) M Clay *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) 13-16 10YR 2/1 90 5YR 3/4 5 C Histosol (A1) Histic Epipedon (A2) Site 1 receives surface water from adjacent uplands and impervious surfaces. One primary and three secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Drummer silty clay loam (152A), which is listed as a hydric soil in outwash plains and depressions in Will County. Redox Dark Surface (F6) confirmed hydric soil. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 10YR 4/4 5 C M 7-13 10YR 2/1 90 5YR 3/4 10 C M Silty clay 0-7 10YR 2/1 80 5YR 3/4 20 C M Silty clay with roots Sampling Point:1-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 410 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Plainfield/WillCity/ County: FAC (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Drummer silty clay loam, 0 to 2 percent slopes (125A) State: 41.623121 N VEGETATION -- Use scientific names of plants. Absolute % Cover Cirsium arvense Carex cephalophora (Plot size: 5 ft. x 5 ft. NPastinaca sativa 5 N Phalaris arundinacea 10 30Solidago altissima 2 FACU N FACU UPL N FACW Y FACU Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) Vitis riparia Problematic hydrophytic vegetation* (explain) N (Plot size: FACW 2 N No indicators of hydrophytic vegetation were present at the time of the site visit. The crabapple species (Malus sp.) could not be identified at the time of the site visit; however, it would not change the hydrophytic vegetation determination as all crabapple species in the Chicago region are considered upland species. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 2 4 1 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic Asclepias syriaca 25% 5 N 5 FACU Hydrophytic vegetation present? 2 30 ft. x 30 ft. 87 Local relief (concave, convex, none):Hillslope 10 Lat:Long: Applicant/Owner: FAC UNK 5 Rhamnus cathartica 10 Y Dominant Species Indicator Status Malus sp. N WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-2Illinois Concave , or hydrology , or hydrology -88.199792 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 6/8/2016 S10, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None (If needed, explain any answers in remarks.) Data Point 1-2 is an upland located adjacent to Sites 1 and W1. N If yes, optional wetland site ID: Prunus serotina 2 N FACU Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 30 YBromus inermis 17 N Cornus racemosa Y FACU 2 US Army Corps of Engineers Midwest RegionPage 411 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) Sampling Point:1-2 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-10 10YR 3/2 60 Silt loam Mixed Matrix 10YR 5/6 40 Sandy loam Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Drummer silty clay loam (125A), which is listed as a hydric soil in outwash plains and depressions in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. Rocks were encountered at 10 inches below the soil surface. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 10 Rocks Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) >10 Shovel refusal Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 412 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) 65 YPhalaris arundinacea 5 Acer negundo FACW (If needed, explain any answers in remarks.) Data Point 1-3 is an upland located adjacent to Sites 1 and W1. N If yes, optional wetland site ID: FAC Acer saccharinum 60 Y FACW Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-3Illinois None , or hydrology , or hydrology -88.202006 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 6/8/2016 S10, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None Local relief (concave, convex, none):Terrace 0 Lat:Long: Applicant/Owner: UPL5 Y Dominant Species Indicator Status 5 N Ribes missouriense N Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 65 3 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 67% Hydrophytic vegetation present? 30 ft. x 30 ft. 85 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 N FACW N FAC Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Urtica dioica 5 15Alliaria petiolata Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Dunham silty clay loam, 0 to 2 percent slopes (523A) State: 41.622501 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 413 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) M Loam *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) 14-18 10YR 3/1 95 10YR 6/2 5 D Histosol (A1) Histic Epipedon (A2) Surface water flows from this area into adjacent wetlands. No primary and one secondary indicator of wetland hydrology was present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Dunham silty clay loam (523A), which is listed as a hydric soil in outwash plains and ground moraines in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 10-14 10YR 3/1 98 10YR 6/2 2 D M Loam with roots 0-10 10YR 3/1 100 Sandy clay loam with roots Sampling Point:1-3 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 414 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s):Huff & Huff, Inc. (N. Pisula) Orthents, loamy, rolling (802D) State: 41.622452 Y VEGETATION -- Use scientific names of plants. Absolute % Cover (Plot size: 5 ft. x 5 ft. 5Parthenocissus inserta Y FACU Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 N Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 70 4 3 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 75% Hydrophytic vegetation present? 30 ft. x 30 ft. 10 Local relief (concave, convex, none):Berm 10 Lat:Long: Applicant/Owner: FACRhamnus cathartica 20 Y Dominant Species Indicator Status N (If needed, explain any answers in remarks.) WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-4Illinois Concave , or hydrology , or hydrology -88.200726 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 9/9/2016 S10, T36N, R9E Data Point 1-4 is an upland located adjacent to Site 1. N If yes, optional wetland site ID: Morus alba 70 Y FAC Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 None 5 YRhamnus cathartica 20 Tree Stratum (Plot size: FAC US Army Corps of Engineers Midwest RegionPage 415 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) Sampling Point:1-4 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-12 10YR 3/2 100 Silty clay loam >12 Shovel refusal Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Orthents, loamy, rolling (802D), which is not on the hydric soil list for Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. A dense root system was encountered at 12 inches below the soil surface. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 12 Dense Root System Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 416 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 X Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 85 YPilea pumila 0 FACW Site 1 Site 1 is a wet meadow, forested wetland, and marsh associated with the West Norman Drain (Site W1), East Norman Drain (Site W2), and DuPage River (Site W3). Data Point 1-5 was taken in the forested wetland. Y If yes, optional wetland site ID: Acer saccharinum 90 Y FACW WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-5Illinois None , or hydrology , or hydrology -88.200845 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 9/9/2016 S10, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None Local relief (concave, convex, none):Flat in depression 0 Lat:Long: Applicant/Owner: Dominant Species Indicator Status None Y (If needed, explain any answers in remarks.) Hydrophytic vegetation was confirmed by the Rapid Test for Hydrophytic Vegetation. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 90 2 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 100% Hydrophytic vegetation present? 30 ft. x 30 ft. 95 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 N FACU Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. 10Glechoma hederacea Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y Y Investigator(s):Huff & Huff, Inc. (N. Pisula) Orthents, loamy, rolling (802D) State: 41.622438 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 417 X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) X Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Site 1 receives surface water from adjacent uplands and impervious surfaces. One primary and two secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Orthents, loamy, rolling (802D) which is not on the hydric soil list for Will County. Depleted Dark Surface (F7) confirmed hydric soil. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 0-16 10YR 2/1 90 10YR 6/2 10 D M Silty clay loam Sampling Point:1-5 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 418 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) UPL Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 None 80 YGlycine max 0 Tree Stratum (Plot size: If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region No Sampling Point: 1-6Illinois Concave , or hydrology , or hydrology -88.205731 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 X Sampling Date: 9/9/2016 S9, T36N, R9E Local relief (concave, convex, none):Hillslope 10 Lat:Long: Applicant/Owner: None Dominant Species Indicator Status N (If needed, explain any answers in remarks.) Data Point 1-6 is an upland located adjacent to Site 1. The soil is disturbed by recent tilling. N Hydrophytic vegetation was not confirmed at the time of the site visit. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 1 0 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 0% Hydrophytic vegetation present? 30 ft. x 30 ft. 80 None Problematic hydrophytic vegetation* (explain) N (Plot size: 0 N Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s):Huff & Huff, Inc. (N. Pisula) Dunham silty clay loam, 0 to 2 percent slopes (523A) State: 41.622418 N VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 419 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) >18 Shovel refusal Histosol (A1) Histic Epipedon (A2) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Dunham silty clay loam (523A), which is listed as a hydric soil in outwash plains, ground moraines, and swales in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. Compacted clay was encountered at 18 inches below the soil surface. The soil is disturbed by recent tilling. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 18 Compacted Clay Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 8-18 10YR 2/1 95 10YR 5/1 5 D M Silty clay 0-8 10YR 2/1 98 10YR 5/1 2 D M Silty clay loam Sampling Point:1-6 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 420 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) FACW Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 30 YAmaranthus albus 0 FACU Site 1 Site 1 is a wet meadow, forested wetland, and marsh associated with the West Norman Drain (Site W1), East Norman Drain (Site W2), and DuPage River (Site W3). Data Point 1-7 was taken at the edge of the wet meadow and actively farmed agricultural land. Y If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-7Illinois None , or hydrology , or hydrology -88.203446 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 9/9/2016 S10, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None Local relief (concave, convex, none):Toe slope 0 Lat:Long: Applicant/Owner: Dominant Species Indicator Status None Y (If needed, explain any answers in remarks.) Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 3 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 67% Hydrophytic vegetation present? 30 ft. x 30 ft. None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 Y FAC Y FACW 65 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. NPhalaris arundinacea 5 Panicum capillare 15 15Echinochloa crus-galli Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y Y Investigator(s):Huff & Huff, Inc. (N. Pisula) Dunham silty clay loam, 0 to 2 percent slopes (523A) State: 41.621867 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 421 X Aquatic Fauna (B13) True Aquatic Plants (B14) X Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Site 1 receives surface water from adjacent uplands and impervious surfaces. Two primary and one secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes 12 (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes X NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes X No Depth (inches):14 Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Dunham silty clay loam (523A), which is listed as a hydric soil in outwash plains and ground moraines in Will County. Depleted Dark Surface (F7) confirmed hydric soil. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 12-18 10YR 3/1 90 10YR 5/1 10 D M Silty clay loam 0-12 10YR 3/1 80 10YR 5/1 20 D M Silty clay loam with roots Sampling Point:1-7 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 422 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) UPL Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 None 70 YGlycine max 0 Tree Stratum (Plot size: If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-8Illinois None , or hydrology , or hydrology -88.205731 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 9/9/2016 S9, T36N, R9E Local relief (concave, convex, none):Hillslope 10 Lat:Long: Applicant/Owner: None Dominant Species Indicator Status N (If needed, explain any answers in remarks.) Data Point 1-8 is an upland located adjacent to Site 1. N Hydrophytic vegetation was not confirmed at the time of the site visit. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 1 0 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 0% Hydrophytic vegetation present? 30 ft. x 30 ft. 70 None Problematic hydrophytic vegetation* (explain) N (Plot size: 0 N Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s):Huff & Huff, Inc. (N. Pisula) Graymont silt loam, 2 to 5 percent slopes (541B) State: 41.622418 N VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 423 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Graymont silt loam (541B), which has hydric inclusions in end moraines in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. Compacted clay was encountered at 17 inches below the soil surface. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 17 Compacted Clay Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) >17 Shovel refusal 0-17 10YR 2/1 95 10YR 5/1 5 D M Silt loam Sampling Point:1-8 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 424 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y Y Investigator(s):Huff & Huff, Inc. (N. Pisula) Graymont silt loam, 2 to 5 percent slopes (541B) State: 41.622438 Y VEGETATION -- Use scientific names of plants. Absolute % Cover (Plot size: 5 ft. x 5 ft. Echinochloa crus-galli 20 25Amaranthus albus Y FACW Y FACU 70 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 Y (If needed, explain any answers in remarks.) Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 3 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 67% Hydrophytic vegetation present? 30 ft. x 30 ft. None Local relief (concave, convex, none):Flat in depression 0 Lat:Long: Applicant/Owner: Dominant Species Indicator Status None WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 1-9Illinois None , or hydrology , or hydrology -88.205645 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 9/9/2016 S9, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 Site 1 Site 1 is a wet meadow, forested wetland, and marsh associated with the West Norman Drain (Site W1), East Norman Drain (Site W2), and DuPage River (Site W3). Data Point 1-9 was taken at the edge of the wet meadow. Y If yes, optional wetland site ID: None Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 25 YCyperus esculentus 0 FACW US Army Corps of Engineers Midwest RegionPage 425 X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) X Presence of Reduced Iron (C4) X X X Sampling Point:1-9 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-9 10YR 2/1 90 10YR 5/2 10 D M Silty clay 9-15 10YR 2/1 85 10YR 5/2 15 D M Silty clay Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Graymont silt loam (541B), which is has hydric inclusions in end moraines in Will County. Depleted Dark Surface (F7) confirmed hydric soil. Compacted clay was encountered at 15 inches below the soil surface. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 15 Compacted Clay Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Site 1 receives surface water from adjacent uplands and impervious surfaces. One primary and three secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) >15 Shovel refusal Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 426 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) FACU Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 None 45 YSolidago altissima 0 Tree Stratum (Plot size: If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region No Sampling Point: 1-10Illinois None , or hydrology , or hydrology -88.205158 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 X Sampling Date: 9/9/2016 S9, T36N, R9E Local relief (concave, convex, none):Terrace 0 Lat:Long: Applicant/Owner: None Dominant Species Indicator Status N (If needed, explain any answers in remarks.) Data Point 1-10 is an upland located adjacent to Site 1. The soil appears to have been disturbed in the past by construction. N Hydrophytic vegetation was not confirmed at the time of the site visit. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 2 1 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 50% Hydrophytic vegetation present? 30 ft. x 30 ft. 95 None Problematic hydrophytic vegetation* (explain) N (Plot size: 0 N N UPL Y FAC Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Daucus carota 10 40Eupatorium serotinum Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s):Huff & Huff, Inc. (N. Pisula) Elpaso silty clay loam, 0 to 2 percent slopes (356A) State: 41.622355 N VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 427 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) 10YR 6/4 40 Histosol (A1) Histic Epipedon (A2) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Elpaso silty clay loam (356A), which is listed as a hydric soil in till plains and depressions in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. Rocks were encountered at 14 inches below the soil surface. The soil appears to have been disturbed in the past by construction. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 14 Rocks Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) >14 Shovel refusal 4-14 10YR 3/1 55 10YR 5/2 5 D M Silty clay loam with pebbles 0-4 10YR 3/1 95 10YR 5/2 5 D M Silty clay loam with roots Sampling Point:1-10 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 428 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 X Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Is the sampled area within a wetland? 30 ft. x 30 ft.Tree Stratum (Plot size: 100 YPhalaris arundinacea 0 FACW Site 1 Site 1 is a wet meadow, forested wetland, and marsh associated with the West Norman Drain (Site W1), East Norman Drain (Site W2), and DuPage River (Site W3). Data Point 1-11 was taken within the wet meadow. The soil appears to have been disturbed in the past due to construction. Y If yes, optional wetland site ID: None WETLAND DETERMINATION DATA FORM - Midwest Region No Sampling Point: 1-11Illinois None , or hydrology , or hydrology -88.205227 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 X Sampling Date: 9/9/2016 S9, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None Local relief (concave, convex, none):Flat in depression 0 Lat:Long: Applicant/Owner: Dominant Species Indicator Status None Y (If needed, explain any answers in remarks.) Hydrophytic vegetation was confirmed by the Rapid Test for Hydrophytic Vegetation. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 1 1 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 100% Hydrophytic vegetation present? 30 ft. x 30 ft. None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 100 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y Y Investigator(s):Huff & Huff, Inc. (N. Pisula) Elpaso silty clay loam, 0 to 2 percent slopes (356A) State: 41.622394 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 429 X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) M Silty clay loam with pebbles *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) 8-11 10YR 4/1 90 10YR 6/6 5 C Histosol (A1) Histic Epipedon (A2) >15 MD Site 1 receives surface water from adjacent uplands and impervious surfaces. No primary and two secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) 11-15 10YR 4/1 80 10YR 6/6 10 C M Silty clay loam with pebbles Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Shovel refusal Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Elpaso silty clay loam (356A), which is listed as a hydric soil in till plains and depressions in Will County. Depleted Matrix (F3) confirmed the presence of hydric soil. Pebbles were encountered at eight inches below the soil surface. Rock was encountered at 15 inches below the soil surface. The soil appears to have been disturbed in the past due to construction. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 15 Rock Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 10YR 5/2 10 10YR 5/2 5 D M 10YR 5/2 5 D M 0-8 10YR 4/1 90 10YR 6/6 5 C M Silty clay loam with roots Sampling Point:1-11 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 430 SITE:1 LOCALE:143rd Street, Plainfield, IL BY:H&H (N. Pisula and L. Herrera) NOTES: CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)2.34 SPECIES RICHNESS (ALL)56 MEAN C (ALL SPECIES)1.46 SPECIES RICHNESS (NATIVE)35 MEAN C (NATIVE TREES)2.00 % NON-NATIVE 0.38 MEAN C (NATIVE SHRUBS)2.33 WET INDICATOR (ALL)-0.13 MEAN C (NATIVE HERBACEOUS)2.48 WET INDICATOR (NATIVE)-0.51 FQAI (NATIVE SPECIES)13.86 % HYDROPHYTE (MIDWEST)0.66 FQAI (ALL SPECIES)10.96 % NATIVE PERENNIAL 0.52 ADJUSTED FQAI 18.52 % NATIVE ANNUAL 0.11 % C VALUE 0 0.48 % ANNUAL 0.14 % C VALUE 1-3 0.36 % PERENNIAL 0.79 % C VALUE 4-6 0.16 % C VALUE 7-10 0.00 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC) HABIT DURATION NATIVITY aceneg Acer negundo Acer negundo var. violaceum Ash-Leaf Maple 0 FAC FAC 0 Tree Perennial Native acesai Acer saccharinum Acer saccharinum Silver Maple 0 FACW FACW -1 Tree Perennial Native allpet Alliaria petiolata ALLIARIA PETIOLATA Garlic-Mustard 0 FAC FACU 0 Forb Biennial Adventive amaalb Amaranthus albus AMARANTHU S ALBUS Tumbleweed 0 FACU FACU 1 Forb Annual Adventive arcmin Arctium minus ARCTIUM MINUS Lesser Burrdock 0 FACU FACU 1 Forb Biennial Adventive ascsyr Asclepias syriaca Asclepias syriaca Common Milkweed 0 FACU UPL 1 Forb Perennial Native barvul Barbarea vulgaris BARBAREA VULGARIS Garden Yellow- Rocket 0 FAC FAC 0 Forb Biennial Adventive broine Bromus inermis BROMUS INERMIS Smooth Brome 0 FACU UPL 1 Grass Perennial Adventive consep Calystegia sepium Convolvulus sepium Hedge False Bindweed 1 FAC FAC 0 Forb Perennial Native cxceph Carex cephalophora Carex cephalophora Oval-Leaf Sedge 3 FACU FACU 1 Sedge Perennial Native cxemor Carex emoryi Carex emoryi Emory's Sedge 6 OBL OBL -2 Sedge Perennial Native cxstip Carex stipata Carex stipata Stalk-Grain Sedge 3 OBL OBL -2 Sedge Perennial Native cxvulp Carex vulpinoidea Carex vulpinoidea Common Fox Sedge 2 FACW OBL -1 Sedge Perennial Native cirarv Cirsium arvense CIRSIUM ARVENSE Canadian Thistle 0 FACU FACU 1 Forb Perennial Adventive conarv