The URL can be used to link to this page

Home My Public Portal AboutProject Development Report-Volume4March 2021 Addendum Originally Approved December 17, 2014 Project Development Report Village of Plainfield 143RD STREET EXTENSION (FAU 0380) IL ROUTE 59 TO IL ROUTE 126 SECTION 06-00040-00-FP PROJECT M-9003(273) Prepared by: CMT, Inc. 550 N Commons Drive Suite 116 Aurora, IL 60504 Prepared for: Village of Plainfield 14400 Coil Plus Drive Plainfield, IL 60544 Volume 4 of 8  Appendices 19 thru 21 Section 06‐00040‐00‐FP Village of Plainfield – 143rd Street Extension Project M‐9003(273) Project Development Report Volumes Volume 1 Narrative Appendix 1 – Location Map and Functional Classification Map Appendix 2 – Existing Typical Sections and Plan and Profile Appendix 3 – Structure Master Report and BCR Approval Letter Appendix 4 – Proposed Purpose and Need, Typical Sections, and Plan and Profile Appendix 5 – Preliminary Bridge Design and Hydraulic Report Approval Cover Letter Appendix 6 – Intersection Design Studies Appendix 7 – Bass & Gill Club Alternative Memorandum Appendix 8 – Type, Size, and Location (TS&L) Plans Volume 2 Appendix 9 – BDE 3100 Design Exception Request Forms Appendix 10 – Project Cost Estimate Appendix 11 – Complete Streets Memorandum Appendix 12 – Crash Analysis Appendix 13 – Land Acquisition Summary Appendix 14 – Urbanized Area Map Appendix 15 – FEMA Maps Appendix 16 – 404 Permit Correspondence Appendix 17 – PESA Volume 3 Appendix 18 – Environmental Survey Volume 4 Appendix 19 – Section 4(f) Appendix 20 – COSIM Pre‐Screen Analysis Appendix 21 – Noise Analysis Volume 5 Appendix 22 – Public Information Meeting Volume 6 Appendix 23 – Other Public Involvement Volume 7 Appendix 24 – LA‐IDOT‐FHWA Coordination Meetings and Bimonthly Coordination Meeting Minutes Volume 8 Appendix 25 – IDOT Approval Memorandums Appendix 26 – Other Coordination APPENDIX 19 Section 4(f) 1 Alexandra Zelles From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Friday, October 9, 2020 9:57 AM To:Tice 'Charles' Cole Cc:Randy Jessen; Allen Persons; Scott Threewitt; Mike Wittkop; Alexandra Zelles; DavisD1, Michelle L. Subject:FW: 06-00040-00-FP 143rd Street East Extension-Section 4f de minimis Concurrence ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, Plainfield/143rdStreetExtension,section06Ͳ00040Ͳ00ͲFP PleaseseethemessagesbelowindicatingFHWA’s4(f)deminimisfindingforthesubjectproject.Pleaseincludethis stringofemailsinthefinalPDRforthePhase1Addendum. Thanks, Kevin From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Thursday,October8,20208:01AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence Mr. Stallworth – Please see below for the FHWA’s Section 4(f) de minimis finding. Please ensure that a copy of this email is included in the final project report addendum. William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT Sent from laptop From:Pantoja,Irene(FHWA)<irene.pantoja@dot.gov> Sent:Thursday,October8,20207:43AM To:Raffensperger,William<William.Raffensperger@illinois.gov> Cc:Rogers,John(FHWA)<john.rogers@dot.gov> Subject:[External]06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence Bill, 2 The Planned DuPage River Trail extension located adjacent west of the DuPage River in the Village of Plainfield, Will County will result in the use of Plainfield Park District owned by the Village of Plainfield, a Section 4(f) resource. FHWA hereby makes a de minimis impact finding for this use as it will not adversely affect this resource’s activities, features, and attributes. The de minimis impact finding is based upon the impact avoidance, minimization, and mitigation or enhancement measures detailed in the documentation submitted on September 30, 2020. Staysafe, \ÜxÇx ctÇàÉ}t TransportationEngineer FederalHighwayAdministration 3250ExecutiveParkDrive Springfield,IL62703 217Ͳ492Ͳ4628 “Courageisnothavingthestrengthtogoon;it'sgoingonwhenyoudon’thavethestrength”.ͲTheodoreRoosevelt From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Wednesday,September30,202011:27AM To:Pantoja,Irene(FHWA)<irene.pantoja@dot.gov> Cc:Rogers,John(FHWA)<john.rogers@dot.gov> Subject:FW:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence CAUTION:ThisemailoriginatedfromoutsideoftheDepartmentofTransportation(DOT).Donotclickonlinksoropenattachments unlessyourecognizethesenderandknowthecontentissafe. Ms. Pantoja – Please see the attached Section 4(f) de minimis evaluation for impacts to Will County Forest Preserve property along the DuPage River. This project proposes to acquire a 1.2 acre parcel from the Plainfield Park District and then deed back a permanent easement to construct a shared use path. The purpose of this acquisition is to construct a proposed bridge over the DuPage River. The project also proposes to extend an existing shared use path on park district property, located south of the proposed roadway to loop under the bridge and connect to a proposed shared use path along the north side of the roadway. Prior to this submittal, IDOT sought advice from the FHWA to determine if a Section 4(f) de minimis evaluation was appropriate for this project. Please see the attached email from the FHWA with their advice. Based on the advice from the FHWA, IDOT recommends approval of this Section 4(f) de minimis evaluation. William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway 3 Springfield, IL 62764 O - 217.785.1676 C - 217.720.2787 Hours: 7:00 am to 3:00 pm CDT Sent from laptop From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Monday,September28,202010:01AM To:Raffensperger,William<William.Raffensperger@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence Bill, Plainfield/143rdSt.Extension(fromIL59toIL126),sec.06Ͳ00040Ͳ00ͲFP Pleaseseetheattachedupdatedsection4(f)documentationanddispositionofcomments.Pleasereviewand coordinatewithFHWAforfurthercommentsand/orconcurrence. Thanks, Kevin From:AlexandraZelles<azelles@cmtengr.com> Sent:Monday,September21,20202:35PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:Tice'Charles'Cole<ccole@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;ScottThreewitt <sthreewitt@goplainfield.com>;MikeWittkop<mwittkop@cmtengr.com>;DavisD1,MichelleL. <Michelle.L.DavisD1@Illinois.gov>;Raffensperger,William<William.Raffensperger@illinois.gov> Subject:RE:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence HiKevin, AttachedistheupdatedSection4(f)documentationperthedraftPDR’scomments,aswellasacommentdisposition andthetransmittalletter. Pleaseletmeknowifthereisanythingelseyouneedorifthereareanyquestions. Thanks, Alex ALEXANDRAZELLES|Crawford,Murphy&Tilly|w630.907.7072|m630.632.5859 EnvironmentalScientist State of Illinois - CONFIDENTIALITY NOTICE: The information contained in this communication is confidential, may be attorney-client privileged or attorney work product, may constitute inside information or internal deliberative staff communication, and is intended only for the use of the addressee. Unauthorized use, disclosure or copying of this communication or any part thereof is strictly prohibited and may be unlawful. If you have received this communication in error, please notify the sender immediately by return e-mail and destroy this communication and all copies thereof, including all attachments. Receipt by an unintended recipient does not waive attorney-client privilege, attorney work product privilege, or any other exemption from disclosure. In accordance with 23 CPR 774.3 and the FHWA Illinois Division, the following documentation is being submitted for a determination of a de minimis impact for the referenced project. The following items are included: De Minimis Documentation Checklist Appendix A - Exhibits Appendix B - Correspondence Appendix C - Photographs De Minimis Documentation Checklist 1.Project Description a.Section number: 06-00040-00-FP b.Official Project Name: Plainfield 143rd Street Extension Project number: P-91-200-08 PPS Project number: M9003(273) c.Project Location (roadway designations, termini): Plainfield, Will County, Illinois; extends from the U.S. Route 30/W 143rd Street and Route 59/N Division Street intersection east to the Route 126 and E 143rd Street intersection See Exhibit A-1 for Location Map. d.Project type (new alignment, widening, safety improvement): Roadway Extension e.Project size (total project length in miles): 1.25 miles f.NEPA Class of Action: Categorical Exclusion g.NEPA Purpose and Need Summary: Purpose The purpose of the project is to improve mobility and safety along Illinois Route 59 (IL 59) and along Illinois Route 126 (IL 126) through the downtown corridor in the Village of Plainfield, Will County, Illinois by reducing the vehicular travel time and the number of crashes through the corridor. The downtown corridor is defined as the existing IL 126 (Main Street) from Wallin Drive to East 143rd Street and IL 59 from West 143rd Street to Lockport Street. Need The Village of Plainfield and the Illinois Department of Transportation (IDOT) have identified mobility and safety issues in the downtown Plainfield corridor along IL 59 and IL 126. Traffic moving between rural areas and commercial distribution facilities to the west of downtown Plainfield and Interstate 55 (I-55) to the east uses the downtown corridor because the current roadway network lacks a direct connection between the 143rd Street corridor west of IL 59 and I-55. The need for the project is evidenced by a history of increased travel times as a result of congestion and excessive crash rates along the downtown corridor. Travel time is increasing along the corridor due to congestion. Travel times for vehicles moving eastbound to IL 126 at the existing West 143rd Street from IL 59 (a total distance of 1.8 miles) are projected to increase by 113% (7.6 minutes to 16.3 minutes) by 2050, and travel times for vehicles moving westbound through the same corridor are projected to increase by 196% (6.7 minutes to 19.9 minutes) by 2050. Delays at the at-grade Canadian National (CN) rail crossing of IL 126 also impacts travel times within the downtown corridor. According to Illinois Commerce Commission (ICC) data, approximately 29 trains per day utilize this crossing. Based on the current (base year) travel time data, vehicles may be delayed by 83 seconds traveling eastbound and by 9.5 seconds traveling westbound during the worst peak travel hour as a result of the at-grade rail crossing. Average daily traffic (ADT) is projected to continue to increase in the 2050 traffic projections, which will contribute to continued travel time delays and congestion at the at-grade crossing. Congestion and lack of mobility along IL 59 and IL 126 are contributing to excessive crash rates at the intersections of IL 59 at IL 126 and IL 59 at Naperville Road. There were 730 reported crashes within the downtown Plainfield corridor between 2012 and 2018. Of the 730 crashes tabulated, 138 injuries were reported in 113 injury crashes, approximately 15% of all crashes. According to Interactive Highway Design Safety Model (IHDSM) analysis, the segment of IL 126 from IL 59 to East 143rd Street experiences twice the expected number of injury crashes. The intersection of IL 59 at West 143rd Street experiences nearly five times the expected number of injury crashes, the intersection of IL 59 at IL 126 experiences nearly four times the expected number of injury crashes, and the intersection of IL 126 at East 143rd Street experiences twice the expected number of injury crashes. The crash types identified to be contributing the most to injury crashes at these intersections are primarily rear-end and angle collisions, suggesting that due to congested traffic and long wait times, vehicles are attempting to move quickly through these intersections when it is unsafe to do so. High injury rates (40% of crashes) are also evident at the existing CN at- grade rail crossing of IL 126. h.Project Status: Phase 1 Design Approval was initially granted on December 17, 2014. The Village is in the process of completing an addendum to the preliminary engineering and environmental studies (Phase 1) due to a revised alignment. Approval of the Phase 1 Addendum is anticipated by December 2020. Letting is currently programmed for November 2021 with construction planned in 2022 and 2023. 2.Section 4(f) Resources a.Resource type (historic property, park, recreation area, wildlife or waterfowl refuge): Planned multi-use paved trail b.Resource Name: Planned DuPage River Trail extension on Plainfield Park District property located adjacent west of the DuPage River (Will Co. Parcel ID 06-03-03-300-016-0000) c.Official(s) with Jurisdiction (OWJ) name: Carlo Capalbo, Executive Director, Plainfield Park District d.Description of role/significance in the community: The 1.2-acre property is currently undeveloped and is comprised of floodplain and wetland habitat. Plainfield Park District purchased the property with the intent to construct a multi-use paved bike trail that would connect an existing trail south of the project corridor north along the DuPage River corridor to Eaton Preserve Park, as indicated in the Park District’s 2016 Comprehensive Plan (select pages attached).See Exhibit A-2 for an aerial map of the Plainfield Park District property within the project limits. 3.Description of intended Section 4(f) Resource Use a.Acres to be taken and/or impacted: The 4(f) property is a total of 1.2 acres. The project proposes to acquire the entire property and return approximately 0.08 acre of permanent easement containing the new trail extension to the Park District after construction is complete, for a net take of 1.12 acres. The Park District owns four additional parcels abutting the DuPage River south of the 4(f) resource totaling 7.2 acres (Will Co. Parcel IDs 06-03-10-100-029-0000, 06-03-10- 100-031-0000, 06-03-10-100-027-0000 and 06-03-10-100-025-0000). The ComEd utility property separates the 4(f) property from the four other Park District properties. The existing DuPage River Trail runs north-south through the additional Park District properties and then dead ends with a loop in the ComEd utility property (Will Co. Parcel ID 06-03-10-100-001-0000). The Park District owns a 74.8 acre parcel (Eaton Preserve Park) abutting the DuPage River approximately 0.5 mile north of the 4(f) resource. b.Type of impact (for example, ROW acquisition, permanent incorporation/change in ownership, perpetual easement, etc.): The type of impact is permanent full acquisition/change in ownership and permanent easement, as identified in the table below. The Village of Plainfield will acquire the entire property for purposes of constructing a bridge over the DuPage River as part of the 143rd Street extension. The project will also include placing a retaining wall and bridge piers on the property and will provide streambank stabilization measures on the west bank of the DuPage River within the property boundary to address existing and future scour. Approximately 0.08 acre of permanent easement will be returned to the Plainfield Park District to allow for the Park District to maintain and utilize the multi-use paved trail that will be built as a minimization measure by the project, as described in Section 4.a. See Exhibit A-6 for an aerial map showing the proposed impacts and minimization measures. Type of Impact Area (acres)Purpose Negatively Affect Function (Yes or No) Temporary Construction Easement 0 N/A N/A Permanent Right-of- Way 1.2 Property acquisition by Village of Plainfield for construction of bridge over DuPage River to facilitate extension of 143rd Street. No Permanent Easement 0.08 Trail easement from the acquired property by Village of Plainfield to Plainfield Park District No c.Existing function of impacted areas: The property is currently undeveloped and comprised of floodplain, wetland and upland habitats. No recreational opportunities for the public are currently available at this property, and the site does not serve as a designated wildlife and waterfowl refuge. d.Relationship of impacted areas to Section 4(f) function and significance to resource: Plainfield Park District purchased the property with the intent to construct a multi- use paved bike trail that would connect an existing trail that ends adjacent south of the property north along the DuPage River corridor to Eaton Preserve Park, as indicated in the Park District’s 2016 Comprehensive Plan (Exhibit A-3) and original concept exhibit (Exhibit A-4). e.Resulting function of impacted areas: Because the project will construct a multi-use paved trail extension on the property as a minimization measure, the property will function as a recreational resource as originally intended by the Plainfield Park District. Photographs of the property’s existing conditions can be found in Appendix C. 4.Description of Efforts to Avoid, Minimize, and Mitigate or Enhance Resource a.Avoidance and minimization efforts made and benefits to resource: The Plainfield Park District has agreed to the acquisition and construction of the multi- use paved trail, and in an email dated April 23, 2020, concurred with and supports the measures to minimize harm and the assessment of de minimis impacts regarding the proposed project. Full property acquisition is proposed for the Plainfield Park District property, the project will construct a multi-use paved trail extension under the proposed bridge and preserve the original intended recreational use of the property. The multi-use paved trail extension will be constructed from an existing trail south of the property to the north through the property, wrapping west to connect to the proposed shared use trail to be constructed along the north side of 143rd Street. A permanent easement to the Plainfield Park District will be established to include the north-south portion of the trail extension to allow for trail maintenance and a future trail extension north by the Park District. Due to minimization measures of constructing a paved multi-use trail concurrently with the project and providing a permanent easement of the trail to the Park District, there is no adverse effect on the qualities or function and activities of the 4(f) property as originally intended by the Plainfield Park District. There will be no permanent interference with or adverse effects to the planned recreational activities, features, and/or attributes associated with the 4(f) property. b.Commitments for mitigation or enhancement: There are no commitments for mitigation or enhancement as a result of impact to the Section 4(f) resource. c.Description of the benefits to the resource by the proposed improvements: The project will build a multi-use paved trail on the property under the DuPage River bridge. The trail will extend the existing paved trail adjacent south of the property and will provide a pedestrian crossing point over the DuPage River by connecting to the proposed shared use trail to be constructed along the north side of 143rd Street. d.Statement that the state historic preservation office (IHPA) was contacted and responded that no historic properties will be impacted: Cultural clearance was acquired during the previous Phase I and Environmental Survey Request (ESR) in 2007. An updated ESR, including a request for cultural review, was submitted to IDOT on October 26, 2018. The updated cultural clearance was acquired on April 1, 2020. See Exhibit A-5 for Cultural Clearance. 5.Evidence of Opportunity for Public Review and Comment a.Type of public availability (internet posting, public meeting, mailers): A newspaper advertisement notifying the public of a public meeting and an opportunity to comment on the Section 4(f) impacts was published on September 3, 2019 and on September 17, 2019 in The Herald-News. The notice was also placed on a statewide public notice website and was also advertised on the Village’s website with informational materials (https://www.plainfield- il.org/pages/documents/SEP18_SEP2019_PlainfieldPublicInfoMeetingBoardscompres sed.pdf). An article seeking public input on the project was also published on the Plainfield Patch (https://patch.com/illinois/plainfield/plainfield-seeking-input-143rd- street-extension-plan) on October 3, 2019. A postcard mailing notifying the residents near the project corridor of a public meeting and an opportunity to comment on the Section 4(f) impacts was mailed on September 6, 2019. Copies of the publishing certification and the postcard mailing can be found in Appendix B. A public meeting was held on September 24, 2019 at Village Hall in Community Room A&B from 6:00 pm to 8:00 pm. The public meeting summary can be found in Appendix B. b.Date of action: September 24, 2019. c.Summary of comments: A summary of comments is located in the public meeting summary in Appendix B. d.Notification of OWJ of public availability and summary of comments: A meeting invite and notification was sent to the Plainfield Park District. The summary of comments and a copy of all comments received and Village responses was provided to the Plainfield Park District. The summary of comments, OWJ coordination letter and OWJ concurrence response are included in Appendix B. 6.Evidence of Coordination with Official(s) with Jurisdiction a.Meeting minutes and agendas: Meeting minutes detailing conversations between the Plainfield Park District and the Village of Plainfield are included in Appendix B. Plainfield Park District verbally agreed to the impact finding of de minimis use of their property and the proposed minimization measures during these meetings. b.Correspondence: The OWJ coordination letter was dated and sent to the Park District on March 20, 2020. The Plainfield Park District responded on April 23, 2020 that the District agrees with and supports the measures to minimize harm and the assessment of de minimis impacts regarding the project. Correspondence is included in Appendix B. c.OWJ written concurrence with a No Adverse Effect determination: Plainfield Park District verbally agreed to the impact finding of de minimis use of their property and the proposed minimization measures. Plainfield Park District provided a letter of intent dated August 26, 2020 to the City of Plainfield regarding the agreed upon Section 4(f) determination, minimization measures, and cost/easement responsibilities for the 4(f) recreational property and new trail. Formal concurrence from the Plainfield Park District of a de minimis impact to the property was received on April 23, 2020. The Letter of Intent and OWJ concurrence letter are provided in Appendix B. 7.Supporting Documentation a.Appendix A – Map of Project Area indicating relationship of project to resource 1.Location Map 2.Existing Conditions 3.Plainfield Park District Comprehensive Plan 4.Plainfield Park District Original Concept Exhibit 5.Proof of Cultural Clearance 6.Section 4(f) Impact Exhibits b.Appendix B – Public Hearings and Meeting Minutes 1.Public Meeting Publication Notice 2.Postcard Mailing 3.Public Meeting Summary 4.FHWA Coordination Meeting Minutes 5.Park District Meeting Minutes 6.OWJ Coordination 7.Park District Letter of Intent c.Appendix C – Supporting photographs of resource ā $SSHQGL[$ 143rd Street Extension Location Map - Will County, IL 0LOHV 6HUYLFH/D\HU&UHGLWV6RXUFHV(VUL+(5(*DUPLQ86*6,QWHUPDS,1&5(0(17315&DQ(VUL-DSDQ0(7,(VUL&KLQD+RQJ.RQJ(VUL.RUHD(VUL7KDLODQG 1*&&2SHQ6WUHHW0DSFRQWULEXWRUVDQGWKH*,68VHU&RPPXQLW\ Project Location ([KLELW$ DuPage R i v e r 'X 3 D J H 5 L Y H U 7 U D L O 143rd Street Extension - Plainfield, Will Co., IL PLAINFIELD PARK DISTRICT SECTION 4(F) PROPERTY - EXISTING CONDITIONS )HHW 33'I3URSHUW\IXOOWDNH (656WXG\/LPLWV ([KLELW$ &RPSUHKHQVLYH3DUNV 5HFUHDWLRQ0DVWHU3ODQ 3ODLQILHOG3DUN'LVWULFW &RPSUHKHQVLYH0DVWHU3ODQ $FFHVVWR7UDLOV ,QWKH3ODLQILHOG3DUN'LVWULFWDVLQPDQ\FRPPXQLWLHVDFURVVWKHFRXQWU\WUDLOVDUHUHFRJQL]HGDV YDOXDEOHDQGGHVLUDEOHHOHPHQWVRIDUHFUHDWLRQV\VWHP7KHIROORZLQJPDS0DSVKRZVH[LVWLQJ WUDLOVLQWKH'LVWULFWDVZHOODVSURSRVHGWUDLOVDVUHIOHFWHGLQWKH'LVWULFW*,6GDWDVHW5HVLGHQWVKDYHRQO\ OLPLWHGDFFHVVWRH[LVWLQJWUDLOV7KLVVWXG\LQGLFDWHVWKDWH[SDQGHGDFFHVVDQGDGGLWLRQDORSSRUWXQLWLHV DUHQHHGHG 0DS7UDLO$FFHVV ([KLELW$ Project Area 3ODLQILHOG3DUN'LVWULFW &RPSUHKHQVLYH0DVWHU3ODQ 2SSRUWXQLW\IRUWUDLOH[SDQVLRQVHHPVWRH[LVWZLWKLQWKH'LVWULFW3URSRVHGWUDLOVDORQJWKH'X3DJH 5LYHUDQGDORQJH[LVWLQJUDLOFRUULGRUVZRXOGHIIHFWLYHO\VHUYHDVFULWLFDOQRUWKVRXWKWUDLOVSLQHV7KLV DQDO\VLVLQGLFDWHVWKDWWKHVHPD\EHJRRGSULRULWLHVIRUIXWXUHSODQQLQJDQGFDSLWDOLPSURYHPHQW7KHVH FRUHWUDLOFRUULGRUVZRXOGEHFULWLFDOWROLQNSDUNVVFKRROVDQGRWKHUSXEOLFIDFLOLWLHVDVWKHWUDLOV\VWHP H[SDQGV $VDWUDLOV\VWHPPDWXUHVWKHQHHGHPHUJHVWRDGGUHVVEDUULHUVVXFKDVURDGZD\VZDWHUZD\VDQG UDLOURDGFURVVLQJVWKDWVHSDUDWHGLVWLQFWWUDLOQHWZRUNVLQRUGHUWRFUHDWHDWUXO\FRQQHFWHGWUDLOV\VWHP $WUDLOQHWZRUNLVDSDUWRIDWUDLOV\VWHPZLWKLQZKLFKPDMRUEDUULHUFURVVLQJVKDYHEHHQDGGUHVVHGDQG DOOWUDLOVDUHFRQQHFWHG7UDLOQHWZRUNVZLWKLQDJUHDWHUWUDLOV\VWHPDUHW\SLFDOO\VHSDUDWHGIURPHDFK RWKHUE\EDUULHUVRUE\PLVVLQJWUDLOFRQQHFWLRQV6LJQDOHGFURVVZDONVSHGHVWULDQXQGHUSDVVHVDQG EULGJHVFDQEHXVHGWRKHOSXVHUVQDYLJDWHEDUULHUV1HZWUDLOVPD\EHDGGHGWROLQNWUDLOQHWZRUNVDQG LPSURYHRYHUDOOFRQQHFWLYLW\ 0RVWFRPPXQLWLHVKDYHVHYHUDOWUDLOQHWZRUNVWKDWFRQQHFWXVHUVWRFRPPRQGHVWLQDWLRQVVXFKDV VFKRROVVKRSVUHVWDXUDQWVDQGFLYLFDQGUHOLJLRXVLQVWLWXWLRQVLQDGGLWLRQWRSDUNVDQGUHFUHDWLRQ IDFLOLWLHV7KHPRUHLQWHJUDWHGWKHVHQHWZRUNVWKHPRUHFRQQHFWHGDFRPPXQLW\2SSRUWXQLW\H[LVWVWR EHJLQEXLOGLQJDFRPSOHWHWUDLOV\VWHPLQWKH3ODLQILHOG3DUN'LVWULFW 3URSRVHGWUDLOVDORQJWKH'X3DJH 5LYHUDQGDORQJH[LVWLQJUDLOFRUULGRUVZRXOGHIIHFWLYHO\VHUYHDVFULWLFDOQRUWKVRXWKWUDLOVSLQHV DuPage R i v e r Existing Trail 143rd Street Extension - Plainfield, Will Co., IL PLAINFIELD PARK DISTRICT SECTION 4(F) PROPERTY - ORIGINALLY PLANNED TRAIL )HHW 33'I3URSHUW\IXOOWDNH 2ULJLQDO7UDLO)RRWSULQW ([KLELW$ To:Bureau of Local Roads Attn: William Raffensperger From: Jack Elston By: Brad Koldehoff Subject: Cultural Resources - No Historic Properties Affected Clearance Date: April 1, 2020 Will County FAU 0350, 143rd Street Plainfield Sec. 06-00040-00-FP Seq.13370D For the above referenced undertaking, IDOT’s qualified Cultural Resources staff hereby make a “No Historic Properties Affected”finding pursuant to Section 106 of the National Historic Preservation Act. This finding concludes the Section 106 process in accordance with the stipulations of the Programmatic Agreement Regarding Section 106 Implementation for Federal-Aid Transportation Projects in the State of Illinois, executed March 6, 2018 by FHWA, Illinois SHPO, IDOT and the Advisory Council on Historic Preservation. No further cultural resources coordination is required for this undertaking, unless design modifications or new information indicate that historic properties may be affected. If so, then, additional coordination with my office is required. Brad H. Koldehoff Cultural Resources Unit Chief Bureau of Design & Environment ([KLELW$ Cultural Resources Cleared for DA: Cleared for Letting: Submittal Date:Sequence No: 9LOODJHRI3ODLQILHOG Contract #: Route:)$8Marked: Street:UG6WUHHW Section:)3 District: Counties::LOO Municipalityies):3ODLQILHOG FromTo (At):,/5RXWHWR,/5RXWH Quadrangle:3ODLQILHOG Township-Range-Section:715(6 Anticipated DA: acres Project Length:km miles Acquisition of additional ROW or easement ha/ Proposed Work: Project Description:7KHSURMHFWOLPLWVKDYHPRYHGGXHWRWKHLQDELOLW\WRDFTXLUHULJKWRIZ D\IURP&RP(G Highw ay Bridge Funding: Bike Trail Other Federal State TBP MFT Local Non-MFT Anticipated Processing:&( Requesting Agency:/RFDO Job No.:3 ' Project No: Historic Bridges District Notified: District Notified: Sent for Survey ISAS:SHPO Concurrence: District Notified: Historic District Involved:Historic Building Involved: Architectural Photos Requested:Photos Received: Sent for Architectural Survey:SHPO Concurrence: Overall Cultural Resource Archaeological Resources District Notified: Sent for Archival Recordation:Substitute Bridge Identification: SHPO Submittal: Comments:3ULQWHGDQGJLYHQWR%.ROGHKRIIIRUUHYLHZ RQ.0%1RVXUYH\UHTXLUHGSHU%.ROGHKRII RQ6HQWWR%5RPDQIRUKLVWRULFUHYLHZ RQ.0%3HUP\HPDLOWR.0%LQ-DQ LQIRUPDWLRQRQWKHSDVWFOHDUDQFHVIRUWKLVSURMHFWLVQHHGHGWRPRYHIRUZDUG7KLVLVD\HDUROG SURMHFWZLWKSDVWFXOWXUDOUHYLHZ\HDUVDJR%5+LVWRULF5HVRXUFHV,QYQHWRU\+5,IRXQGQR DERYHJURXQG+3VSHUUHSRUWLQILOHDQGQRWHVRQ(657UDFNLQJ)RUP1+3$%5 Architectural Resources (Standing Structures) In-House Cultural Resources Clearance<HV In-House Archeology Only Clearance In-House Architectural Only Clearance In-House Historic Bridge Only Clearance Survey Target Date: D u P a g e R i v e r Existing Trail 143rd Street Extension - Plainfield, Will Co., IL PLAINFIELD PARK DISTRICT SECTION 4(F) PROPERTY - PROPOSED IMPACTS )HHW 33'I3URSHUW\IXOOWDNH 3URSRVHG33'(DVHPHQW 7UDLO([WHQVLRQ 6KDUHG8VH3DWK 5RDGZD\ 0HGLDQ %ULGJH3LHUV &XUE *XWWHU 5HWDLQLQJ:DOO ([KLELW$ c PROPOSED ROADWAY IMPROVEMENTS TO IL RTE 59 PROPOSED DUPAGE RIVER BRIDGE TO NAPERVILLE ROAD PROPOSED DUPAGE RIVER BRIDGE STEEL PLATE GIRDER PROPOSED BRIDGE ABUTMENT VAR. 89' TO 74' 0 EXISTING GROUND LINE PROPOSED PARK DISTRICT TRAIL EXTENSION VERTICAL CLEARANCE 10' VAR. 15' TO 29' STREAM BED TYPICAL SECTION UNDER BRIDGE (LOOKING NORTH) 1J - PROPOSED BRIDGE PIER DUPAGE RIVER NORMAL WATER LEVEL V CMT Liconse Mo. 180-000613 FILE NAME = D1143exh__River_Trzil_Typicsls.dgn DESIGNED - MJW REVISED - MODEL NAME = Exh,bxt DRAWN - MJW REVISED - PLOT SCALE = 20.0000 '/ CHECKED - CMC REVISED - PLOT DATE = 8/7/2019 (4:58:03 PM) DATE - 08/07/2019 REVISED - STATE OF ILLINOIS DEPARTMENT OF TRANSPORTATION 143RD STREET EXTENSION PLAINFIELD PARK DISTRICT SECTION 4(F) PROPERTY PROPOSED TYPICAL SECTION UNDER BRIDGE F.A.U. RTE. 0380 SECTION COUNTY TOTAL SHEETS SHEET NO. 06 -00040 -00 -FP WILL 160 SCALE: SHEET I OF 1 SHEETS STA. TO STA. CONTRACT NO. ILLINOIS FED. AID PROJECT $SSHQGL[% ([KLELW% The Village of Plainfield invites you to attend a public information meeting regarding the planning for the potential roadway extension of 143rd Street from Illinois Route 59 to Illinois Route 126 including a crossing of the DuPage River in Will County. The purpose of the meeting is to obtain public input on: • The proposed improvements • Section 4(f) impacts to the Plainfield Park District property along the DuPage River The section 4(f) document identifies impacts to the Plainfield Park District property along the DuPage River and efforts to avoid, minimize and mitigate or enhance the resource. Comments can be accepted through Tuesday, October 8, 2019 to become part of the public meeting record. Written comments can be sent to: 3BOEZ+FTTFO Plainfield Public Works 14400 Coil Plus Drive Plainfield, IL 60544 publicworks@goplainfield.com Any individual with a disability requesting a reasonable accommodation to participate in a city meeting should call (815) 436-7093 for coordination for ADA services. Persons planning to attend who will need a sign language interpreter or other similar accommodations should notify the TTY/TDD number 800.526,0844 or 711; TTY users (Spanish) (800) 501-0864 or 711; and for Telebraille dial 877.526.6670 at least five (5) days prior to the meeting. 143rd Street Extension Illinois Route 59 to Illinois Route 126PU PUBLIC INFORMATION MEETING Tuesday, September 24, 2019 6:00-8:00 P.M. You may stop by the open house Public Information Meeting anytime between 6:00 and 8:00 PM Village Hall Community Room 24401 Lockport Street Plainfield, IL 60544 ([KLELW% Plainfield Public Works 14400 Coil Plus Drive Plainfield, IL 60544 UG6W([WHQVLRQ ,/WR,/ )3 6(37(0%(538%/,&,1)250$7,210((7,1* 6800$5< General Information 7KHILUVWSXEOLFPHHWLQJIRUWKH3KDVH,$GGHQGXPIRUWKHUG6WUHHW([WHQVLRQEHWZHHQ,/ DQG,/ZDVKHOGRQ7XHVGD\6HSWHPEHUDWWKH9LOODJHRI3ODLQILHOG9LOODJH+DOO &RPPXQLW\5RRP/RFNSRUW6WUHHW3ODLQILHOG,/IURPWR307KH PHHWLQJZDVFRQGXFWHGLQDQRSHQKRXVHIRUPDW $WWHQGHHVVLJQHGLQDQGUHYLHZHGERDUGVDQGVWULSPDSVRIUHJDUGLQJWKHSURMHFW7KHH[KLELW ERDUGVLQFOXGHGPHHWLQJSXUSRVHSURMHFWORFDWLRQDQGGHVFULSWLRQSURMHFWSURFHVVSXUSRVH DQGQHHGSURMHFWKLVWRU\VFKHGXOHFRVWVDQGIXQGLQJVWDNHKROGHUPHHWLQJVWRGDWHDOLJQPHQW VKLIWDOWHUQDWLYHDQDO\VLVUHQGHULQJVDQGW\SLFDOVHFWLRQVDWWKH%DVV *LOO&OXEHQYLURQPHQWDO VWXG\DQGSUHOLPLQDU\HQYLURQPHQWDOLPSDFWV6HFWLRQISXEOLFO\RZQHGSDUNVEHVW PDQDJHPHQWSUDFWLFHVIRUVWRUPZDWHUQRLVHDQDO\VLVODQGDFTXLVLWLRQ±W\SHVSURFHVVDQG VFKHGXOHQH[WVWHSVDQGKRZWRVXEPLWFRPPHQWV7KHUHZHUHWZRVWULSPDSVZLWKRQH VKRZLQJWKHSURSRVHGURDGZD\EULGJHDQGGUDLQDJHLPSURYHPHQWVZLWKDQWLFLSDWHGJUDGLQJ OLPLWVRYHUODLGRQDQDHULDOLPDJH7KHRWKHUVWULSPDSVKRZHGWKHSUHOLPLQDU\ODQGDFTXLVLWLRQ DUHDVGLVWLQJXLVKHGE\ODQGDFTXLVLWLRQW\SHRYHUODLGRQDQDHULDOLPDJH $WWHQGHHVZHUHSURYLGHGDQRSSRUWXQLW\WRVSHDNZLWKUHSUHVHQWDWLYHVIURPWKH9LOODJHRI 3ODLQILHOGLQFOXGLQJWKH3XEOLF:RUNV'LUHFWRU6XSHULQWHQGHQWRI3XEOLF:RUNVDQG/HDG (QJLQHHUDQGWKHLUHQJLQHHULQJFRQVXOWDQWLQFOXGLQJVHYHQPHPEHUVRIWKHSURMHFWWHDP LQFOXGLQJWUDIILFHQYLURQPHQWDOQRLVHDQGODQGDFTXLVLWLRQVWDII Attendees 7KHPHHWLQJZDVDWWHQGHGE\SHRSOHLQFOXGLQJSURMHFWWHDPPHPEHUV+DUU\%HQWRQ9LOODJH 7UXVWHHZDVLQDWWHQGDQFH6SHFLILFUHSUHVHQWDWLYHVLGHQWLILHGLQWKHVLJQLQVKHHWLQFOXGHG &RP(GDQGWKH3XUH5RG *XQ&OXE1RPHGLDLVNQRZQWRKDYHDWWHQGHGWKHPHHWLQJ Comments 4XHVWLRQVDQGFRPPHQWVZHUHUHFHLYHGIURPUHVSRQGHQWVEHIRUHGXULQJDQGDIWHUWKH PHHWLQJ6SHFLILFDJHQFLHVWKDWFRPPHQWHGEXWGLGQRWDWWHQGWKHPHHWLQJLQFOXGHGWKH :HVWHUQ:LOO&RXQW\&RPPXQLFDWLRQ&HQWHU:(6&20:LOO&RXQW\&HQWHUIRU(FRQRPLF 'HYHORSPHQWDQGWKH&RQWUDFWRUV$VVRFLDWLRQRI:LOODQG*UXQG\&RXQWLHV&$:*&6HH DWWDFKHGVXPPDU\FKDUW $SSUR[LPDWHO\RIWKHUHVSRQGHQWVFRPPHQWHGLQVXSSRUWRIWKHSURSRVHGLPSURYHPHQWV 2IWKRVHZKRYRLFHGVXSSRUWIRUWKHSURMHFWWKHLUFRQFHUQVZLWKWKHH[LVWLQJFRQGLWLRQVLQFOXGHG WUDIILFFRQJHVWLRQLQDGHTXDWHLQIUDVWUXFWXUHWRDFFRPPRGDWHWUXFNVFRQJHVWLRQZLWKDWJUDGH UDLOFURVVLQJVVDIHW\DQGTXDOLW\RIOLIH7KH\DOVRQRWHGWKHEHQHILWRIWKHELNHWUDLOVDQGWKH VPDOOSURSRUWLRQRIWKH9LOODJHVKDUHRIWKHIXQGLQJWRWKHRYHUDOOSURMHFWFRVW 7KHWRSWKUHHFRQFHUQVLGHQWLILHGE\UHVSRQGHQWVZHUHWUDIILFWUXFNVDQGQRLVHZLWK DQGRIWKHUHVSRQGHQWVUHVSHFWLYHO\)RUWUDIILFDQGWUXFNVLWVKRXOGEHQRWHGWKDWWKLV LQFOXGHVWKRVHERWKVXSSRUWLQJWKHLPSURYHPHQWVWRIL[WKHWUDIILFDQGWUXFNSUREOHPDQGWKRVH ([KLELW% UG6W([WHQVLRQ ,/WR,/ )3 6(37(0%(538%/,&,1)250$7,210((7,1* 6800$5< RSSRVHGWRWKHLPSURYHPHQWVEHFDXVHWKH\WKLQNLWHLWKHUGRHVQ¶WDGGUHVVWKHH[LVWLQJSUREOHPV RUFUHDWHVPRUHSUREOHPV1RQHRIWKHUHVSRQGHQWVLQGLFDWHGWKDWWKHUHZDVQ¶WDQH[LVWLQJ WUDIILFSUREOHP,WVKRXOGEHQRWHGWKDWWKHQRLVHDQDO\VLVLVVWLOOEHLQJFRPSOHWHGVRQRWDOO TXHVWLRQVUHJDUGLQJSRWHQWLDOQRLVHPLWLJDWLRQFRXOGEHDQVZHUHGDWWKHPHHWLQJ $SSUR[LPDWHO\RIUHVSRQGHQWVKDGTXHVWLRQVDQGFRQFHUQVUHJDUGLQJSODQQLQJ]RQLQJDQG HFRQRPLFGHYHORSPHQW7KHVHLQFOXGHGWKHFRUSRUDWHOLPLWVDQQH[DWLRQFRPSUHKHQVLYHSODQ ]RQLQJZDUHKRXVHVDQGLQGXVWU\ 7KHQH[WWLHURIUHVSRQGHQWVIURPGRZQWRZHUHFRQFHUQHGZLWK x SURSHUW\LPSDFWVDQGSURSHUW\YDOXHVGLPLQLVKLQJ x ZDWHUTXDOLW\JURXQGZDWHUWKHZDWHUWDEOHVZHOOVDQGVHSWLF x ZLOGOLIH x VDIHW\ x IORRGLQJHURVLRQFRQWURO x FRVWIXQGLQJDQGVFKHGXOH x TXDOLW\RIOLIH x ELF\FOHVSHGHVWULDQVDQGWUDLOV 7KHQH[WWLHURIUHVSRQGHQWVEHORZZHUHFRQFHUQHGZLWK x WUDLQVDQGDWJUDGHFURVVLQJV x GLVSODFHPHQWV x DLUTXDOLW\ x ZHWODQGVDQGJUHHQVSDFH x PDLQWHQDQFHDQGOLWWHUUHPRYDO x SDUNLQJLQWKHGRZQWRZQ x HPHUJHQF\YHKLFOHUHVSRQVHDQGWUDQVSRUW x IXHOFRQVXPSWLRQ x FULPH 0%10%20%30%40%50%60%70%80%%ofRespondentsIdentifyingParticularConcerns Page 1 of 4 MEETING MINUTES Transmitted via email November 20, 2018 CMT No. 16242-02-00 Project: Village of Plainfield 143 rd Street Extension Phase II CMT No.: 16242-02-00-17 Section No.: 06-00040-00-FP Project No.: M9003 (273) Location: IDOT D1 Schaumburg 4th Floor Executive Conference Room Date: September 18, 2018 Time: 10:45 AM Subject: FHWA Coordination Meeting Attendees: See attached sign-in sheet Please review the attached REVISED minutes, if our understanding of the information exchange as presented in these notes is different from yours kindly inform us so we can revise accordingly. Should we not here from you within one (1) weeks’ time we will consider these notes correct as presented. Signed Charles M. “Tice” Cole, P.E., PTOE ([KLELW% Page 2 of 4 MEETING MINUTES Transmitted via email November 20, 2018 CMT No. 16242-02-00 1. Introduction and Project Updates a. The Village of Plainfield (Village) introduced the project to the meeting attendees. The Village stated that further Phase II coordination with ComEd resulted in the originally approved alignment through ComEd’s property being no longer feasible to ComEd due to recent changes regulatory changes pertaining to electricity generation and transmission. The Village proposed to shift the alignment to the north to avoid the permanent parallel impacts to the ComEd corridor. b. The Village restated the possibility of moving IL Route 126 onto the future segment of 143rd Street per the letter from IDOT dated November 3, 2005. Plainfield has been working to implement a plan to move Illinois Route 126 out of downtown Plainfield. The Village stated they would pursue implementation and maintenance of this needed local and regional transportation asset even if IDOT did not ultimately end up taking jurisdiction. The Village indicated that while the western portions of 143 rd Street (west of Steiner Road) would need to be constructed to fully complete the IL Route 126 reroute, an interim jurisdictional transfer could occur between existing IL 126 and Wallin Drive. Wallin Drive between Lockport Street and 143 rd Street would become IL 126 in the interim. Wallin Drive was previously designated US 30, before US 30 was rerouted to 143rd Street and IL 59. c. CMT presented a strip map exhibit showing the originally approved alignment and the proposed alignment to the north. CMT also presented a table of environmental impacts comparing the originally approved alignment to the proposed alignment. d. The Village noted the project has been awarded $20,328,000 in IL Competitive Freight funds for construction of the project. The grant funds will be available in the federal fiscal year 2022 (beginning October 1, 2021). FHWA noted that this is based upon planned future programming of this fund type and it is not a grant. IDOT asked about the anticipated letting date. The Village stated that a November 2021 letting is scheduled in conjunction with the anticipated ICF funds. 