Convolvulus arvensis CONVOLVULU S ARVENSIS Field Bindweed 0 UPL UPL 2 Forb Perennial Adventive corrac Cornus racemosa Cornus racemosa Gray Dogwood 1 FAC FAC 0 Shrub Perennial Native cypesc Cyperus esculentus Cyperus esculentus Chufa 0 FACW FACW -1 Sedge Perennial Native echcru Echinochloa crus- galli Echinochloa crusgalli Large Barnyard Grass 0 FACW FAC -1 Grass Annual Native Page 431 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC) HABIT DURATION NATIVITY eleery Eleocharis palustris Eleocharis erythropoda; Eleocharis palustris major; Eleocharis smallii Common Spike- Rush 2 OBL OBL -2 Sedge Perennial Native galapa Galium aparine Galium aparine Sticky-Willy 1 FACU FACU 1 Forb Annual Native glehed Glechoma hederacea GLECHOMA HEDERACEA Groundivy 0 FACU FACU 1 Forb Perennial Adventive gletri Gleditsia triacanthos Gleditsia triacanthos Honey-Locust 2 FACU FAC 1 Tree Perennial Native helgro Helianthus grosseserratus Helianthus grosseserratu s Saw-Tooth Sunflower 2 FACW FACW -1 Forb Perennial Native horjub Hordeum jubatum HORDEUM JUBATUM Fox-Tail Barley 0 FAC FAC 0 Grass Perennial Adventive impcap Impatiens capensis Impatiens capensis Spotted Touch-Me- Not 3 FACW FACW -1 Forb Annual Native jugnig Juglans nigra Juglans nigra Black Walnut 5 FACU FACU 1 Tree Perennial Native lapcan Laportea canadensis Laportea canadensis Canadian Wood- Nettle 3 FACW FACW -1 Forb Perennial Native lonmaa Lonicera maackii LONICERA MAACKII Amur Honeysuckle 0 UPL UPL 2 Shrub Perennial Adventive moralb Morus alba MORUS ALBA White Mulberry 0 FAC FACU 0 Tree Perennial Adventive pancap Panicum capillare Panicum capillare Common Panic Grass 1 FAC FAC 0 Grass Annual Native passat Pastinaca sativa PASTINACA SATIVA Parsnip 0 UPL UPL 2 Forb Biennial Adventive peramp Persicaria amphibia Polygonum coccineum; Polygonum amphibium stipulaceum Water Smartweed 4 OBL OBL -2 Forb Perennial Native perpen Persicaria pensylvanica Polygonum pensylvanicu m Pinkweed 0 FACW FACW -1 Forb Annual Native phaaru Phalaris arundinacea PHALARIS ARUNDINACE A Reed Canary Grass 0 FACW FACW -1 Grass Perennial Adventive pilpum Pilea pumila Pilea pumila Canadian Clearweed 5 FACW FACW -1 Forb Annual Native plamaj Plantago major PLANTAGO MAJOR Great Plantain 0 FAC FACU 0 Forb Perennial Adventive popdel Populus deltoides Populus deltoides Eastern Cottonwood 2 FAC FAC 0 Tree Perennial Native pruser Prunus serotina Prunus serotina Black Cherry 1 FACU FACU 1 Tree Perennial Native rhacat Rhamnus cathartica RHAMNUS CATHARTICA European Buckthorn 0 FAC FAC 0 Shrub Perennial Adventive ribmis Ribes missouriense Ribes missouriense Missouri Gooseberry 5 UPL UPL 2 Shrub Perennial Native rosmul Rosa multiflora ROSA MULTIFLORA Rambler Rose 0 FACU FACU 1 Shrub Perennial Adventive rumcri Rumex crispus RUMEX CRISPUS Curly Dock 0 FAC FAC 0 Forb Perennial Adventive salint Salix interior Salix interior Sandbar Willow 1 FACW FACW -1 Shrub Perennial Native salnig Salix nigra Salix nigra Black Willow 4 OBL OBL -2 Tree Perennial Native schacu Schoenoplectus acutus Scirpus acutus Hard-Stem Club- Rush 6 OBL OBL -2 Sedge Perennial Native setfab Setaria faberi SETARIA FABERI Japanese Bristle Grass 0 FACU FACU 1 Grass Annual Adventive soldul Solanum dulcamara SOLANUM DULCAMARA Climbing Nightshade 0 FAC FAC 0 Vine Perennial Adventive solalt Solidago altissima Solidago altissima Tall Goldenrod 1 FACU FACU 1 Forb Perennial Native solgig Solidago gigantea Solidago gigantea Late Goldenrod 4 FACW FACW -1 Forb Perennial Native taroff Taraxacum officinale TARAXACUM OFFICINALE Common Dandelion 0 FACU FACU 1 Forb Perennial Adventive teucan Teucrium canadense Teucrium canadense American Germander 3 FACW FACW -1 Forb Perennial Native toxrad Toxicodendron radicans Rhus radicans Eastern Poison-Ivy 2 FAC FAC 0 Vine Perennial Native typang Typha angustifolia Typha angustifolia Narrow-Leaf Cat- Tail 0 OBL OBL -2 Forb Perennial Adventive urtdio Urtica dioica ssp. gracilis Urtica procera Tall Nettle 2 FACW FAC -1 Forb Perennial Native veralt Verbesina alternifolia Actinomeris alternifolia Wingstem 5 FACW FACW -1 Forb Perennial Native vitrip Vitis riparia Vitis riparia River-Bank Grape 2 FACW FAC -1 Vine Perennial Native Page 432 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) (Plot size: 5 ft. x 5 ft. 2 Y FACPersicaria virginiana None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 Hydrophytic vegetation was confirmed by the Dominance Test. The aster species (Symphyotrichum sp.) could not be identified to species level as it was not in flower at the time of the site visit. However, identification to the species level would not change the hydrophytic vegetation determination. Vegetation in the tree and sampling/shrub strata were overhanging Site 2 only. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 60 5 4 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 80% Hydrophytic vegetation present? 30 ft. x 30 ft. 7 WETLAND DETERMINATION DATA FORM - Midwest Region No Sampling Point: 2-1Illinois None , or hydrology , or hydrology -88.199320 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 X Local relief (concave, convex, none):Flat in depression 0 5 Y FAC Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) 5 Y (Plot size: 15 ft. x 15 ft. UNK Rhamnus cathartica Absolute % Cover Dominant Species Indicator Status 20 Y State: 41.624577 Y Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft.Tree Stratum (Plot size: Morus alba Section, Township, Range: Soil Map Unit Name: Y Y VEGETATION -- Use scientific names of plants. Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Graymont silt loam, 2 to 5 percent slopes (541B) Lat:Long: Sampling Date: 6/8/2016 S3, T36N, R9E Y (If needed, explain any answers in remarks.) Site 2 Site 2 is a seasonal depressional wetland located approximately 0.18 mile east of Illinois Route 59 (IL 59) and approximately 0.17 mile south of West Hazelcrest Drive. Site 2 has characteristics of an ephmeral wetland as it is a closed depression within a forest within an outwash plain. However faunal surveys were not conducted at the time of the site visit to support an ephemeral wetland designation. Dragonflies and damelflies were observed within Site 2. Y If yes, optional wetland site ID: FAC Populus deltoides 40 Y FAC WGS 84 None Plainfield/WillCity/ County: Applicant/Owner:Village of Plainfield Aster species 5 US Army Corps of Engineers Midwest RegionPage 433 X X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X Sampling Point:2-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-4 10YR 2/1 93 10YR 5/2 5 D M Silt loam with muck Sandy clay Mixed Matrix 10YR 7/2 2 D M >8 Shovel refusal 6-8 10YR 6/6 85 10YR 7/1 10 D PL Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3)X Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Graymont silt loam (541B), which has hydric inclusions in end moraines in Will County. 2cm Muck (A10) and Depleted Dark Surface (F7) confirmed hydric soil. Rocks were encountered at eight inches below the soil surface. The soil appears to be disturbed by past construction. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 8 Rocks Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Site 2 receives surface water from adjacent uplands and impervious surfaces. Two primary and one secondary indicator of wetland hydrology was present at the time of the site visit. Indicator B7 - 2002 and 2005 aerial imagery. Des Plaines River Watershed (HUC # 07120004) 10YR 2/1 5 with rocks Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) PL Silt loam *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) 4-6 10YR 2/1 80 2.5 YR 4/8 20 C Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 434 Project/Site Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Plainfield/WillCity/ County: Applicant/Owner: Village of Plainfield Verbesina alternifolia 10 Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Graymont silt loam, 2 to 5 percent slopes (541B) Lat: Long: Sampling Date: 6/8/2016 S3, T36N, R9E N (If needed, explain any answers in remarks.) Data Point 2-2 is located on a hillslope adjacent to Site 2. N If yes, optional wetland site ID: FAC Populus deltoides 40 Y FAC WGS 84 None Absolute % Cover Dominant Species Indicator Status 20 Y State: 41.62461 Y Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft.Tree Stratum (Plot size: Morus alba Section, Township, Range: Soil Map Unit Name Y Y VEGETATION -- Use scientific names of plants. (Plot size: 15 ft. x 15 ft. FACW Rhamnus cathartica FAC 10 Y FAC Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) 45 Y 10 WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 2-2Illinois Concave , or hydrology , or hydrology -88.199233 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 X Local relief (concave, convex, none):Hillslope 10 Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 60 5 4 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 80% Hydrophytic vegetation present? 30 ft. x 30 ft. 85 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 (Plot size: 5 ft. x 5 ft. Alliaria petiolata 10 N FAC 20 Y N FACU Viola sororia Ageratina altissima US Army Corps of Engineers Midwest Region Page 435 X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) Rocks *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) >5 Shovel refusal Histosol (A1) Histic Epipedon (A2) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present? Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Graymont silt loam (541B), which has hydric inclusions in end moraines in Will County. Redox Dark Surface (F6) confirmed hydric soil. Rocks were encountered at five inches below the soil surface. The soil appears to be disturbed by past construction. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 5 Rocks Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5) Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 10YR 3/2 40 0-5 10YR 2/1 60 10YR 6/8 2 C M Silty clay Sampling Point:2-2 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest Region Page 436 SITE:2 LOCALE:143rd Street, Plainfield, IL BY:H&H (N. Pisula and L. Herrera) NOTES: CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)2.67 SPECIES RICHNESS (ALL)6 MEAN C (ALL SPECIES)1.33 SPECIES RICHNESS (NATIVE)3 MEAN C (NATIVE TREES)2.00 % NON-NATIVE 0.50 MEAN C (NATIVE SHRUBS)0.00 WET INDICATOR (ALL)-0.50 MEAN C (NATIVE HERBACEOUS)3.00 WET INDICATOR (NATIVE)-0.67 FQAI (NATIVE SPECIES)4.62 % HYDROPHYTE (MIDWEST)1.00 FQAI (ALL SPECIES)3.27 % NATIVE PERENNIAL 0.50 ADJUSTED FQAI 18.86 % NATIVE ANNUAL 0.00 % C VALUE 0 0.50 % ANNUAL 0.00 % C VALUE 1-3 0.33 % PERENNIAL 1.00 % C VALUE 4-6 0.17 % C VALUE 7-10 0.00 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC) HABIT DURATION NATIVITY glystr Glyceria striata Glyceria striata Fowl Manna Grass 4 OBL OBL -2 Grass Perennial Native moralb Morus alba MORUS ALBA White Mulberry 0 FAC FACU 0 Tree Perennial Adventive pervir Persicaria virginiana Polygonum virginianum Jumpseed 2 FAC FAC 0 Forb Perennial Native phaaru Phalaris arundinacea PHALARIS ARUNDINACE A Reed Canary Grass 0 FACW FACW -1 Grass Perennial Adventive popdel Populus deltoides Populus deltoides Eastern Cottonwood 2 FAC FAC 0 Tree Perennial Native rhacat Rhamnus cathartica RHAMNUS CATHARTICA European Buckthorn 0 FAC FAC 0 Shrub Perennial Adventive Page 437 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) (Plot size: 5 ft. x 5 ft. 1 N FACToxicodendron radicans None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 85 3 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 67% Hydrophytic vegetation present? 30 ft. x 30 ft. 3 WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 3-1Illinois Concave , or hydrology , or hydrology -88.181911 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Local relief (concave, convex, none):Toeslope 5 Prunus serotina 15 Y FAC FAC FACU 10 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) 2 N 10 N FACU (Plot size: 15 ft. x 15 ft. FACU Lonicera tatarica Rhamnus cathartica 5 Morus alba Y Absolute % Cover Dominant Species Indicator Status 10 N State: 41.623100 Y Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft.Tree Stratum (Plot size: Acer saccharinum Section, Township, Range: Soil Map Unit Name: Y Y VEGETATION -- Use scientific names of plants. Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Orthents, loamy, undulating (802B) Lat:Long: Sampling Date: 6/17/2016 S11, T36N, R9E Y (If needed, explain any answers in remarks.) Site 3 Site 3 is a seasonal depressional wetland located approximately 535 feet east of the Illinois Route 126 (IL 126) and 143rd Street intersection, on the south side of 143rd Street. Site 3 has characteristics of an ephmeral wetland as it is a closed depression within a forest within an ground moraine. However faunal surveys were not conducted at the time of the site visit to support an ephemeral wetland designation. Y If yes, optional wetland site ID: FACW Populus deltoides 65 Y FAC WGS 84 None Unincorporated WillCity/ County: Applicant/Owner:Village of Plainfield Parthenocissus inserta 30 N US Army Corps of Engineers Midwest RegionPage 438 X Aquatic Fauna (B13) X True Aquatic Plants (B14) X Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X Sampling Point:3-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-16 10YR 2/1 100 Mucky peat with sand Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Orthents, loamy, undulating (802B), which has hydric inclusions in outwash plains in Will County. Histosol (A1) confirmed hydric soil. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) YHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes X No Depth (inches):4 Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Site 3 receives surface water from adjacent uplands and impervious surfaces. Three primary and one secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes 0 (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes X NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 439 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) Unincorporated WillCity/ County: FAC (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Orthents, loamy, undulating (802B) State: 41.623151 Y (Plot size: 5 ft. x 5 ft. N Hydrophytic vegetation present? 10 30 ft. x 30 ft. 25 Vitis aestivalis Problematic hydrophytic vegetation* (explain) Y (Plot size: FACU 10 Y Hydrophytic vegetation was confirmed by the Dominance Test. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 40 5 3 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 60% WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: 3-2Illinois Convex , or hydrology , or hydrology -88.181899 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Local relief (concave, convex, none):Hillslope 20 Lat:Long: Applicant/Owner: VEGETATION -- Use scientific names of plants. FACU 10 20 Y Absolute % Cover Dominant Species Indicator Status 10 Y Lonicera tatarica Sampling Date: 6/17/2016 S11, T36N, R9E N (If needed, explain any answers in remarks.) Data Point 3-2 is located adjacent to Site 3. N If yes, optional wetland site ID: FAC Populus deltoides 30 Y FAC Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 None 25 NParthenocissus inserta 30 Tree Stratum (Plot size: Morus alba Rhamnus cathartica Y FACU US Army Corps of Engineers Midwest RegionPage 440 Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) Sampling Point:3-2 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** 0-16 10YR 2/1 100 Silt loam with gravel Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No X Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) Other (explain in remarks) The soil is mapped as Orthents, loamy, undulating (802B) which has hydric inclusions in outwash plains in Will County. Indicators of hydric soil were not present within the soil profile at the time of the site visit. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) X Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?N Water table present?Yes No X Depth (inches): Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Surface water flows from this area into adjacent wetlands. No primary or secondary indicators of wetland hydrology were present at the time of the site visit. Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) Yes (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) US Army Corps of Engineers Midwest RegionPage 441 SITE:3 LOCALE:143rd Street, Plainfield, IL BY:H&H (N. Pisula and L. Herrera) NOTES: CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)1.73 SPECIES RICHNESS (ALL)17 MEAN C (ALL SPECIES)1.12 SPECIES RICHNESS (NATIVE)11 MEAN C (NATIVE TREES)0.75 % NON-NATIVE 0.35 MEAN C (NATIVE SHRUBS)0.00 WET INDICATOR (ALL)-0.12 MEAN C (NATIVE HERBACEOUS)2.60 WET INDICATOR (NATIVE)-0.18 FQAI (NATIVE SPECIES)5.73 % HYDROPHYTE (MIDWEST)0.65 FQAI (ALL SPECIES)4.61 % NATIVE PERENNIAL 0.65 ADJUSTED FQAI 13.89 % NATIVE ANNUAL 0.00 % C VALUE 0 0.53 % ANNUAL 0.06 % C VALUE 1-3 0.41 % PERENNIAL 0.88 % C VALUE 4-6 0.06 % C VALUE 7-10 0.00 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC) HABIT DURATION NATIVITY aceneg Acer negundo Acer negundo var. violaceum Ash-Leaf Maple 0 FAC FAC 0 Tree Perennial Native acesai Acer saccharinum Acer saccharinum Silver Maple 0 FACW FACW -1 Tree Perennial Native ascsyr Asclepias syriaca Asclepias syriaca Common Milkweed 0 FACU UPL 1 Forb Perennial Native barvul Barbarea vulgaris BARBAREA VULGARIS Garden Yellow- Rocket 0 FAC FAC 0 Forb Biennial Adventive broine Bromus inermis BROMUS INERMIS Smooth Brome 0 FACU UPL 1 Grass Perennial Adventive cxceph Carex cephalophora Carex cephalophora Oval-Leaf Sedge 3 FACU FACU 1 Sedge Perennial Native cxstip Carex stipata Carex stipata Stalk-Grain Sedge 3 OBL OBL -2 Sedge Perennial Native cxstri Carex stricta Carex stricta Uptight Sedge 5 OBL OBL -2 Sedge Perennial Native cxvulp Carex vulpinoidea Carex vulpinoidea Common Fox Sedge 2 FACW OBL -1 Sedge Perennial Native lemaeq Lemna aequinoctialis LEMNA AEQUINOCTI ALIS Lesser Duckweed 0 OBL OBL -2 Forb Annual Adventive lontat Lonicera tatarica LONICERA TATARICA Twinsisters 0 FACU FACU 1 Shrub Perennial Adventive moralb Morus alba MORUS ALBA White Mulberry 0 FAC FACU 0 Tree Perennial Adventive parins Parthenocissus inserta Parthenocissu s inserta Thicket-Creeper 1 FACU FACU 1 Vine Perennial Native popdel Populus deltoides Populus deltoides Eastern Cottonwood 2 FAC FAC 0 Tree Perennial Native pruser Prunus serotina Prunus serotina Black Cherry 1 FACU FACU 1 Tree Perennial Native rhacat Rhamnus cathartica RHAMNUS CATHARTICA European Buckthorn 0 FAC FAC 0 Shrub Perennial Adventive toxrad Toxicodendron radicans Rhus radicans Eastern Poison-Ivy 2 FAC FAC 0 Vine Perennial Native Page 442 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) Plainfield/WillCity/ County: Applicant/Owner:Village of Plainfield None 7 Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Dunham silty clay loam, 0 to 2 percent slopes (523A) Lat:Long: Sampling Date: 6/8/2016 S10, T36N, R9E N (If needed, explain any answers in remarks.) Site W1 (WOUS) Site W1 is the West Norman Drain, a "Waters of the U.S." (WOUS), that crosses Illinois Route 59 (IL 59) approximately 355 feet south of the IL 59 at 143rd Street intersection and crosses 143rd Street approximately 540 feet west of the IL 59 and 143rd Street intersection. Data Point W1-1 is located within the West Norman Drain, on the east side of IL 59, south of West 143rd Street. Y If yes, optional wetland site ID: None WGS 84 Blue line stream Absolute % Cover Dominant Species Indicator Status State: 41.622126 Y Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft.Tree Stratum (Plot size: Section, Township, Range: Soil Map Unit Name: Y N VEGETATION -- Use scientific names of plants. (Plot size: 15 ft. x 15 ft. Acer negundo Acer saccharinum N 5 Y FACW FAC 2 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: W1-1Illinois None , or hydrology , or hydrology -88.202468 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Local relief (concave, convex, none):Channel 0 Hydrophytic vegetation was confirmed by the Dominance Test. Vegetation in the sampling/shrub stratum were overhanging the West Norman Drain only. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 1 1 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 100% Hydrophytic vegetation present? 30 ft. x 30 ft. 0 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 (Plot size: 5 ft. x 5 ft. US Army Corps of Engineers Midwest RegionPage 443 X X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Site W1 receives surface water from adjacent uplands and impervious surfaces. Three primary and two secondary indicators of wetland hydrology were present at the time of the site visit. Aquatic fauna (B13) consisted of a specimen of Asian clam (Corbicula fluminea ). Des Plaines River Watershed (HUC #07120004) Secondary Indicators (minimum of two required) 8-12YesX N/A (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No Depth (inches):N/A Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Dunham silty clay loam (523A), which is listed as a hydric soil in outwash plains, ground moraines, and swales in Will County. No soil pit was dug due to the presence of up to 12 inches of surface water at the time of the site visit. The substrate of the West Norman Drain consists of cobbles, silt, and clay. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 0 Surface Water Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 0 Inundation Surface Water Sampling Point:W1-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 444 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 X Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) 5 YCarex emoryi 20 Rhamnus cathartica Y OBL (If needed, explain any answers in remarks.) Site W2 (WOUS) Site W2 is the East Norman Drain, a "Waters of the U.S." (WOUS), located east of Illinois Route 59 (IL 59) and flows south into Site W3, the DuPage River. Y If yes, optional wetland site ID: None Is the sampled area within a wetland? 20 ft. x 40 ft.Tree Stratum (Plot size: WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: W2-1Illinois None , or hydrology , or hydrology -88.198614 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Sampling Date: 6/17/2016 S3, T36N, R9E Landform (hillslope, terrace, etc.): WGS 84 None Local relief (concave, convex, none):Channel 0 Lat:Long: Applicant/Owner: FACU 10 10 Y Dominant Species Indicator Status Lonicera tatarica N Hydrophytic vegetation was confirmed by the Dominance Test. Vegetation in the sapling/shrub stratum was overhanging the East Norman Drain only. The tree and woody vine strata were modified due to the geometry of the East Norman Drain. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 3 2 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 67% Hydrophytic vegetation present? 20 ft. x 40 ft. 5 None Problematic hydrophytic vegetation* (explain) Y (Plot size: 0 Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) (Plot size: 5 ft. x 5 ft. Plainfield/WillCity/ County: FAC (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Drummer silty clay loam, 0 to 2 percent slopes (152A) State: 41.624503 Y VEGETATION -- Use scientific names of plants. Absolute % Cover US Army Corps of Engineers Midwest RegionPage 445 X Aquatic Fauna (B13) X True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Site W2 receives surface water from adjacent uplands and impervious surfaces. Three primary and one secondary indicators of wetland hydrology were present at the time of the site visit. The aquatic plant was long-leaved pondweed (Potamogeton nodosus ). Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) 18-24YesX N/A (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No Depth (inches):N/A Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Drummer silty clay loam (152A), which is listed as a hydric soil in outwash plains and depressions in Will County. No soil pit was dug due to the presence of up to 24 inches of surface water at the time of the site visit. The substrate of the East Norman Drain consists of cobble and silt. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 0 Surface Water Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 0 Inundation Surface Water Sampling Point:W2-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** US Army Corps of Engineers Midwest RegionPage 446 Project/Site: Slope (%): NWI Classification: Are climatic/hydrologic conditions of the site typical for this time of the year?(If no, explain in remarks) Are vegetation , soil significantly disturbed? Are vegetation , soil naturally problematic? SUMMARY OF FINDINGS Hydrophytic vegetation present? Hydric soil present? Wetland hydrology present? Remarks: (Explain alternative procedures here or in a separate report.) Dominance Test Worksheet ) 1 (A) 2 3 (B) 4 5 (A/B) =Total Cover Sapling/Shrub stratum )Prevalence Index Worksheet 1 Total % Cover of: 2 OBL species x 1 = 3 FACW species x 2 = 4 FAC species x 3 = 5 FACU species x 4 = =Total Cover UPL species x 5 = Herb stratum )Column totals (A)(B) 1 Prevalence Index = B/A = 2 Hydrophytic Vegetation Indicators: 3 Rapid Test for Hydrophytic Vegetation 4 Dominance test is >50% 5 Prevalence index is ≤3.0* 6 7 8 9 =Total Cover Woody vine stratum ) 1 2 =Total Cover Remarks: (Include photo numbers here or on a separate sheet) R2UBH None 0 Tree Stratum (Plot size: Sampling Date: 6/8/2016 S3, T36N, R9E N (If needed, explain any answers in remarks.) Site W3 (WOUS) Site W3 is the DuPage River, a "Waters of the U.S." (WOUS), located approximately 1,160 feet east of the Illinois Route 59 (IL 59) and 143rd Street intersection. Data Point W3-1 is located within the DuPage River. Y If yes, optional wetland site ID: None Is the sampled area within a wetland? Landform (hillslope, terrace, etc.): 30 ft. x 30 ft. WGS 84 VEGETATION -- Use scientific names of plants. Absolute % Cover Dominant Species Indicator Status None WETLAND DETERMINATION DATA FORM - Midwest Region Yes Sampling Point: W3-1Illinois None , or hydrology , or hydrology -88.198515 Are "normal circumstances" present? Datum: 143rd Street Extension, IL 59 to IL 126 Local relief (concave, convex, none):Channel 0 Lat:Long: Applicant/Owner: Indicators of hydrophytic vegetation were not present at the time of the site visit. Number of Dominant Species that are OBL, FACW, or FAC: Total Number of Dominant Species Across all Strata: Percent of Dominant Species that are OBL, FACW, or FAC: 0 0 0 *Indicators of hydric soil and wetland hydrology must be present, unless disturbed or problematic 0% Hydrophytic vegetation present? 30 ft. x 30 ft. 0 None Problematic hydrophytic vegetation* (explain) N (Plot size: 0 (Plot size: 5 ft. x 5 ft. Morphological adaptations* (provide supporting data in Remarks or on a separate sheet) Plainfield/WillCity/ County: (Plot size: 15 ft. x 15 ft. Village of Plainfield Section, Township, Range: Soil Map Unit Name: Y N Investigator(s): Huff & Huff, Inc. (N. Pisula & L. Herrera) Water (W) State: 41.623292 N U S ArmyCorpsofEngineers M idwestR egionPage 447 X X Aquatic Fauna (B13) True Aquatic Plants (B14) Hydrogen Sulfide Odor (C1) Presence of Reduced Iron (C4) X X 5 cm Mucky Peat or Peat (S3) (LRR K, L, R) Sandy Gleyed Matrix (S4) Sandy Redox (S5) Indicators for Problematic Hydric Soils: Stripped Matrix (S6) *Type: C = Concentration, D = Depletion, RM = Reduced Matrix, MS = Masked Sand Grains. **Location: PL = Pore Lining, M = Matrix Coast Prairie Redox (A16) (LRR K, L, R) Dark Surface (S7) (LRR K, L) Histosol (A1) Histic Epipedon (A2) Site W3 receives surface water from adjacent uplands and impervious surfaces. Three primary and one secondary indicators of wetland hydrology were present at the time of the site visit. Aquatic fauna (B13) consisted of several mallards (A nas platyrhync hos ). Des Plaines River Watershed (HUC # 07120004) Secondary Indicators (minimum of two required) 48-60YesX N/A (includes capillary fringe) Inundation Visible on Aerial Imagery (B7) Sparsely Vegetated Concave Surface (B8) Surface water present? Yes NoSaturation present? Primary Indicators (minimum of one is required; check all that apply) Gauge or Well Data (D9) Other (Explain in Remarks) Depth (inches): Thin Muck Surface (C7) Wetland hydrology present?Y Water table present?Yes No Depth (inches):N/A Depth (inches): Field Observations: Surface Water (A1)Surface Soil Cracks (B6) Sandy Mucky Mineral (S1) NHydric soil present? Dry-Season Water Table (C2) Hydric Soil Indicators: Profile Description: (Describe to the depth needed to document the indicator or confirm the absence of indicators.) Loamy Mucky Mineral (F1) 2 cm Muck (A10) 5 cm Mucky Peat or Peat (S3) Restrictive Layer (if observed): Iron-Manganese Masses (F12) (LRR K, L, R) Very Shallow Dark Surface (TF12) Other (explain in remarks) The soil is mapped as Water (W). No soil pit was dug due to the presence of up to 60 inches of surface water at the time of the site visit. The substrate of the DuPage River consists of gravel and silt. *Indicators of hydrophytic vegetation and wetland hydrology must be present, unless disturbed or problematic Remarks: Type: SOIL Wetland Hydrology Indicators: HYDROLOGY Black Histic (A3) Hydrogen Sulfide (A4) Stratified Layers (A5) Depth (inches): 0 Surface Water Loamy Gleyed Matrix (F2) Depleted Matrix (F3) Redox Dark Surface (F6) Depleted Dark Surface (F7) Redox Depressions (F8) Depleted Below Dark Surface (A11) Thick Dark Surface (A12) Describe recorded data (stream gauge, monitoring well, aerial photos, previous inspections), if available: Remarks: Water-Stained Leaves (B9) Oxidized Rhizospheres on Living Roots (C3) Drainage Patterns (B10) Water Marks (B1)Crayfish Burrows (C8) Saturation Visible on Aerial Imagery (C9) High Water Table (A2) FAC-Neutral Test (D5)Iron Deposits (B5) Drift Deposits (B3) Algal Mat or Crust (B4) Stunted or Stressed Plants (D1) Geomorphic Position (D2) Saturation (A3) No Recent Iron Reduction in Tilled Soils (C6) Sediment Deposits (B2) 0 Inundation Surface Water Sampling Point:W3-1 Depth (Inches) Matrix Redox Features Texture RemarksColor (moist) % Color (moist) % Type* Loc** U S ArmyCorpsofEngineers M idwestR egionPage 448 Appendix C – Photographs Page 449 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 1: Facing north towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. The photo was taken in the wet meadow east of Illinois Route 59 (IL 59). Photo 3: Facing east towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. The photo was taken in the wet meadow east IL 59. Photo 2: Facing west towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. The photo was taken in the wet meadow east IL 59. Photo 4: Data Point 1-1 (wetland). Page 450 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 5: Data Point 1-2 (upland). Photo 7: Facing northeast towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. The photo was taken in the forested wetland east of IL 59. Photo 6: Data Point 1-3 (upland). Photo 8: Data Point 1-5 (wetland). Page 451 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 9: Data Point 1-4 (upland). Photo 11: Data Point 1-7 (wetland). Photo 10: Facing west from IL 59 towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. The photo was taken in the wet meadow at the edge of an agricultural field, west of IL 59. Photo 12: Data Point 1-6 (upland). Page 452 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 13: Facing south from 143rd Street towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. Photo 15: Data Point 8-1 (upland). Photo 14: Data Point 1-9 (wetland). Photo 16: Facing southeast from 143rd Street towards Site 1, a wet meadow, forested wetland, and marsh associated with the West Norman Drain, East Norman Drain, and the DuPage River. Page 453 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 17: Data Point 1-11 (wetland). Photo 19: Facing south towards Site 2, a seasonal depressional wetland, located approximately 0.18 mile east of IL 59 and approximately 0.17 mile south of West Hazelcrest Drive. Photo 18: Data Point 1-10 (upland). Photo 20: Close-up of the edge of Site 2, a seasonal depressional wetland, located approximately 0.18 mile east of IL 59 and approximately 0.17 mile south of West Hazelcrest Drive. Page 454 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 21: Data Point 2-1. Photo 23: Facing northwest towards a gully north of the survey limits in an agricultural field west of the DuPage River. Photo 22: Data Point 2-2. Photo 24: Facing southeast towards Site 3, a seasonal depressional wetland, located on the south side of 143rd Street, east of Illinois Route 126 (IL 126). Page 455 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 25: Facing northwest towards Site 3, a seasonal depressional wetland, located on the south side of East 143rd Street, east of IL 126. Photo 27: Facing southeast towards Site 3, a seasonal depressional wetland, located on the south side of 143rd Street, east of IL 126. Photo 26: Facing southeast towards Site 3, a seasonal depressional wetland, located on the south side of 143rd Street, east of IL 126. Photo 28: Facing southeast towards Site 3, a seasonal depressional wetland, located on the south side of 143rd Street, east of IL 126. Page 456 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 29: Facing north towards Site 3, a seasonal depressional wetland, located on the south side of 143rd Street, east of IL 126. Photo 31: Data Point 3-2. Photo 30: Data Point 3-1. Photo 32: Photo of the substrate of Site W1, West Norman Drain, a WOUS, that crosses IL 59 approximately 355 feet south of the IL 59 at 143rd Street intersection and approximately 540 feet west of the IL 59 and 143rd Street intersection. Page 457 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 33: Facing northeast towards Site W1, West Norman Drain, a WOUS, that crosses IL 59 approximately 355 feet south of the IL 59 at 143rd Street intersection and approximately 540 feet west of the IL 59 and 143rd Street intersection. Photo 35: Facing northeast towards Site W1, West Norman Drain, a WOUS, that crosses IL 59 approximately 355 feet south of the IL 59 at 143rd Street intersection and approximately 540 feet west of the IL 59 and 143rd Street intersection. Photo 34: Facing west towards Site W1 and 1 from IL 59. Photo 36: Facing north towards Site W1, West Norman Drain, a WOUS, that crosses IL 59 approximately 355 feet south of the IL 59 at 143rd Street intersection and approximately 540 feet west of the IL 59 and 143rd Street intersection. Picture taken north of 143rd Street, west of IL 59. Page 458 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 37: Facing south towards Site W2, East Norman Drain, a WOUS, located east of IL 59, north of 143rd Street. The photo was taken at the confluence with the DuPage River (Site W3). Photo 39: Facing west towards Site W3, the DuPage River, a WOUS, located east of IL 59. Photo 38: Data Point W2-1. Photo 40: Facing south towards Site W3, the DuPage River, a WOUS, located east of IL 59. Page 459 Photographic Log of the Wetland and “Waters of the U.S.” Investigation of the 143rd Street Extension Village of Plainfield, Will County, Illinois June 8, and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_WetlandPhotolog.doc Photo 41: Facing north towards Site W3, the DuPage River, a WOUS, located east of IL 59. Page 460 Photographic Log of the Stormwater Water Features for the Wetland and “Waters of the U.S” Delineation for 143rd Street Extension Village of Plainfield, Will County, Illinois June 8 and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_RDPhotolog.doc Photo 1: Facing west towards Roadside Ditch (RD) 1, a stormwater conveyance feature, located south of 143rd Street, west of IL 59. Photo 3: RDDP1-1. Photo 2: Facing east towards RD1, a stormwater conveyance feature, located south of 143rd Street, west of IL 59. Photo 4: Facing north towards RD2, a stormwater conveyance feature, located west of IL 59, south of 143rd Street. Page 461 Photographic Log of the Stormwater Water Features for the Wetland and “Waters of the U.S” Delineation for 143rd Street Extension Village of Plainfield, Will County, Illinois June 8 and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_RDPhotolog.doc Photo 5: RDDP2-1. Photo 7: RPDP1-1. Photo 6: Facing west towards Retention Pond (RP) 1, located north and west of Site 1, and west of the DuPage River (Site W3). Photo 8: Facing southeast towards Pond 1, located east of the Dupage River, west of IL 126. Page 462 Photographic Log of the Stormwater Water Features for the Wetland and “Waters of the U.S” Delineation for 143rd Street Extension Village of Plainfield, Will County, Illinois June 8 and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_RDPhotolog.doc Photo 9: Facing north towards Mining Pond 1 located east of Plainfield/Naperville Road and west of IL 126. Photo 11: Facing south towards Mining Pond 3 located south of 143rd Street, east of IL 126. Photo 10: Facing northeast towards Mining Pond 2, located east of IL 126, north of 143rd Street. Photo 12: Facing north towards RP2, located north of 143rd Street, east of IL 126. Page 463 Photographic Log of the Stormwater Water Features for the Wetland and “Waters of the U.S” Delineation for 143rd Street Extension Village of Plainfield, Will County, Illinois June 8 and 17, 2016 and September 9, 2016 J:\81.0220102.05 CMT 143rd Street\Photos\Wetland\CMT_143_RDPhotolog.doc Photo 13: Facing southeast towards Mining Pond 4, located east of IL 126, south of IL 143rd Street. Page 464 Appendix D – Waters Upload Page 465 JURISDICTIONAL SUMMARY (WATERS UPLOAD)143rd Street ExtensionPlainfield, Will County, IllinoisWaters_NameCowadin_Code HGM_CodeMeasurement_Type Amount UnitsWaters_TypesLatitude Longitude Local_WaterwaySite 1 - Wet meadow/MarshPEMDEPRESSArea8.47 ACRERPWWD41.622967 -88.199235 West Norman Drain/DuPage RiverSite 2 - Seasonal Depressional WetlandPFODEPRESSArea0.03 ACREISOLATE41.624577 -88.19932 East Norman DrainSite 3 - Seasonal Depressional WetlandPFODEPRESSArea0.002 ACREISOLATE41.6231 -88.181911 Lily Cache CreekSite W1 - West Norman Drain RRIVERINEArea1.28 ACRERPW41.622126 -88.202468 West Norman DrainSite W2 - East Norman Drain RRIVERINEArea0.03 ACRERPW41.624503 -88.198614 East Norman DrainSite W3 - DuPage RiverR2UBRIVERINEArea1.96 ACRERPW41.623292 -88.198515 DuPage RiverJ:\81.0220102.05 CMT 143rd Street\Wetlands\Appendix D - Jurisdictional Summary Table.xlsxPage 466 Appendix E – FWD Summary Page 467 CMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 2003Normal YearSurveyLimitsSignature #1Page 468 CMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 2002Normal YearSignature #1SurveyLimitsPage 469 CMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 2001Normal YearSignature #1SurveyLimitsPage 470 Signature #1CMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 2000Wet YearSurveyLimitsPage 471 CMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 1998Normal YearSignature #1SurveyLimitsPage 472 Signature #1SurveyLimitsCMT 143rd Street ExtensionPlainfield, ILFSA Aerial Slide - 1995Normal YearPage 473 Huff & Huff, a Subsidiary of GZA Page 474