2. Logical Termini FHWA and IDOT concurred with the logical termini of west of IL 59 and east of IL 126. 3. Scope of Work a. Due to the intended jurisdictional transfer, IDOT requested following BDE criteria for a minor arterial. b. Due to the intended jurisdictional transfer and following BDE criteria, IDOT requested the complete streets policy be followed. IDOT further clarified that the complete streets policy does not require the bicycle and pedestrian accommodations to be within state ROW. The section of 143rd Street between Naperville Road and IL 126 could have a shared use path on ComEd property to minimize impacts to the Bass & Gill club. c. FHWA and IDOT concurred with the scope of work as indicated in the proposed concept plan. Page 3 of 4 MEETING MINUTES Transmitted via email November 20, 2018 CMT No. 16242-02-00 4. Environmental a. CMT noted that the shift in the alignment moved the improvements significantly out of the West Norman Drain and adjacent wetlands. This substantially reduces both permanent and temporary surface water impacts. The original PDR anticipated an individual permit from the USACE due to the magnitude of the original alignment impacts. The new alignment is expected to result in less than the 1.0 acre threshold of permanent surface water impacts which is eligible under the Chicago District Regional Permit Program. In is anticipated that no individual 404 or individual 401 water quality certification will be required. CMT will be holding a preapplication meeting with USACE soon. CMT noted the anticipated schedule can accommodate an individual or regional permit. b. CBLRS asked about Section 4(f) impacts. CMT stated that the originally approved PDR had none; however, the Plainfield Park District (separate from Village) purchased the back half of the storage facility, between the facility and the river, for the intent of eventually extending the river trail along the west side of the DuPage river (as described in the approved Plainfield Park District Comprehensive Plan). This property was separated from the storage facility property and purchased by the Park District after Phase I was approved. Both the originally approved alignment and the revised alignment would impact the entire parcel, accommodate the future river trail (bridge span over it), and preserve a connection between the proposed 143rd Street Bridge over the river to the future river trail. IDOT requested a drawing showing the clear limits of the property, what is being taken and what the remainder is, and a description of the taking purpose. CMT shall provide this information. IDOT will determine if a de minimis impact finding will be the appropriate 4(f) finding. c. The conceptual exhibit shows potential impacts for the first and second homes at the northeast quadrant of Naperville Road and proposed 143 rd Street. The first home, closest to 143rd Street, will likely be a total acquisition based upon the proposed alignment. The second home will likely have the separate garage impacted by the proposed alignment. IDOT requested the ESR limits completely cover both these properties to cover the second home if it becomes a complete acquisition. A total acquisition of the second home will be determined during the intersection design, row impact analysis, and appraisal process. d. IDOT requested an Environmental Survey Request (ESR) be submitted as soon as possible. IDOT requested a copy of the wetland delineation from 2016 be included with the ESR submittal. CMT shall prepare the ESR for submittal. IDOT also requested an updated wetland impact evaluation. e. IDOT stated the wetland delineation would be valid for 5 years. f. IDOT requested an updated noise analysis. g. IDOT requested an updated COSIM screening including both the total ADT and highest DHV. Page 4 of 4 MEETING MINUTES Transmitted via email November 20, 2018 CMT No. 16242-02-00 h. IDOT asked if the filling of the floodplain at the Bass & Gill club would raise the floodplain by 1 foot. CMT stated an analysis would need to be performed to answer that question. CMT shall include this analysis with the Phase I update scope of work. i. IDOT asked if the fishing club was privately owned. The Village confirmed it is. Therfore, this property is not eligible for Section 4(f) protections. j. IDOT asked if the previous public meetings included the IL 126 reroute. After the meeting Huff & Huff and CMT demonstrated that this was included in the 2011 approved ECAD and presented at previous public meetings. IDOT stated no public hearing was required at this time. k. IDOT stated a public information meeting would be required for the alignment shift. l. IDOT and FHWA agreed that the revisions to the roadway alignment shall proceed as a federally approved categorical exclusion. Environmental impacts will be documented in the amended Project Development Report (PDR). 5. Updates to the Design/Report a. The originally approved sidewalk on the north side of the bridge over the DuPage River will be changed to a shared use path to meet IDOT policy. b. IDOT requested 2050 CMAP traffic projections in the updated report. The I-55 interchanges are not included within the official model. c. IDOT noted the new design vehicle requirements, per the latest BDE Procedure Memoranda, regarding WB 65 vehicles being able to make turns at intersection of two state designated truck routes with encroachment. Also, updated design vehicle requirements regarding the single unit truck and the school bus. d. IDOT requested traffic signal warrants for the three intersections (IL 59, Naperville Road, IL 126). IDOT requested an analysis of signals being warranted within 5 years of construction. e. IDOT stated that BDE Programming will handle all design exceptions. f. IDOT requested the PDR update report be started over with BLR 22210 instead of a technical memorandum update. Page 1 of 4 0((7,1*0,187(6 7UDQVPLWWHGYLDHPDLO1RYHPEHU &071R WƌŽũĞĐƚ͗ sŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚϭϰϯ ƌĚ^ƚƌĞĞƚǆƚĞŶƐŝŽŶWŚĂƐĞ// DdEŽ͗͘ ϭϲϮϰϮͲϬϮͲϬϬͲϭϳ ^ĞĐƚŝŽŶEŽ͗͘ ϬϲͲϬϬϬϰϬͲϬϬͲ&W WƌŽũĞĐƚEŽ͗͘ DϵϬϬϯ;ϮϳϯͿ >ŽĐĂƚŝŽŶ͗ WůĂŝŶĨŝĞůĚWƵďůŝĐtŽƌŬƐ ĂƚĞ͗ KĐƚŽďĞƌϰ͕ϮϬϭϴ dŝŵĞ͗ ϭ͗ϯϬWD ^ƵďũĞĐƚ͗ WĂƌŬŝƐƚƌŝĐƚ^ƚĂŬĞŚŽůĚĞƌDĞĞƚŝŶŐ $WWHQGHHV ůůĞŶWĞƌƐŽŶƐsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚ ZĂŶĚǇ:ĞƐƐĞŶsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚ ^ĐŽƚƚdŚƌĞĞǁŝƚƚsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚ ĂƌůŽĂƉĂůďŽWůĂŝŶĨŝĞůĚWĂƌŬŝƐƚƌŝĐƚ :ĞŶŶŝĨĞƌZŽŽŬƐͲ>ŽƉĞǌWůĂŝŶĨŝĞůĚWĂƌŬŝƐƚƌŝĐƚ dŝĐĞŽůĞDd 3OHDVH UHYLHZ WKH DWWDFKHG PLQXWHV LI RXU XQGHUVWDQGLQJ RI WKH LQIRUPDWLRQ H[FKDQJH DV SUHVHQWHGLQWKHVHQRWHVLVGLIIHUHQWIURP\RXUVNLQGO\LQIRUPXVVRZHFDQUHYLVHDFFRUGLQJO\ 6KRXOGZHQRWKHUHIURP\RXZLWKLQRQHZHHNV¶WLPHZHZLOOFRQVLGHUWKHVHQRWHVFRUUHFWDV SUHVHQWHG 6LJQHG &KDUOHV0³7LFH´&ROH3(372( ([KLELW% Page 2 of 4 0((7,1*0,187(6 7UDQVPLWWHGYLDHPDLO1RYHPEHU &071R ϭ͘ DĞĞƚŝŶŐWƵƌƉŽƐĞ ŽŽƌĚŝŶĂƚĞǁŝƚŚƐƚĂŬĞŚŽůĚĞƌ͕WůĂŝŶĨŝĞůĚWĂƌŬŝƐƚƌŝĐƚ͕ƌĞŐĂƌĚŝŶŐƉƌŽũĞĐƚĂŶĚƐĞĐƚŝŽŶϰ;ĨͿŝŵƉĂĐƚƐ͘ ŽŽƌĚŝŶĂƚĞǁŝƚŚWĂƌŬŝƐƚƌŝĐƚƌĞŐĂƌĚŝŶŐƚŚĞŝƌŶĞǁůǇĂĐƋƵŝƌĞĚ;ĂĨƚĞƌϭϰϯƌĚ^ƚƌĞĞƚWŚĂƐĞ/^ƚƵĚǇ ŽŵƉůĞƚŝŽŶͿƉƌŽƉĞƌƚǇďĞŚŝŶĚƚŚĞhͲ^ƚŽƌĞͲ/ƚĨĂĐŝůŝƚǇĂůŽŶŐƚŚĞƵWĂŐĞZŝǀĞƌ͘ŽŽƌĚŝŶĂƚĞĨƵƚƵƌĞ ďŝĐǇĐůĞĂŶĚƉĞĚĞƐƚƌŝĂŶƉůĂŶƐ͘ Ϯ͘ /ŶƚƌŽĚƵĐƚŝŽŶĂŶĚKǀĞƌǀŝĞǁ dŚĞsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚĞǆƉůĂŝŶĞĚƐŽŵĞŽĨƚŚĞďĂĐŬŐƌŽƵŶĚŽĨƚŚĞƉƌŽũĞĐƚ͘ WůĂŝŶĨŝĞůĚŚĂƐĞŶƚĞƌĞĚŝŶƚŽĂŶŐƌĞĞŵĞŶƚǁŝƚŚƚŚĞ^ƚĂƚĞŽĨ/ůůŝŶŽŝƐƚŽƵƐĞĨĞĚĞƌĂůĨƵŶĚƐƚŽƐƚƵĚǇ͕ ĚĞƐŝŐŶĂŶĚĐŽŶƐƚƌƵĐƚĂŶĞǁƐƚƌĞĞƚŬŶŽǁŶĂƐϭϰϯƌĚ^ƚƌĞĞƚďĞƚǁĞĞŶ/ůůŝŶŽŝƐZŽƵƚĞϱϵĂŶĚ/ůůŝŶŽŝƐ ZŽƵƚĞϭϮϲ;ƚŚĞWƌŽũĞĐƚͿ͘ƌĞƉŽƌƚǁĂƐƉƌĞƉĂƌĞĚĨŽƌƚŚĞƉƌŽũĞĐƚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚ/KdĂŶĚ &,tƉŽůŝĐŝĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐĂŶĚǁĂƐĂƉƉƌŽǀĞĚďǇ/KdŽŶĞĐĞŵďĞƌϭϳ͕ϮϬϭϰ͘KŶDĂƌĐŚϵ͕ ϮϬϭϲĨŽƌWůĂŝŶĨŝĞůĚĂƉƉƌŽǀĞĚĂĐŽŶƚƌĂĐƚƚŽďĞŐŝŶĐŽŶƐƚƌƵĐƚŝŽŶƉůĂŶƐĂŶĚůĂŶĚĂĐƋƵŝƐŝƚŝŽŶĨŽƌƚŚĞ ƉƌŽũĞĐƚ͘ƵƌŝŶŐƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶƉůĂŶƉƌĞƉĂƌĂƚŝŽŶƉƌŽĐĞƐƐ͕WůĂŝŶĨŝĞůĚǁĂƐŝŶĨŽƌŵĞĚďǇ ŽŵŵŽŶǁĞĂůƚŚĚŝƐŽŶ;ŽŵĚͿƚŚĂƚƚŚĞŽƌŝŐŝŶĂůůǇĂƉƉƌŽǀĞĚĂůŝŐŶŵĞŶƚƚŚĂƚǁĂƐƚŽŽĐĐƵƉǇĂ ƉŽƌƚŝŽŶŽĨŽŵĚ͛ƐƉƌŽƉĞƌƚǇ͕ŝƐŶŽůŽŶŐĞƌĨĞĂƐŝďůĞĚƵĞƚŽƌĞĐĞŶƚŵĂƌŬĞƚĂŶĚƌĞŐƵůĂƚŽƌǇĐŚĂŶŐĞƐ ƉĞƌƚĂŝŶŝŶŐƚŽĞůĞĐƚƌŝĐŝƚǇŐĞŶĞƌĂƚŝŽŶĂŶĚƚƌĂŶƐŵŝƐƐŝŽŶ͘ WůĂŝŶĨŝĞůĚĂŶĚ/KdƌĞƉƌĞƐĞŶƚĂƚŝǀĞƐŵĞƚ:ƵůǇϭϳ͕ϮϬϭϴƚŽƌĞǀŝĞǁƚŚĞƉƌŽũĞĐƚŽƉƚŝŽŶƐŝŶƌĞƐƉŽŶƐĞ ƚŽŽŵĚ͛ƐƉŽƐŝƚŝŽŶ͘/KdĂŶĚWůĂŝŶĨŝĞůĚŵƵƚƵĂůůǇĂŐƌĞĞĚŝƚǁŽƵůĚďĞŶĞĐĞƐƐĂƌǇƚŽŵŽǀĞƚŚĞ ƉƌŽƉŽƐĞĚƌŽĂĚǁĂǇĨĂĐŝůŝƚŝĞƐŽƵƚŽĨŽŵĚƉƌŽƉĞƌƚǇ͘WůĂŝŶĨŝĞůĚĂŶĚDdŚĂǀĞĐŽŶƐŝĚĞƌĞĚƚŚŽƐĞ ŽƉƚŝŽŶƐĂŶĚĚĞƚĞƌŵŝŶĞĚƚŚĂƚƐŚŝĨƚŝŶŐƚŚĞĂůŝŐŶŵĞŶƚƚŽƚŚĞŶŽƌƚŚĐĂŶĂǀŽŝĚƚŚĞƉĞƌŵĂŶĞŶƚ ƉĂƌĂůůĞůŝŵƉĂĐƚƐƚŽƚŚĞŽŵĚĐŽƌƌŝĚŽƌ͘WůĂŝŶĨŝĞůĚǁŝůůďĞĂŵĞŶĚŝŶŐƚŚĞƐƚƵĚǇƌĞƉŽƌƚĂŶĚ ƌĞĂĐŚŝŶŐŽƵƚƚŽƐƚĂŬĞŚŽůĚĞƌƐĂƐƉĂƌƚŽĨƚŚĞƐƚƵĚǇƵƉĚĂƚĞ͘DdŶŽƚĞĚƚŚĂƚǁŝƚŚƚŚĞWĂƌŬ ŝƐƚƌŝĐƚ͛ƐĂĐƋƵŝƐŝƚŝŽŶŽĨƚŚŝƐƉƌŽƉĞƌƚǇĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͕ƚŚĞƉƌŽƉĞƌƚǇǁŽƵůĚŚĂǀĞďĞĞŶŝŵƉĂĐƚĞĚ ǁŝƚŚďŽƚŚƚŚĞŽƌŝŐŝŶĂůĂůŝŐŶŵĞŶƚĂŶĚƚŚĞƐŚŝĨƚĞĚĂůŝŐŶŵĞŶƚ͘ŽƚŚǁŽƵůĚƉƌĞƐĞƌǀĞƚŚĞWĂƌŬ ŝƐƚƌŝĐƚ͛ƐĂďŝůŝƚǇƚŽŝŵƉůĞŵĞŶƚĂŶĞǆƚĞŶƐŝŽŶŽĨƚŚĞƵWĂŐĞZŝǀĞƌdƌĂŝůƵŶĚĞƌƚŚĞƉƌŽƉŽƐĞĚďƌŝĚŐĞ͘ ϯ͘ ZĞĨĞƌĞŶĐĞʹƵWĂŐĞZŝǀĞƌdƌĂŝů &ƌŽŵsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶ ^ĞĞǆŚŝďŝƚ͘dŚĞƵWĂŐĞZŝǀĞƌdƌĂŝůŝƐĂŶŝŵƉŽƌƚĂŶƚƌĞŐŝŽŶĂůƚƌĂŝůǁŝƚŚŝŶƚŚĞƉůĂŶŶŝŶŐĂƌĞĂ͘/ƚŝƐ ƉůĂŶŶĞĚƚŽƌƵŶĐŽŶƚŝŶƵŽƵƐůǇĨƌŽŵEĂƉĞƌǀŝůůĞƚŽƚŚĞ/ΘDĂŶĂůdƌĂŝůŝŶŚĂŶŶĂŚŽŶ͘ŽŵƉůĞƚŝŽŶ ŽĨƚŚŝƐƚƌĂŝůŝƐĂŐŽĂůŽĨƚŚĞWůĂŝŶĨŝĞůĚWĂƌŬŝƐƚƌŝĐƚ͘dŚĞƚƌĂŝůǁŝůůƌƵŶƚŚƌŽƵŐŚƚŚĞŚĞĂƌƚŽĨƚŚĞ sŝůůĂŐĞ͕ĐŽŶŶĞĐƚŝŶŐĚŽǁŶƚŽǁŶǁŝƚŚƐƵƌƌŽƵŶĚŝŶŐŶĞŝŐŚďŽƌŚŽŽĚƐĂŶĚƌĞĐƌĞĂƚŝŽŶĂůĂŵĞŶŝƚŝĞƐůŝŬĞ DĂƚŚĞƌtŽŽĚƐ͕^ĞƚƚůĞƌ͚ƐWĂƌŬĂŶĚĂƚŽŶWƌĞƐĞƌǀĞ͘DĂŶǇƐĞĐƚŝŽŶƐĂůŽŶŐƚŚŝƐƚƌĂŝůĂƌĞĐƵƌƌĞŶƚůǇ ŝŶĐŽŵƉůĞƚĞ͘dŚĞWĂƌŬŝƐƚƌŝĐƚŚĂƐďĞĞŶĂĐƚŝǀĞůǇƐĞĞŬŝŶŐŐƌĂŶƚƐƚŽĂƐƐŝƐƚŝŶƚƌĂŝůĐŽŵƉůĞƚŝŽŶ͘ tŚŝůĞŽƵƚƐŝĚĞƚŚĞƉůĂŶŶŝŶŐĂƌĞĂ͕ĨƵƚƵƌĞĐŽŶŶĞĐƚŝŽŶƐŽĨƚŚĞƚƌĂŝůŶĞƚǁŽƌŬƚŽƚŚĞƐƵƌƌŽƵŶĚŝŶŐƚƌĂŝů ƐǇƐƚĞŵƐŽĨtŝůůĂŶĚ<ĞŶĚĂůůŽƵŶƚǇĂƌĞƌĞĐŽŐŶŝǌĞĚĂŶĚŝŶĚŝĐĂƚĞĚŽŶƚŚĞƚƌĂŝůƐŵĂƉ͘ Page 3 of 4 0((7,1*0,187(6 7UDQVPLWWHGYLDHPDLO1RYHPEHU &071R ϰ͘ WƌĞǀŝŽƵƐ/ŵƉƌŽǀĞŵĞŶƚƐͬĐĐŽŵŵŽĚĂƚŝŽŶƐǁŝƚŚƚŚĞKƌŝŐŝŶĂů ĂůŝŐŶŵĞŶƚ ^ĞĞǆŚŝďŝƚ͘DdƐƚĂƚĞĚƚŚĂƚƚŚĞŽƌŝŐŝŶĂůƉůĂŶǁĂƐƚŽƉƌĞƐĞƌǀĞĂĨƵƚƵƌĞƉĞĚĞƐƚƌŝĂŶĐŽŶŶĞĐƚŝŽŶ ŽǀĞƌƚŚĞƵWĂŐĞZŝǀĞƌǁŝƚŚƚŚĞŶĞǁďƌŝĚŐĞĂŶĚƚŽƉƌĞƐĞƌǀĞĂĨƵƚƵƌĞĞǆƚĞŶƐŝŽŶŽĨƚŚĞƵWĂŐĞ ZŝǀĞƌdƌĂŝůƚŽƚŚĞŶŽƌƚŚ͘^ƉĞĐŝĨŝĐĂůůǇ͕ƚŚĞƌĞǁŽƵůĚďĞĂƐŝĚĞǁĂůŬĨĂĐŝůŝƚǇĂĚĚĞĚƚŽƚŚĞŶŽƌƚŚƐŝĚĞ ŽĨƚŚĞƉƌŽƉŽƐĞĚďƌŝĚŐĞƚŽĂĐĐŽŵŵŽĚĂƚĞƉĞĚĞƐƚƌŝĂŶƐ͘/ƚǁŽƵůĚďĞƐĞƉĂƌĂƚĞĚĨƌŽŵǀĞŚŝĐƵůĂƌ ƚƌĂĨĨŝĐďǇĂďĂƌƌŝĞƌǁĂůů͘ƐƉĂƌƚŽĨƚŚĞŝŵƉƌŽǀĞŵĞŶƚƐ͕ƉƌŽƉĞƌƚǇǁŽƵůĚďĞĂĐƋƵŝƌĞĚĨƌŽŵhͲ^ƚŽƌĞͲ /ƚ͕ŝŶĐůƵĚŝŶŐĂƐŵĂůůƉŝĞĐĞƚŚĂƚŚĂƐŶŽǁďĞĞŶĚŝǀŝĚĞĚĂŶĚƉƵƌĐŚĂƐĞĚďǇƚŚĞWĂƌŬŝƐƚƌŝĐƚ͘/Ŷ ĂĚĚŝƚŝŽŶ͕ƚŚĞƌĞŵĂŝŶĚĞƌŽĨƚŚĞƉƌŽƉĞƌƚǇĚŝǀŝĚĞĚĂŶĚƉƵƌĐŚĂƐĞĚďǇƚŚĞWĂƌŬŝƐƚƌŝĐƚǁĂƐƉůĂŶŶĞĚ ĨŽƌĂƉĞƌŵĂŶĞŶƚĚƌĂŝŶĂŐĞĞĂƐĞŵĞŶƚƚŽĐŽŶƐƚƌƵĐƚĐŽŵƉĞŶƐĂƚŽƌǇƐƚŽƌĂŐĞĨŽƌĨŝůůŝŶŐŝŶƚŚĞ ĨůŽŽĚƉůĂŝŶŽĨƚŚĞƵWĂŐĞZŝǀĞƌ͘ĂƌƚŚǁŽƌŬŐƌĂĚŝŶŐƚŽƉƌŽǀŝĚĞĂĐŽŶŶĞĐƚŝŽŶĨƌŽŵƚŚĞƐŝĚĞǁĂůŬĂƚ ƚŚĞǁĞƐƚĞŶĚŽĨƚŚĞďƌŝĚŐĞƚŽƚŚĞĨƵƚƵƌĞƵWĂŐĞZŝǀĞƌdƌĂŝůĐŽƵůĚďĞĐŽŵƉůĞƚĞĚďǇƚŚĞWĂƌŬ ŝƐƚƌŝĐƚŝŶĐŽŶũƵŶĐƚŝŽŶǁŝƚŚƚŚĞĞǆƚĞŶƐŝŽŶŽĨƚŚĞƵWĂŐĞZŝǀĞƌdƌĂŝů͘ ϱ͘ WƌŽƉŽƐĞĚ/ŵƉƌŽǀĞŵĞŶƚƐͬĐĐŽŵŵŽĚĂƚŝŽŶƐǁŝƚŚƚŚĞ^ŚŝĨƚĞĚ ůŝŐŶŵĞŶƚ ^ĞĞǆŚŝďŝƚ͘DdƐƚĂƚĞĚƚŚĂƚƚŚĞŵŽƐƚƌĞĐĞŶƚĐŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚƚŚĞ/ůůŝŶŽŝƐĞƉĂƌƚŵĞŶƚŽĨ dƌĂŶƐƉŽƌƚĂƚŝŽŶĂŶĚ&ĞĚĞƌĂů,ŝŐŚǁĂǇĚŵŝŶŝƐƚƌĂƚŝŽŶǁŽƵůĚŶĞĐĞƐƐŝƚĂƚĞƚŚĞŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨ ƚŚĞĐŽŵƉůĞƚĞƐƚƌĞĞƚƐƉŽůŝĐǇĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘dŚĞƐŝĚĞǁĂůŬŽŶƚŚĞŶŽƌƚŚƐŝĚĞŽĨƚŚĞďƌŝĚŐĞ ǁŽƵůĚďĞĐŽŵĞĂďŝŬĞƉĂƚŚ͘tŝƚŚƚŚĞƐŚŝĨƚŝŶƚŚĞĂůŝŐŶŵĞŶƚ͕ƚŚĞŝŵƉƌŽǀĞŵĞŶƚƐŽŶƚŚĞWĂƌŬ ŝƐƚƌŝĐƚWƌŽƉĞƌƚǇǁŽƵůĚŝŶĐůƵĚĞƚŚĞϭϰϯƌĚ^ƚƌĞĞƚƌŝĚŐĞŽǀĞƌƚŚĞƵWĂŐĞZŝǀĞƌĂŶĚĂƉŽƌƚŝŽŶŽĨĂ ĚƌĂŝŶĂŐĞŝŶĨŝůƚƌĂƚŝŽŶďĂƐŝŶ͘ĂƌƚŚǁŽƌŬŐƌĂĚŝŶŐǁŽƵůĚďĞƉƌŽǀŝĚĞĚƚŽĐŽŶŶĞĐƚĨƌŽŵƚŚĞƉĂƚŚĂƚ ƚŚĞǁĞƐƚĞŶĚŽĨƚŚĞďƌŝĚŐĞƚŽƚŚĞĨƵƚƵƌĞƵWĂŐĞZŝǀĞƌdƌĂŝů͘ dŚĞWĂƌŬŝƐƚƌŝĐƚĂƐŬĞĚĂďŽƵƚƚŚĞĐůĞĂƌĂŶĐĞŽĨƚŚĞƉĂƚŚƵŶĚĞƌŶĞĂƚŚƚŚĞƉƌŽƉŽƐĞĚϭϰϯƌĚ^ƚƌĞĞƚ ďƌŝĚŐĞŽǀĞƌƚŚĞƵWĂŐĞZŝǀĞƌ͘DdƐƚĂƚĞĚƚŚĞŽƌŝŐŝŶĂůĐůĞĂƌĂŶĐĞǁŽƵůĚƉƌŽǀŝĚĞĂŵŝŶŝŵƵŵŽĨϵ ĨĞĞƚŽĨĐůĞĂƌĂŶĐĞ͘^ĞĞǆŚŝďŝƚWĂŐĞϮ͘DdǁŝůůĚĞƐŝŐŶƚŚĞƐŚŝĨƚĞĚĂůŝŐŶŵĞŶƚƉƌŽĨŝůĞŽĨϭϰϯƌĚ ^ƚƌĞĞƚƚŽŵĞĞƚĂƚůĞĂƐƚϭϬĨĞĞƚŽĨĐůĞĂƌĂŶĐĞĂƚƚŚĞƉƌŽƉŽƐĞĚĨƵƚƵƌĞĐƌŽƐƐŝŶŐŽĨƚŚĞƵWĂŐĞZŝǀĞƌ dƌĂŝůƉĞƌƚŚĞ/KdƵƌĞĂƵŽĨĞƐŝŐŶĂŶĚŶǀŝƌŽŶŵĞŶƚDĂŶƵĂů͘ ϲ͘ ƵWĂŐĞZŝǀĞƌdƌĂŝůWƌŽũĞĐƚĐƌŽƐƐŚŝĐĂŐŽƌŝĚŐĞĂŶĚ/ƌŽŶWƌŽƉĞƌƚǇ ^ĞĞǆŚŝďŝƚƐĂŶĚ͘dŚĞWůĂŝŶĨŝĞůĚWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĂƚƚŚĞǇŚĂĚƌƵŶŝŶƚŽĚŝĨĨŝĐƵůƚŝĞƐ ĂƚƚĂŝŶŝŶŐƚŚĞƉĂƚŚĞĂƐĞŵĞŶƚĨƌŽŵŚŝĐĂŐŽƌŝĚŐĞΘ/ƌŽŶĚƵĞƚŽĐŽŽƌĚŝŶĂƚŝŽŶŝƐƐƵĞƐŽŶƚŚĞΘ/ ƐŝĚĞǁŝƚŚďĂĐŬĂŶĚĨŽƌƚŚďĞƚǁĞĞŶƚŚĞŝƌŚŝĐĂŐŽĂŶĚdĞǆĂƐŽĨĨŝĐĞƐŽŶƚŚĞƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐŽĨƚŚŝƐ ĐŽŽƌĚŝŶĂƚŝŽŶ͘dŚĞsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚƐƚĂƚĞĚƚŚĞǇǁŽƵůĚďĞƚĂůŬŝŶŐƚŽŚŝĐĂŐŽƌŝĚŐĞĂŶĚ/ƌŽŶĂƐ ĂϭϰϯƌĚ^ƚƌĞĞƚƉƌŽũĞĐƚƐƚĂŬĞŚŽůĚĞƌĂŶĚǁŽƵůĚďƌŝŶŐƵƉƚŚĞĨƵƚƵƌĞƵWĂŐĞZŝǀĞƌdƌĂŝůĚƵƌŝŶŐƚŚĞ ŵĞĞƚŝŶŐ͘ ϳ͘ ƵWĂŐĞZŝǀĞƌdƌĂŝůWƌŽũĞĐƚĐƌŽƐƐƚŚĞWƌĂŝƌŝĞƌĞĞŬĞǀĞůŽƉŵĞŶƚ ^ĞĞǆŚŝďŝƚ͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĂƚƚŚĞŽǁŶĞƌƐŚŝƉĐŚĂŶŐĞĚĂƉƉƌŽǆŝŵĂƚĞůǇϲŵŽŶƚŚƐĂŐŽ͕ ĂŶĚŶŽƉƌŽŐƌĞƐƐŚĂĚďĞĞŶŵĂĚĞĚƵƌŝŶŐƚŚĂƚƚŝŵĞ͘ŝƐĐƵƐƐŝŽŶƐǁĞƌĞŚĞůĚǁŝƚŚƚŚĞƉƌĞǀŝŽƵƐ Page 4 of 4 0((7,1*0,187(6 7UDQVPLWWHGYLDHPDLO1RYHPEHU &071R ŽǁŶĞƌ͕ďƵƚŶŽĞĂƐĞŵĞŶƚƐŚĂĚďĞĞŶĂƚƚĂŝŶĞĚ͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĂƚĐƌŽƐƐŝŶŐƚŚĞĂƐƚ EŽƌŵĂŶƌĂŝŶĨƌŽŵƚŚĞǁĞƐƚƐŝĚĞƚŽƚŚĞĞĂƐƚƐŝĚĞǁŽƵůĚďĞĂĐŚŝĞǀĞĚŶŽƌƚŚŽĨƚŚĞϭϰϯƌĚ^ƚƌĞĞƚ ƉƌŽũĞĐƚůŝŵŝƚƐ͘ ϴ͘ WĂƚŚŽŶŶĞĐƚŝŽŶƐƚŽƚŚĞEŽƌƚŚĂŶĚtĞƐƚ ^ĞĞǆŚŝďŝƚ͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĞǇǁŽƵůĚĚĞƐŝƌĞƚŽĐŽŶŶĞĐƚƚŚĞƌĞƐŝĚĞŶƚŝĂůĂƌĞĂǁĞƐƚŽĨ />ϱϵĂŶĚŶŽƌƚŚŽĨ,ĂǌĞůĐƌĞƐƚƌŝǀĞƚŽƚŚĞƵWĂŐĞZŝǀĞƌdƌĂŝů͘dŚĞWĂƌŬŝƐƚƌŝĐƚǁŽƵůĚĚĞƐŝƌĞƚŽ ĐƌŽƐƐ/>ϱϵǁŝƚŚĂƉĂƚŚŶĞĂƌ:ŽƐĞƉŚǀĞŶƵĞŽƌϭϯϱƚŚ^ƚƌĞĞƚ͘/ĨĂƚ:ŽƐĞƉŚǀĞŶƵĞ͕ƚŚĞŶƚŚĞWĂƌŬ ŝƐƚƌŝĐƚƐĂŝĚƚŚĞǇǁŽƵůĚǁĂŶƚĂƐŝŐŶĂůĨŽƌƚŚĞĐƌŽƐƐŝŶŐ͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĞǇǁŽƵůĚŶŽƚ ďĞŝŶƚĞƌĞƐƚĞĚŝŶĐƌŽƐƐŝŶŐ/>ϱϵĂƚϭϰϯƌĚ^ƚƌĞĞƚĂŶĚƚŚĂƚƚŚĞůĂŶĚƵƐĞƐĂƚƚŚĂƚůŽĐĂƚŝŽŶǁĞƌĞŶŽƚ ĚĞƐŝƌĂďůĞĨŽƌƉĂƚŚĐŽŶŶĞĐƚŝŽŶƐ͘DdƐƚĂƚĞĚƚŚĂƚƚŚĞĐƵůǀĞƌƚĞǆƚĞŶƐŝŽŶŽĨh^ϯϬͬϭϰϯƌĚ^ƚƌĞĞƚ ŽǀĞƌƚŚĞtĞƐƚEŽƌŵĂŶƌĂŝŶĐŽƵůĚĂĐĐŽŵŵŽĚĂƚĞĂĨƵƚƵƌĞƉĂƚŚŽŶƚŚĞƐŽƵƚŚŽĨƚŚĞƌŽĂĚ͘dŚĞ sŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚƐƚĂƚĞĚƚŚĂƚƚŚĞdƌĂŶƐƉŽƌƚĂƚŝŽŶWůĂŶĚŝĚŶŽƚŝŶĐůƵĚĞĂƉůĂŶŶĞĚƉĂƚŚŽŶϭϰϯƌĚ ^ƚƌĞĞƚĨƌŽŵsĂŶǇŬĞZŽĂĚƚŽ/>ϱϵ͘dŚĞsŝůůĂŐĞŽĨWůĂŝŶĨŝĞůĚƐƚĂƚĞĚƚŚĂƚĂŐƌĂĚĞƐĞƉĂƌĂƚŝŽŶŽĨ ϭϰϯƌĚ^ƚƌĞĞƚŽǀĞƌƚŚĞĂŶĂĚŝĂŶEĂƚŝŽŶĂůZĂŝůƌŽĂĚǁŽƵůĚďĞĚĞƐŝƌĞĚŝŶƚŚĞůŽŶŐƚĞƌŵ͘ ϵ͘ WĂƚŚƚŚƌŽƵŐŚƚŚĞŽŵĚŽƌƌŝĚŽƌ ^ĞĞǆŚŝďŝƚƐĂŶĚ&͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĂƚƚŚĞǇǁĞƌĞŝŶƚĞƌĞƐƚĞĚŝŶĂĐŚŝĞǀŝŶŐĂ ĐŽŶŶĞĐƚŝŽŶďĞƚǁĞĞŶƚŚĞƵWĂŐĞZŝǀĞƌdƌĂŝůĂŶĚƚŚĞǀĞƌǇWƌĞƐĞƌǀĞͬ&ŽƵƌ^ĞĂƐŽŶƐWĂƌŬ͘dŚŝƐ ǁŽƵůĚŝŶĐůƵĚĞďŽƚŚƚŚĞϭϰϯƌĚ^ƚƌĞĞƚǆƚĞŶƐŝŽŶĨƌŽŵ/>ϱϵƚŽ/>ϭϮϲŽŵĚŽƌƌŝĚŽƌĂƐǁĞůůĂƐƚŚĞ >ŽĐŬƉŽƌƚŽŶŶĞĐƚŽƌĨƌŽŵ/>ϭϮϲͬϭϰϯƌĚ^ƚƌĞĞƚƚŽ>ŽĐŬƉŽƌƚ^ƚƌĞĞƚŽŵĚŽƌƌŝĚŽƌ͘dŚĞsŝůůĂŐĞŽĨ WůĂŝŶĨŝĞůĚƐƚĂƚĞĚƚŚĂƚƚŚĞ>ŽĐŬƉŽƌƚ^ƚƌĞĞƚŽŶŶĞĐƚŽƌǁŽƵůĚŽŶůǇďĞŝŵƉůĞŵĞŶƚĞĚŝĨƚŚĞ>ŽĐŬƉŽƌƚ ^ƚƌĞĞƚŝŶƚĞƌĐŚĂŶŐĞĂƚ/ͲϱϱŝƐŝŵƉůĞŵĞŶƚĞĚ͘dŚĞWĂƌŬŝƐƚƌŝĐƚƐƚĂƚĞĚƚŚĞǇŚĂĚǁŽƌŬĞĚǁŝƚŚ ŽŵĚďĞĨŽƌĞŽŶŝŵƉůĞŵĞŶƚŝŶŐƉĂƚŚƐŽŶŽŵĚƚƌĂŶƐŵŝƐƐŝŽŶĐŽƌƌŝĚŽƌƉƌŽƉĞƌƚǇ͘dŚĞǇƐƚĂƚĞĚ ƚŚĞĞǆŝƐƚŝŶŐƉĂƚŚ͕ƉĂƌĂůůĞůƚŽh^ϯϬĂŶĚƚŚĞĂŶĂĚŝĂŶEĂƚŝŽŶĂůZĂŝůƌŽĂĚ͕ďĞƚǁĞĞŶϭϮϳƚŚ^ƚƌĞĞƚ ĂŶĚϭϯϱƚŚ^ƚƌĞĞƚ͕ŝƐĂŶĞǆĂŵƉůĞ͘ &RPSUHKHQVLYH3DUNV 5HFUHDWLRQ0DVWHU3ODQ 3ODLQILHOG3DUN'LVWULFW &RPSUHKHQVLYH0DVWHU3ODQ $FFHVVWR7UDLOV ,QWKH3ODLQILHOG3DUN'LVWULFWDVLQPDQ\FRPPXQLWLHVDFURVVWKHFRXQWU\WUDLOVDUHUHFRJQL]HGDV YDOXDEOHDQGGHVLUDEOHHOHPHQWVRIDUHFUHDWLRQV\VWHP7KHIROORZLQJPDS0DSVKRZVH[LVWLQJ WUDLOVLQWKH'LVWULFWDVZHOODVSURSRVHGWUDLOVDVUHIOHFWHGLQWKH'LVWULFW*,6GDWDVHW5HVLGHQWVKDYHRQO\ OLPLWHGDFFHVVWRH[LVWLQJWUDLOV7KLVVWXG\LQGLFDWHVWKDWH[SDQGHGDFFHVVDQGDGGLWLRQDORSSRUWXQLWLHV DUHQHHGHG 0DS7UDLO$FFHVV 143rd Street Project Location EXHIBIT A Four Seasons Park 1 of 3 EXHIBIT B 2 of 3 3 of 3 2018 Shifted Alignment Concept to the North –based drawing from as presented to FHWAFuture DuPage River Trail ConceptFuture Connection from DuPage River Trail to Crossing over DuPage RiverExisting DuPage River TrailOriginal Proposed 143rdStreet Alignment ---------Future Path at Existing Grade;Bridge Over Future PathEarthwork Grading For Future Connection in GreenEAST NORMAN DRAINPark District Property Shaded in OrangeEXHIBIT CChicago Bridge and Iron Future DuPage River Trail ConceptFuture Residential Connection Option A to DuPage River TrailFuture Residential Connection Option B to DuPage River TrailProposed 143rdStreet CorridorEXHIBIT DChicago Bridge and IronPrairie Creek Development 2018 Shifted Alignment Concept to the North –based drawing from as presented to FHWAFuture DuPage River Trail Concept143rdStreet Bike Path AccommodationsFuture Concept Path to Four Seasons Parkand Avery PreserveFuture Connection from DuPage River Trail to Crossing over DuPage RiverEXHIBIT E 143rdStreet Bike Path AccommodationsFuture Concept Path to Four Seasons Parkand Avery Preserve (ComEd Corridor)Four Seasons ParkAvery PreserveEXHIBIT F Page 1 of 3 MEETING MINUTES &071R 3URMHFW 3ODLQILHOG UG6WUHHW([WHQVLRQ3KDVH,$GGHQGXP &071R 6HFWLRQ1R)3 3URMHFW1R 0 /RFDWLRQ 3ODLQILHOG3XEOLF:RUNV 'DWH $WWHQGHHV NAME REPRESENTING PHONE NUMBER EMAIL &KDUOHV³7LFH´&ROH &07 FFROH#FPWHQJUFRP 5DQG\-HVVHQ 9LOODJHRI3ODLQILHOG UMHVVHQ#JRSODLQILHOGFRP &DUOR&DSDOER 3ODLQILHOG3DUN'LVWULFW [FDSDOER#SOIGSDUNRUJ 'LVWULEXWLRQ $WWHQGHHV 3OHDVHUHYLHZWKHDWWDFKHGPLQXWHVLIRXUXQGHUVWDQGLQJRIWKHLQIRUPDWLRQH[FKDQJHDV SUHVHQWHG LQ WKHVH QRWHV LV GLIIHUHQW IURP \RXUV NLQGO\ LQIRUPXV VR ZH FDQ UHYLVH DFFRUGLQJO\6KRXOGZHQRWKHUHIURP\RXZLWKLQRQHZHHNV¶WLPHZHZLOOFRQVLGHU WKHVHQRWHVFRUUHFWDVSUHVHQWHG'LVWULEXWHG 6LJQHG &KDUOHV0³7LFH´&ROH3(372( Village of Plainfield 143rd St Extension Phase I Addendum Meeting with Park District Date: February 13th, 2019 Page 2 of 3 &071R Meeting Purpose The purpose of the meeting was for the Village of Plainfield to request a Letter of Financial Support from Plainfield Park District for a DuPage River Path extension as part of the 143rd Street Extension project. Another purpose of the meeting was to determine the Park District’s interest in land acquisition on ComEd property between Naperville Road and IL 126 for a path to meet IDOT Complete Streets requirements for 143rd Street. DuPage River Trail The Village of Plainfield requested the Park District write a letter of intent for financial support to fund their portion of the DuPage River Trail Extension. The extension (See Exhibit A – red dotted line) would begin at the current river trail cul-de-sac south of the ComEd property and extend across the ComEd property (See Exhibit A – purple shaded area) to the north end of the Park District Property (See Exhibit A – orange shaded area). The Village of Plainfield stated they would fund/construct/maintain the connection from the river trail path (See Exhibit A – blue dotted line) to the path now proposed on the 143rd Street Bridge over the DuPage River (See Exhibit A – black dotted line). The Park District requested that the Village bring up their desire to extend the river trail across the Chicago Bridge and Iron (CB&I) property (See Exhibit A – white dotted line) when the Village of Plainfield spoke to CB&I as part of the 143rd Street Extension project. The Park District would like CB&I to contact them. The Village agreed to fulfill that request when meeting with CB&I. The Village and Park District jointly reviewed the parcels that ComEd owns in the area of the River Trail Extension. It appeared that two ComEd parcels would be impacted by the extension due to a section line running east-west through the corridor in this area. The Park District stated that they were not sure of any existing leases on the ComEd property in the existing cul-de-sac area and would need to follow up with that information. 143rd Street Complete Streets Accommodation The Village explained to the Park District that IDOT would require a complete streets accommodation for the 143rd Street Extension project. This section of 143rd Street was originally planned without accommodations for a path (Bureau of Local Roads and Streets project with no complete streets requirement). 143rd Street from IL 59 to IL 126 is planned to be jurisdictionally transferred to Plainfield subsequent to construction completion. The state-required complete streets accommodation is typically completed within the existing/proposed State ROW. With the potential shift in the alignment towards the north, to avoid the road going through ComEd property, this will increase impacts to properties to the north. Further increasing the corridor typical section width to accommodate a path will further increase impacts to the north. The Village would like investigate measures to minimize impacts and reduce costs. Since a path is something that ComEd has historically allowed on their property, because it doesn’t generally interfere with their transmission lines, the Village is interested in putting the path on ComEd property as a potential solution to minimize property impacts Village of Plainfield 143rd St Extension Phase I Addendum Meeting with Park District Date: February 13th, 2019 Page 3 of 3 &071R to the north (See Exhibit B – yellow dotted line). The Park District confirmed that they have other easements within ComEd ROW for Park District paths, but these are 10-year leases, not easements. The Park District stated the lease is over the entire property, not just the area of the path. The Park District stated they are currently going through a process of renewing some of these leases. The Park District noted that ComEd does not manage conflicting leases on the same property, e.g. farming by one party and paths by a separate party on the same property. ComEd leaves it to the lease parties to resolve any conflicts. The Village of Plainfield stated that IDOT would require any kind of accommodation to include a permanent easement (subsequent to this meeting IDOT stated FHWA may allow for a 20-year lease subject to reviewing the terms and conditions of the lease) before the improvement could be released for construction. Since the future path would be a park district path to eventually connect to Four Seasons Park and Avery Preserve (See Exhibit B – light blue dotted line), the Village asked if the Park District was willing to acquire a lease on the ComEd property for the path as part of the 143rd Street Extension project. The Park District stated they would follow up with an answer after the Village confirmed this solution could be acceptable IDOT and FHWA. The Village and Park District jointly reviewed the parcels that ComEd owns in the area between Naperville Road and Illinois Route 126. It appeared that ComEd owns two parcels. CMT noted that the design for a path/sidewalk spur connection from Copper Drive to the 143rd Street Path along Illinois Route 126 (See Exhibit B – green dotted line along IL 126) could avoid a 3rd ComEd parcel at the southwest quadrant of Illinois 126 at 143rd Street. Note this south leg of IL 126 at the intersection of IL 126 would become under the jurisdiction of Plainfield as part of the jurisdictional transfer. This potential spur would not be the Park District’s responsibility. Action Items: 1.Park District identify existing ComEd lease information, if any, for property at River Trail cul-de-sac. 2.Park District send letter of financial support to Village for river trail extension construction costs as part of the 143rd Street Extension project. 3.Village follow up with IDOT and FHWA regarding sufficiency of Park District lease on ComEd property to meet complete streets requirements. Attachments Exhibit A – DuPage River Trail Extension Exhibit B – 143rd Street Path Accommodations for Complete Streets 2018 Shifted Alignment Concept to the North – based drawing from as presented to FHWA River Trail Path Extension as part of 143rd Street – Letter of Intent for Financial Support from Park District Future DuPage River Trail by Park District Connection from DuPage River Trail to Crossing over DuPage River by Village of Plainfield Proposed Bridge Path by Village of Plainfield Existing DuPage River Trail Cul-De-Sac Original Proposed 143rd Street Alignment --------- Future Path at Existing Grade; Bridge Over Future PathEarthwork Grading For Future Connection in Green EAST NORMAN DRAIN Park District Property Shaded in Orange EXHIBIT A Chicago Bridge and Iron 2018 Shifted Alignment Concept to the North – based drawing from as presented to FHWA Future DuPage River Trail Concept by Park District DuPage River Trail Extension as part of 143rd St Extension DuPage River Bridge Path Future 143rd Street Bike Path Accommodations on ComEd Property – Lease by Park District Future Connections to Connect to Path on ComEd property Future Connection by Park District from IL 126 to Four Seasons Park and Avery Preserve EXHIBIT B Page 1 of 3 MEETING MINUTES &071R 3URMHFW 3ODLQILHOG UG6WUHHW([WHQVLRQ3KDVH,$GGHQGXP &071R 6HFWLRQ1R)3 3URMHFW1R 0 /RFDWLRQ 3ODLQILHOG3XEOLF:RUNV 'DWH -XQH 7LPH $0 6XEMHFW 3DUN'LVWULFW&RRUGLQDWLRQ $WWHQGHHV NAME REPRESENTING PHONE NUMBER EMAIL 5DQG\-HVVHQ 9LOODJHRI3ODLQILHOGUMHVVHQ#JRSODLQILHOGFRP 6FRWW7KUHHZLWW 9LOODJHRI3ODLQILHOGVWKUHHZLWW#JRSODLQILHOGFRP &DUOR&DSDOER 3ODLQILHOG3DUN'LVWULFWFDSDOER#SOIGSDUNVRUJ -HQQLIHU5RRNV /RSH]3ODLQILHOG3DUN'LVWULFWURRNVORSH]#SOIGSDUNVRUJ 7LFH&ROH &07FFROH#FPWHQJUFRP -HUHP\0HW] &07MPHW]#FPWHQJUFRP 'LVWULEXWLRQ $WWHQGHHV 3OHDVHUHYLHZWKHDWWDFKHGPLQXWHVLIRXUXQGHUVWDQGLQJRIWKHLQIRUPDWLRQH[FKDQJHDV SUHVHQWHG LQ WKHVH QRWHV LV GLIIHUHQW IURP \RXUV NLQGO\ LQIRUPXV VR ZH FDQ UHYLVH DFFRUGLQJO\6KRXOGZHQRWKHUHIURP\RXZLWKLQRQHZHHNV¶WLPHZHZLOOFRQVLGHU WKHVHQRWHVFRUUHFWDVSUHVHQWHG 6LJQHG &KDUOHV0³7LFH´&ROH3(372( Village of Plainfield 143rd St Extension Phase I Addendum Plainfield Park District Meeting Min Date: June 6, 2019 Page 2 of 3 &071R $PHHWLQJZDVKHOGZLWK3ODLQILHOG3DUN'LVWULFW3DUN'LVWULFWWKH9LOODJHRI3ODLQILHOG9LOODJH DQG&07RQ-XQHDW3ODLQILHOG3XEOLF:RUNV 7KHPHHWLQJEHJDQDWDP ,QWURGXFWLRQV 5HFHQW&RRUGLQDWLRQ D 9LOODJHH[SODLQHGWR3DUN'LVWULFWWKDWWKH\KDGPHW%DVVDQG*LOO&OXE 6WDNHKROGHUWRGLVFXVVDQDOLJQPHQWVKLIWWRWKHQRUWK7KH9LOODJHLVORRNLQJDW WKUHHZD\VWRPLQLPL]HLPSDFWVWRWKHFOXELQFOXGLQJDQDUURZHUPHGLDQ UHWDLQLQJZDOOLQVWHDGRIILOOVORSHVDQGELNHSDWKRQ&RP(GSURSHUW\7KHFOXE SUHIHUUHGWKHSDWKRQWKHVRXWKRISURSRVHGUG6WUHHWDQGDZD\IURPWKHLU SURSHUW\7KHFOXEVXSSRUWHGDQDUURZHUPHGLDQLI,'27ZRXOGDOORZLW7KH FOXEUHSUHVHQWDWLYHVKDGPL[HGVXSSRUWRIILOOYHUVXVUHWDLQLQJZDOO E ,'27KDVVLQFHFRQILUPHGWKH\ZRXOGVXSSRUWDGHVLJQH[FHSWLRQWRGHFUHDVH WKHPHGLDQZLGWK F ,'27KDVVWDWHGWKDWEXLOGLQJWKHSDWKDVSDUWRIWKH UG6WUHHWSURMHFWEHWZHHQ 1DSHUYLOOH5RDGDQG,/RQ&RP(G3URSHUW\ZLWKD\HDUOHDVHZRXOGPHHW WKHLUFRPSOHWHVWUHHWVUHTXLUHPHQWV G 7KH9LOODJHDQG&07PHWZLWK&RP(GRQ0D\&RP(GVWDWHGWKH\ ZHUHDJUHHDEOHWR\HDUSURSRVHGOHDVHLQVWHDGRID\HDUOHDVHIRUDSDWK RQWKHLUIDFLOLW\ H 7KH9LOODJHVWDWHGWKHFRVWRIWKHSDWKZDVWREHVSOLWDSSUR[LPDWHO\ IHGHUDOWRORFDO &RPSOHWH6WUHHWV$FFRPPRGDWLRQ'LVFXVVLRQ D 7KH9LOODJHSURSRVHGWRIXQGDQGFRQVWUXFWDPXOWLXVHSDWKIRUWKH3DUN'LVWULFW EHWZHHQ1DSHUYLOOH5RDGDQG,/7KH3DUN'LVWULFWDJUHHG E 7KH9LOODJHSURSRVHGWKH3DUNGLVWULFWSXUFKDVH\HDUOHDVHVIURP&RP(GIRU WKHSDWKEHWZHHQ1DSHUYLOOH5RDGDQG,/DQGWDNHRZQHUVKLSPDLQWHQDQFH RIWKHSDWK7KH3DUN'LVWULFWDJUHHG F &07VWDWHGLQRUGHUWRIXOILOO&RP(GUHTXLUHPHQWVIRURIIVHWGLVWDQFHVWR WUDQVPLVVLRQDQGGLVWULEXWLRQOLQHVWKH3DUN'LVWULFWPXVWFKRRVHLIWKH\ZDQW PXOWLXVHSDWKQRUWKRUVRXWKVLGHRI&RP(GFRUULGRU7KH3DUN'LVWULFWVWDWHG WKH\SUHIHUWKHSDWKWREHDORQJWKHQRUWKVLGHRIWKH&RP(GFRUULGRU G 7KH3DUN'LVWULFWUHFRPPHQGHGEXLOGLQJDSDWKDVSDUWRIWKHSURMHFWDORQJWKH ZHVWVLGHRI,/IURPUG6WUHHWWR&RSSHU'ULYHIRUDORJLFDOSDWKWHUPLQXV 7KH9LOODJHDJUHHG H 7KHJURXSUHYLHZHGSURSHUWLHVWKDWZRXOGUHTXLUHOHDVHVIURP&RP(GDQGZKLFK SURSHUWLHVDOUHDG\KDGOHDVHVIURP&RP(G7KHJURXSLGHQWLILHGRQHDGGLWLRQDO OHDVHZRXOGEHQHHGHGIRUWKH'X3DJH5LYHU7UDLOH[WHQVLRQDQGWZROHDVHV ZRXOGEHQHHGHGIRUWKHSDWKEHWZHHQ1DSHUYLOOH5RDGDQG,/ I 7KH3DUN'LVWULFWVWDWHGERDUGDSSURYDOZRQ¶WOLNHO\EHQHFHVVDU\WRREWDLQWKH OHDVHVIRUWKLVPXOWLXVHSDWK J &07VWDWHGWKHVHFWLRQIGRFXPHQWZRXOGEHSUHSDUHGVKRZLQJDSHUPDQHQW HDVHPHQWWRWKH3DUN'LVWULFWIRUWKH'X3DJH5LYHU7UDLOH[WHQVLRQZKHQWKH Village of Plainfield 143rd St Extension Phase I Addendum Plainfield Park District Meeting Min Date: June 6, 2019 Page 3 of 3 &071R 9LOODJHSXUFKDVHVWKH3DUN'LVWULFWSDUFHODORQJWKH5LYHUIRUWKHUG6WUHHW SURMHFW K 7KH6SHFLILFDWLRQVRIWKHPXOWLXVHSDWKDUHWRIROORZ,'273ODLQILHOGVWDQGDUGV L 7KH3DUN'LVWULFWUHTXHVWHGDFRQVWUXFWLRQFRVWHVWLPDWHIRUWKH5LYHU7UDLO H[WHQVLRQLQSUHSDUDWLRQRIDQLQWHUJRYHUQPHQWDODJUHHPHQWEHWZHHQWKH3DUN 'LVWULFWDQGWKH9LOODJH M &07DVNHGZKDWWKH3DUN'LVWULFWZRXOGOLNHWRGRZLWKWKH5LYHU7UDLOORRSVRXWK RIWKHSURSRVHG'X3DJH5LYHU%ULGJH7KH3DUN'LVWULFWUHTXHVWHGWKH/RRSLQ WKH5LYHU7UDLOVWD\DQGDSDWKFRQQHFWLRQEHPDGH N 7KH3DUN'LVWULFWUHTXHVWHGWKH9LOODJHLQFOXGHWKHPLQIXWXUHVWDNHKROGHU FRRUGLQDWLRQZLWK&% ,LQRUGHUWRGLVFXVVIXWXUHSODQVIRU5LYHU7UDLOH[WHQVLRQ WRWKHQRUWK7KH9LOODJHDJUHHG O 7KH9LOODJHRIIHUHGDQ\LQIRUPDWLRQWKH3DUN'LVWULFWPD\QHHGZKHQWKH3DUN 'LVWULFWZRUNVWRDWWDLQ&RP(GOHDVHDJUHHPHQWV $FWLRQ,WHPV D &07WRVHQG3DUN'LVWULFWSURSRVHGLPSURYHPHQWV6WULS0DSIURPPHHWLQJ FRPSOHWHG-XQH E &07WRUHYLVH5LYHU7UDLO([WHQVLRQFRQFHSWSHU3DUN'LVWULFWLQSXWUHJDUGLQJ H[LVWLQJORRS F &07WRSURYLGH3DUN'LVWULFWZLWKFRVWHVWLPDWHRI5LYHU7UDLO([WHQVLRQ G &07WRGHYHORS6HFWLRQILPSDFWVDQGFRRUGLQDWHZLWK3DUN'LVWULFWDQG,'27 EHIRUH3XEOLF0HHWLQJLQHDUO\)DOO H 3DUN'LVWULFWWRDWWDLQWKHWKUHHDGGLWLRQDO\HDUOHDVHVLGHQWLILHGIRUSURMHFW SDWKV I 9LOODJHWRVFKHGXOHPHHWLQJZLWK&% ,DQGLQYLWH3DUN'LVWULFW J 3DUN'LVWULFWWRSUHSDUHDOHWWHURILQWHQWUHJDUGLQJSURMHFWUHODWHGLWHPV K 9LOODJHWREHJLQGUDIWLQJLQWHUJRYHUQPHQWDODJUHHPHQWZLWKWKH3DUN'LVWULFWIRUDOO RIWKHSURMHFWUHODWHGLWHPV 7KHPHHWLQJZDVDGMRXUQHGDWDSSUR[LPDWHO\SP ([KLELW% In accordance with 23 CFR 774, the proposed project constitutes a "use" with de minimis impact of the Plainfield Park District 4(f) property, based on the following assessment: i Due to minimization measures of constructing a paved multi -use trail concurrently with the project there is no adverse effect on the qualities or function and activities of the 4(f) property as originally intended by the Park District. Based on the scope of the proposed project and type of work, there will be no permanent interference with or adverse effects to the recreational activities, features and/or attributes associated with the Plainfield Park District 4(f) property. If you concur with the measures to minimize harm and the assessment of impacts regarding the proposed project, please indicate as such by responding accordingly to this letter_ Thank you for your time and cooperation on this matter. If you have questions and/or concerns, please feel free to contact myself at sthreewitt@goplainfield.com or (815) 230-2037. Scott Threewitt Village of Plainfield 1 Alexandra Zelles From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Friday, April 24, 2020 12:48 PM To:Tice 'Charles' Cole Cc:Randy Jessen; Scott Threewitt; Mike Wittkop; Alexandra Zelles; DavisD1, Michelle L.; Raffensperger, William Subject:RE: [External] FW: 06-00040-00-FP 143rd Street East Extension-Section 4f de minimis Concurrence Attachments:OWJ letter_Plainfield Park District.pdf ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, Theletterisfine.Youmayproceedasyouhavestatedbelow. Thanks, Kevin From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Friday,April24,202012:30PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com>;DavisD1,MichelleL. <Michelle.L.DavisD1@Illinois.gov> Subject:[WARNING:ATTACHMENTUNSCANNED]RE:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection 4fdeminimisConcurrence Kevin, ThepublicmeetingwasheldinSeptember2019andthenotices/advertisementsandmeetingmaterialsincludedthe section4fimpacts. Thanks, Tice Charles“Tice”Cole|Crawford,Murphy&Tilly|w630.907.7059 ProjectEngineer From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Friday,April24,202012:22PM To:Tice'Charles'Cole<ccole@cmtengr.com> Cc:RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com>;DavisD1,MichelleL. <Michelle.L.DavisD1@Illinois.gov> Subject:FW:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence 2 ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, IdiscussedthiswithourCentralOffice.Theyprovidedthefollowingresponse: 7KHOHWWHUORRNVJRRG2QHTXHVWLRQDERXWWLPLQJ±:DVWKHSXEOLFLQIRUPDWLRQPHHWLQJKHOGSULRUWR 0DUFK",IWKHUHKDVQRWEHHQDSXEOLFLQIRUPDWLRQPHHWLQJWKHOHWWHULVWREHVLJQHGDIWHUWKH PHHWLQJZDVKHOG Thanks, Kevin From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Friday,April24,202010:24AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com>;DavisD1,MichelleL. <Michelle.L.DavisD1@Illinois.gov> Subject:[External]FW:06Ͳ00040Ͳ00ͲFP143rdStreetEastExtensionͲSection4fdeminimisConcurrence Kevin, IstheemailresponsebelowfromthePlainfieldParkDistrictsufficienttoaddresstheSection4fdeminimisandapprove thataspectoftheprojectforPhaseI?Sincewedidnotreceivealetter,Ianticipateprintingtheemailtopdfand includingitasdocumentationintheFinalPDR. Thanks, Tice Charles“Tice”Cole|Crawford,Murphy&Tilly|w630.907.7059 ProjectEngineer From:JenniferRooksͲLopez<rooksͲlopez@plfdparks.org> Sent:Thursday,April23,20205:13PM To:ScottThreewitt<sthreewitt@goplainfield.com>;CarloCapalbo<Capalbo@plfdparks.org> Cc:RandyJessen<rjessen@goplainfield.com>;Tice'Charles'Cole<ccole@cmtengr.com> Subject:RE:143rdStreetEastExtensionͲSection4fdeminimisConcurrence ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. GoodafternoonScott, TheDistrictagreeswithandsupportsthemeasurestominimizeharmandtheassessmentofimpactsregardingthe proposed143StreetEastExtensionproject. Sincerely, JenniferRooksͲLopez The District agrees with and supports the measures to minimize harm and the assessment of impacts regarding the proposed 143 Street East Extension project. Sincerely, Jennifer RooksͲLopez 3 -HQQLIHU5RRNV/RSH]&353/(('%' & 'LUHFWRURI3DUNVDQG3ODQQLQJ 3ODLQILHOG3DUN'LVWULFW :2WWDZD6W_3ODLQILHOG,/ _www.plfdparks.org 'LUHFW From:ScottThreewitt<sthreewitt@goplainfield.com> Sent:Friday,April17,20209:53AM To:CarloCapalbo<Capalbo@plfdparks.org>;JenniferRooksͲLopez<rooksͲlopez@plfdparks.org> Cc:RandyJessen<rjessen@goplainfield.com>;Tice'Charles'Cole(ccole@cmtengr.com)<ccole@cmtengr.com> Subject:RE:143rdStreetEastExtensionͲSection4fdeminimisConcurrence HelloPlainfieldParkDistrict, WeareafewmoreweeksintothestayͲatͲhomeorderandhopefullywewillstartseeinglightattheendofthetunnel. Haveyouhadachancetoreviewtheattachedletter?TheVillagewouldliketowrapupourProjectDevelopmentReport andwillneedyourresponseaspartofthesubmittal. Thanks! Scott Scott R. Threewitt, P.E. | Lead Engineer Village of Plainfield | Department of Public Works 14400 Coil Plus Drive | Plainfield, Illinois 60544 815-230-2037 - Direct http://www.plainfield-il.org 3 Let'shaveacleanerworld!Reduce,RecycleandReuse!ǦPleaseconsidertheenvironmentanddonotprintthis eǦmailunlessabsolutelynecessary This message may be confidential and/or privileged. If you are not the intended recipient, please notify the sender immediately and then delete. You should not copy or use this message for any purpose or disclose its content to any other person. Internet communications are not secure, you should scan this message for any attachments or viruses. Under no circumstances, does the sender or agency accept any liability for any loss or damage that may result from your receipt of this message or any attachments. From:ScottThreewitt Sent:Friday,March20,20201:54PM To:CarloCapalbo<Capalbo@plfdparks.org>;JenniferRooksͲLopez<rooksͲlopez@plfdparks.org> Cc:'RandyJessen'<rjessen@goplainfield.com> Subject:143rdStreetEastExtensionͲSection4fdeminimisConcurrence HiCarloandJen, -HQQLIHU5RRNV/RSH]&353/(('%' &S 'LUHFWRURI3DUNVDQG3ODQQLQJ 3ODLQILHOG3DUN'LVWULFW :2WWDZD6W_3ODLQILHOG,/ _ _ www.plfdparks.org _ 'LUHFW 4 IhopetheParkDistrictisadjustingtothenewnormalwearelivingin,thingsseemtobechangingbytheminute.Please letusknowifthereisanythingtheVillagecanassistwithasweareinthistogether! Workdoescontinueonthe143rdStreetEastExtensionasourdeadlinetobeginconstructionisstillNovember2021.As partoftheprocess,weneedtheParkDistrict’sconcurrenceonacquiringpropertyownedbytheParkDistrict.Asstated intheattachedletter,therewillbenopermanentinferencewithoradverseeffectstotherecreationfacilities,features and/orattributesassociatedwiththePlainfieldParkDistrict4(f)property.Atthistime,wearerequestingasimple concurrenceletteronParkDistrictletterhead. Thanks, Scott Scott R. Threewitt, P.E. | Lead Engineer Village of Plainfield | Department of Public Works 14400 Coil Plus Drive | Plainfield, Illinois 60544 815-230-2037 - Direct http://www.plainfield-il.org 3 Let'shaveacleanerworld!Reduce,RecycleandReuse!ǦPleaseconsidertheenvironmentanddonotprintthis eǦmailunlessabsolutelynecessary This message may be confidential and/or privileged. If you are not the intended recipient, please notify the sender immediately and then delete. You should not copy or use this message for any purpose or disclose its content to any other person. Internet communications are not secure, you should scan this message for any attachments or viruses. Under no circumstances, does the sender or agency accept any liability for any loss or damage that may result from your receipt of this message or any attachments. CAUTION:Thisemailoriginatedfromoutsideoftheorganization.Donotclicklinksoropenattachmentsunlessyourecognizethe senderandknowthecontentissafe. Disclaimer The information contained in this communication from the sender is confidential. It is intended solely for use by the recipient and others authorized to receive it. If you are not the recipient, you are hereby notified that any disclosure, copying, distribution or taking action in relation of the contents of this information is strictly prohibited and may be unlawful. This email has been scanned for viruses and malware, and may have been automatically archived by Mimecast Ltd, an innovator in Software as a Service (SaaS) for business. Providing a safer and more useful place for your human generated data. Specializing in; Security, archiving and compliance. To find out more Click Here. 6WDWHRI,OOLQRLV&21),'(17,$/,7<127,&(7KHLQIRUPDWLRQFRQWDLQHGLQWKLVFRPPXQLFDWLRQLVFRQILGHQWLDOPD\EH DWWRUQH\FOLHQWSULYLOHJHGRUDWWRUQH\ZRUNSURGXFWPD\FRQVWLWXWHLQVLGHLQIRUPDWLRQRULQWHUQDOGHOLEHUDWLYHVWDII FRPPXQLFDWLRQDQGLVLQWHQGHGRQO\IRUWKHXVHRIWKHDGGUHVVHH8QDXWKRUL]HGXVHGLVFORVXUHRUFRS\LQJRIWKLV FRPPXQLFDWLRQRUDQ\SDUWWKHUHRILVVWULFWO\SURKLELWHGDQGPD\EHXQODZIXO,I\RXKDYHUHFHLYHGWKLVFRPPXQLFDWLRQLQ HUURUSOHDVHQRWLI\WKHVHQGHULPPHGLDWHO\E\UHWXUQHPDLODQGGHVWUR\WKLVFRPPXQLFDWLRQDQGDOOFRSLHVWKHUHRI LQFOXGLQJDOODWWDFKPHQWV5HFHLSWE\DQXQLQWHQGHGUHFLSLHQWGRHVQRWZDLYHDWWRUQH\FOLHQWSULYLOHJHDWWRUQH\ZRUN SURGXFWSULYLOHJHRUDQ\RWKHUH[HPSWLRQIURPGLVFORVXUH ServingallofPlainfieldTownship andportionsofNaͲAuͲSayand WheatlandTownships August 26, 2020 Michael P. Collins Village President Village of Plainfield 24401 W. Lockport Street Plainfield IL 60544 143rd Street East Extension IL 59 to IL 126 Shared Use Paths Letter of Intent Dear Mayor Collins, The Plainfield Park District (District) has been coordinating with the Village of Plainfield (Village) for the study of constructing an extension of 143rd Street between IL 59 and IL 126. The 143rd Street Extension is a vital key to improving regional traffic flow in one of the most rapidly growing areas in Illinois and will relieve major congestion in the central Will County area, improve quality of life and safety, benefit numerous manufacturers moving goods in and out of the area as well as supporting substantial job creation in the area. It is our understanding that the Village is using federal dollars towards the improvement and developing the project in accordance with Illinois Department of Transportation (Department) policies and procedures for the use of federal funds. The District supports this improvement and has sent multiple letters of support from 2016-2020 for use with the Village’s federal funding applications. In the District, as in many communities across the country, trails are recognized as valuable and desirable elements of a recreation system. The District’s 2016-2020 Comprehensive Master Plan (Master Plan) shows existing and proposed trails in the District. Currently, residents have only limited access to the District’s existing trails. The Master Plan indicates that expanded access and additional opportunities are needed throughout the District. In accordance with our Master Plan, it is our intention to use this opportunity of roadway infrastructure improvements in the area to extend the DuPage River Trail to the north, with the goal of incrementally connecting to Eaton Preserve Park. It is also our intention to use this opportunity to further expand access to recreational trails that were previously unplanned, with the goal of eventually connecting Four Seasons Park to the trail system. ([KLELW% It is our understanding that as part of the 143rd Street Extension, the Village will construct (see Table 1 and Exhibit 1): 1. An extension of the DuPage River Trail from the current terminus loop on ComEd parcel PIN 06- 03-10-100-001 through ComEd parcel PIN 06-03-03-300-009 to the current District-owned parcel PIN 06-03-03-300-016. See Section 1 on Exhibit 1 (attached). 2. A connector path/ramp from the proposed DuPage River Trail Extension to the north side of 143 rd Street near the proposed western abutment of the proposed DuPage River Bridge. This will primarily be constructed in ROW acquired by the Village in the name of the Department. See Section 2 on Exhibit 1 (attached). 3. A path on the north side of the proposed 143rd Street bridge over the DuPage River. This will be constructed in ROW acquired by the Village. See Section 3 on Exhibit 1 (attached). 4. A path on the north side of 143 rd Street from the east abutment of the DuPage River bridge to the intersection of Naperville Road. This will be constructed in ROW acquired by the Village. See Section 4 on Exhibit 1 (attached). 5. Path and sidewalk accommodations at the proposed signalized intersection of Naperville Road and 143rd Street. This will be constructed in ROW acquired by the Village. See Section 5 on Exhibit 1 (attached). 6. A path on the south side of 143 rd Street from Naperville Road to IL 126. This will be constructed on ComEd parcel PINs 06-03-03-403-015 and 06-03-03-403-018. See Section 6 on Exhibit 1 (attached). 7. A path on the west side of IL 126 from the intersection of 143rd Street to the north side of Copper Drive. This will be constructed in existing ROW owned by the Department. See Section 7 on Exhibit 1 (attached). It is our understanding that the path on the bridge (Section 3) must be constructed to meet the Department’s Complete Streets policy because the route is planned to be jurisdictionally transferred to the Department and become IL 126 upon successful project completion. It is our understanding that the path between Naperville Road and IL 126 on ComEd property (Section 6) must be constructed as part of the improvement project to meet the Department’s Complete Street policy because the path will not be within the proposed ROW and will exist by lease on ComEd property. Constructing the path will preserve the public investment of funds in the transportation system. It is our understanding that we have a shared desire to avoid intermittent gaps in the proposed path system and to avoid paths that do not have a logical termini. The DuPage River Trail and Pennland Subdivision create two logical termini for the path system within the roadway project limits. It is our shared desire to construct sections 2, 4, 5 and 7 of the path in conjunction with sections 1, 3, and 6, between logical termini, creating a continuous path between them. It is our understanding that ComEd has already provided written concurrence, dated May 7, 2020, having no objection to the proposal for 20-year leases on the aforementioned properties. It is our intent to: 1. Sell the District property, PIN 06-03-03-300-016, on the west side of the DuPage River to the Village for use on the 143rd Street Extension project, with the understanding that a permanent easement will be granted back to the District from the Village for the planned DuPage River Trail extension on the referenced property. 2. Reimburse the Village for construction of the DuPage River Trail from the current northern loop terminus to the new connector ramp that connects to the proposed 143rd Street Trail. See Section 1 on Exhibit 1 (attached). This reimbursement is only intended for local match funding for any federal funds that will be used for the path. Acquire 20-year recreational leases from ComEd for parcel PINs PIN 06-03-03-300-009, 06-03-03-403- 015, and 06-03-03-403-018, for the paths to remain after the Village constructs them via temporary easement. The 20-year leases will not be attained from ComEd until after the Village’s ROW Agreement with the Department has been executed. The 20-year leases will be attained by the Department’s scheduled ROW Certification date of September 2021 for the anticipated November 2021 letting. The leases will be obtained in accordance with the Department’s Land Acquisition Policies and Procedures Manual as there is federal funding in the project. Carlo J. Capalbo, MPA, CPRE Executive Director DuPa g e Ri verTrail1DSHUYLOOH5RDG,/(UG6WUHHW &RSSHU'ULYH,/:UG6WUHH W 6RXUFH(VUL'LJLWDO*OREH*HR(\H(DUWKVWDU*HRJUDSKLFV&1(6$LUEXV'686'$86*6$HUR*5,',*1DQGWKH*,68VHU&RPPXQLW\ 143rd Street Extension - Plainfield, Will Co., IL EXHIBIT 1 -, )HHW ([LVWLQJ33'3URSHUW\ Path Section $SSHQGL[& 3ODLQILHOGUG6WUHHW([WHQVLRQ 3ODLQILHOG3DUN'LVWULFW3URSHUW\±3ODLQILHOG:LOO&R,/ 3KRWRJUDSKLF/RJ 9LHZHDVWWKURXJKWKH3ODLQILHOG3DUN'LVWULFWISURSHUW\IURPWKHZHVWHUQSURSHUW\HGJH 9LHZVRXWKDORQJWKH'X3DJH5LYHUIURPWKHFHQWHURIWKH3ODLQILHOG3DUN'LVWULFWISURSHUW\ 3ODLQILHOGUG6WUHHW([WHQVLRQ 3ODLQILHOG3DUN'LVWULFW3URSHUW\±3ODLQILHOG:LOO&R,/ 3KRWRJUDSKLF/RJ 9LHZQRUWKDORQJWKH'X3DJH5LYHUWRZDUGVWKH3ODLQILHOG3DUN'LVWULFWISURSHUW\IURPWKH&RP(G FRUULGRU 9LHZZHVWWRZDUGVWKHQRUWKHUQWHUPLQXVRIWKHH[LVWLQJ'X3DJH5LYHU7UDLOVRXWKRIWKH3ODLQILHOG3DUN 'LVWULFWISURSHUW\IURPWKH'X3DJH5LYHU APPENDIX 20 COSIMǦ 1 Alexandra Zelles From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Thursday, February 27, 2020 1:14 PM To:Tice 'Charles' Cole; Alexandra Zelles Cc:Mike Wittkop; Randy Jessen; Scott Threewitt; DavisD1, Michelle L. Subject:FW: Plainfield - 143rd Extension - 06-00040-00-FP - Environmental - COSIM pre-screen ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice,Alexandra, Plainfield/143rdSt.Extension,sec.06Ͳ00040Ͳ00ͲFP SeetheresponsebelowfromourCentralOffice,inregardstotheCOSIMworksheetsforthesubjectproject. PleaseincludethisstringofemailsinthefinalProjectDevelopmentReport. Thanks, Kevin From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Monday,February24,20207:29:41AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲCOSIMpreͲscreen Mr. Stallworth - Based on the information provided and in accordance with BDE Section 26-14.03(c) this project is exempt from a project level CO air quality analysis. In accordance with the IDOT-IEPA “Agreement on Microscale Air Quality Assessments for IDOT Sponsored Transportation Projects,” this project is exempt from a project-level carbon monoxide air quality analysis because the highest design-year approach volume on the busiest leg of the intersection is less than 5,000 vph or 62,500 ADT. Please ensure that a copy of the COSIM worksheets and this email are inserted in to the project development report when it is submitted for review. If you have any questions, please call, William Raffensperger, PE, PTOE, PTP Project Development Engineer Illinois Department of Transportation Bureau of Local Roads and Streets 2300 S. Dirksen Parkway 2 Springfield, IL 62764 (O) 217-785-1676 (C) 217-720-2787 From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Thursday,February20,20203:39PM To:Raffensperger,William<William.Raffensperger@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲCOSIMpreͲscreen Bill, Plainfield/143rdStreetfromIL59toIL126,sec.06Ͳ00040Ͳ00ͲFP IamreͲforwardingtheCOSIMsheetsforthesubjectproject.Whenyoulookedatthempreviously,youaskedthatthe localagencyalsosubmitthemissingCOSIMsheetfor143rd&NapervilleRoad.Itisnowincludedintheattached. Pleasereviewandcomment. Thanks, Kevin From:AlexandraZelles<azelles@cmtengr.com> Sent:Monday,February17,202010:31AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;Tice'Charles'Cole<ccole@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com> Subject:[External]RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲCOSIMpreͲscreen HiKevin, Attached,pleasefindCOSIMsheetsforallthreeprojectintersections,includingthepreviouslyapproved143rd& NapervilleRdCOSIMsheet. Pleaseletmeknowifyouneedanythingelse. Thanks, Alex ALEXANDRAZELLES|Crawford,Murphy&Tilly|w630.907.7072|m630.632.5859 EnvironmentalScientist From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Friday,February14,20202:22PM To:AlexandraZelles<azelles@cmtengr.com> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;Tice'Charles'Cole<ccole@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com> Subject:FW:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲCOSIMpreͲscreen 3 Alexandra, PerourCentralOffice’srequest:PleaseprovidethemissingCOSIMsheetfor143rd&NapervilleRoad. Thanks, Kevin From:AlexandraZelles<azelles@cmtengr.com> Sent:Friday,February7,202012:13PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;Tice'Charles'Cole<ccole@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;ScottThreewitt<sthreewitt@goplainfield.com> Subject:[External]PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲCOSIMpreͲscreen HiKevin, AttachedaretheCOSIMpreͲscreenformsforIL126andRoute30/IL59andanupdateCOSIMmap,perthedraftPDR comments. Pleaseletusknowifyouneedanythingelse. Thankyou, ALEXANDRAZELLES|Crawford,Murphy&Tilly|w630.907.7072|m630.632.5859 EnvironmentalScientist From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Thursday,January30,20202:34PM To:Tice'Charles'Cole<ccole@cmtengr.com> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;Scott Threewitt<sthreewitt@goplainfield.com> Subject:RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances Tice, IhaveinquiredtoourCentralOfficeastothestatusofBiological,CulturalandWetlandssurveysandNoiseAnalysis.I willgetbacktoyouassoonastheyrespond. Ofcourse,thePESA(obtainedinJuly2019)satisfiesthePhase1Addendumrequirementsforthisproject.Weare awaitingyouractioninregardstothesection4(f)andairquality,perthedraftPDRcomments. Thankyou, Kevin From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Thursday,January30,20201:17PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop 4 <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com>;RandyJessen<rjessen@goplainfield.com>;Scott Threewitt<sthreewitt@goplainfield.com> Subject:[External]RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances Kevin, I’llbepreparinganINFRAgrantapplicationforthisprojectforPlainfieldinFebruary.Oneoftheslectioncriteriafor projectreadinesstalksaboutthestatusoftheNEPAreview/approval.Iwilllikelydiscussthefederallyapproved categoricalexclusionreapprovalandthestatusofthevariousenvironmentalitemsunderreview.Doyouhaveany updatesonclearancesreceivedaslistedbelow? Thanks, Tice Charles“Tice”Cole|Crawford,Murphy&Tilly|w630.907.7059 ProjectEngineer From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Thursday,January2,20204:06PM To:Tice'Charles'Cole<ccole@cmtengr.com> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com> Subject:RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances Tice, Iconcurwithyoursummarybelow. Thanks, Kevin From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Thursday,January2,20203:03PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com> Subject:[External]RE:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances HiKevin, Withourlatestenvironmentaldocumentsubmittalsoverthepastfewweeks,Iwantedtomakesurewearebothonthe samepageforattainingallenvironmentalclearances/approvalsinthecomingmonth: Topic–CourtͲNote 1. Wetlands–IDOT–DelineationandWIEsubmitted 2. Biological–IDOT–DelineationandWIEsubmitted 3. SpecialWaste–IDOT–PESACompletedbyIDOT 4. Cultural–IDOT–BuildingImpactssubmitted 5. Noise–IDOT–NoiseReportSubmitted 6. Section4(f)–Plainfield,ParkDistrict,CMT–PlainfieldsendOWJlettertobecompleted,CMTaddressDraftPDR comments 7. AirQuality–CMT–AddressDraftPDRComments 5 Pleaseletmeknowifanyoftheaboveisincorrectforstatus. Thanks, Tice Charles“Tice”Cole|Crawford,Murphy&Tilly|w630.907.7059 ProjectEngineer From:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Sent:Wednesday,October16,20194:15PM To:Tice'Charles'Cole<ccole@cmtengr.com> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com> Subject:FW:PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances Tice, OurCentralOfficeCulturalUnitprovidedthefollowingadvice: As10yearshavepassedsincelastculturalreview,wemustreevaluatetheentireprojectoncethisamountof timehaspassed.Giventhearchaeologyworkandcoordinationdonebackin2006,wehavedeterminedthatno additionalarchaeologyworkisneededatthistime.However,wejustdidaquickscreenforhistoric architecture,andthisprojectneedsahistoricresourcesinventorytobecompletedbyourstatewideconsultant. InordertofullyevaluateeffectsanddetermineifSHPOconsultisneeded,thelocalagencymustprovidethe following: x Listofpropertiesbyaddressinwhichbuildingsmaybeacquiredanddemolished. x Amaphighlightingallthebuildingsthatmaybeacquiredanddemolished. x ConceptPlansandDraftPhaseIPlans(whenavailable)showinglocationofnewroadway. Thanks, Kevin From:Tice'Charles'Cole<ccole@cmtengr.com> Sent:Monday,October14,20191:59:08PM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>;HeatherLacey<hlacey@cmtengr.com>;MikeWittkop <mwittkop@cmtengr.com>;AlexandraZelles<azelles@cmtengr.com> Subject:[External]PlainfieldͲ143rdExtensionͲ06Ͳ00040Ͳ00ͲFPͲEnvironmentalͲClearances HiKevin, ThefollowingisthecurrentstatusoftheenvironmentalclearancesasfarasIknow: 1. Wetlands–CMTtocompletewetlandreportforAddendumareasandsubmitwetlandreportsalongwithWIE 2. Biological–CMTtocompletewetlandreportandsubmittoIDOTbeforeIDOTissuesclearance 6 3. SpecialWaste–StatecompletedPESAforentireprojectlimits;CMTtocompletePESAResponsebeforeIDOT issuesclearance 4. Cultural–CMTSubmittedESRbutdon’tknowstatus Letmeknowifyouhavecommentsonthestatusabove. Iknowthatwe’redemolishingaselfͲstoragefacilityatthenortheastquadrantofIL59at143rdanddemolishingone, maybetwo,residentialhomesatthenortheastquadrantofNapervilleRoadandproposed143rdSt.Isthereanythingwe needtodofurthertoreceivetheculturalclearance? Thanks, Tice CHARLES“TICE”COLE,P.E.,PTOE|ProjectEngineer To help protect your priv acy, Microsoft Office prevented automatic download of this picture from the Internet.http://www.cmtengr.com/it_public_resources/images/email/cmt_logo_sm.png Crawford,Murphy&Tilly|Engineers&Consultants 550NorthCommonsDrive,Suite116|Aurora,IL60504 w630.907.7059|f630.820.0350|ccole@cmtengr.com CenteredinValue State of Illinois - CONFIDENTIALITY NOTICE: The information contained in this communication is confidential, may be attorney-client privileged or attorney work product, may constitute inside information or internal deliberative staff communication, and is intended only for the use of the addressee. Unauthorized use, disclosure or copying of this communication or any part thereof is strictly prohibited and may be unlawful. If you have received this communication in error, please notify the sender immediately by return e-mail and destroy this communication and all copies thereof, including all attachments. Receipt by an unintended recipient does not waive attorney-client privilege, attorney work product privilege, or any other exemption from disclosure. :LOO&RXQW\,/ UG6WUHHW([WHQVLRQ 3URSRVHGUG6WUHHWDQG1DSHUYLOOH5RDG 3OHDVHQRWH5HFHSWRULVSODQQHGIRUDFTXLVLWLRQLILWGRHVQRWSDVVWKHSUHVFUHHQDQDO\VLVZH FRXOGFKRRVHWRGHPRWKHEXLOGLQJDQGXVH5HFHSWRUIRUWKHDQDO\VLV5HFHSWRULVQRWFXUUHQWO\ SODQQHGIRUDFTXLVLWLRQKRZHYHUWKHFXUUHQWSURSHUW\RZQHUVPD\RUPD\QRWQHJRWLDWHLWVVDOH GXULQJ3KDVH,,WRWKHSURMHFWVSRQVRU%RWKKDYHEHHQLGHQWLILHGRQWKHDWWDFKHGPDSDVZHOODV 5HFHSWRUWKHWKLUGQHDUHVWUHFHSWRUWRWKHSURMHFW :LOO&RXQW\,/ UG6WUHHW([WHQVLRQ ([LVWLQJUG6WUHHWDQG,/ :LOO&RXQW\,/ UG6WUHHW([WHQVLRQ ([LVWLQJUG6WUHHWDQG86 (1) This receptor is not currently planned for acquistion; however, the current property owner may or may not negotiate its sale. It has been included as the nearest receptor (30.7 ft). (3) This receptor is not planned for acquisition. It is the third nearest receptor (112 ft). (2) This receptor is not currently planned for acquistion; however, the current property owner may or may not negotiate its sale. It has been included as the second nearest receptor (39.6 ft). 112' 30.7'39.6' 109' 56' 143rd Street Extension - Plainfield, Will Co., IL COSIM PRE-SCREEN ANALYSIS 0 350 700175 Feet Legend Receptor Locations along Project Corridor N Division StreetNaperville RoadState Route 126 30 30 D u P a g e R i v e r Lake PlainfieldService Layer Credits: Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community 59 APPENDIX 21 Noise Analysis 1 Mike Wittkop From:Stallworth, Kevin D <Kevin.Stallworth@illinois.gov> Sent:Wednesday, April 1, 2020 10:04 AM To:Tice 'Charles' Cole Cc:Randy Jessen; Scott Threewitt; Mike Wittkop; Alexandra Zelles Subject:RE: D1 - Will Co - Plainfield Sec 06-00040-00-FP (Seq 13370) 143rd S; Revised Noise Report ExternalMessage:ThisemailwassentfromsomeoneoutsideofCMT.Pleaseusecautionwithlinksandattachments fromunknownsendersorreceivingunexpectedemails. Tice, Plainfield/143rdSt.Extension,section06Ͳ00040Ͳ00ͲFP OurIDOTCentralBureauofDesignandEnvironmenthasprovidedtheirconcurrencewiththelatestsubmittalofthe noisereportforthesubjectproject.Seebelow.Pleaseincludeacopyofthisstringofemailsinthefinalproject developmentreport,alongwithacopyofthefullnoisereport. Thankyou. KevinStallworth IDOTDist.1BureauofLocalRoads&Streets ͲͲͲͲͲOriginalMessageͲͲͲͲͲ From:Raffensperger,William<William.Raffensperger@illinois.gov> Sent:Wednesday,April1,20207:08AM To:Stallworth,KevinD<Kevin.Stallworth@illinois.gov> Cc:DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov> Subject:FW:D1ͲWillCoͲPlainfieldSec06Ͳ00040Ͳ00ͲFP(Seq13370)143rdS;RevisedNoiseReport Mr.StallworthͲ Pleaseseebelow.PleaseensurethatacopyofthisemailandnoisestudyareincludedinthePDRwhenitissubmitted forreview. ͲͲͲͲͲOriginalMessageͲͲͲͲͲ From:Veile,JanelM<Janel.Veile@illinois.gov> Sent:Tuesday,March31,20203:51PM To:DOT.LocalAgencyESR<DOT.LocalAgencyESR@illinois.gov> Cc:Stallworth,KevinD<Kevin.Stallworth@illinois.gov>;DavisD1,MichelleL.<Michelle.L.DavisD1@Illinois.gov>; Raffensperger,William<William.Raffensperger@illinois.gov> Subject:RE:D1ͲWillCoͲPlainfieldSec06Ͳ00040Ͳ00ͲFP(Seq13370)143rdS;RevisedNoiseReport Greetings, Therevisednoisereportisapproved.Thankyou. 2 JanelVeile,DoctorateinPublicAdministrationStudentAirQuality&NoiseSpecialist/ProjectCoordinatorDistricts2,3,5 ,6&CREATEBureauofDesignandEnvironmentIllinoisDepartmentofTransportation 2300S.DirksenParkway Springfield,IL62764 NewPhone:217Ͳ785Ͳ0202 Knowingisnotenough;wemustapply.Willingisnotenough;wemustdo. ͲJohannWolfgangvonGoethe StateofIllinoisͲCONFIDENTIALITYNOTICE:Theinformationcontainedinthiscommunicationisconfidential,maybe attorneyͲclientprivilegedorattorneyworkproduct,mayconstituteinsideinformationorinternaldeliberativestaff communication,andisintendedonlyfortheuseoftheaddressee.Unauthorizeduse,disclosureorcopyingofthis communicationoranypartthereofisstrictlyprohibitedandmaybeunlawful.Ifyouhavereceivedthiscommunication inerror,pleasenotifythesenderimmediatelybyreturneͲmailanddestroythiscommunicationandallcopiesthereof, includingallattachments.ReceiptbyanunintendedrecipientdoesnotwaiveattorneyͲclientprivilege,attorneywork productprivilege,oranyotherexemptionfromdisclosure. TRAFFIC NOISE TECHNICAL REPORT PLAINFIELD 143RD STREET EXTENSION SECTION 06-00040-00-FP VILLAGE OF PLAINFIELD, WILL COUNTY, ILLINOIS MARCH 13, 2020 PREPARED FOR: VILLAGE OF PLAINFIELD 24401 WEST LOCKPORT STREET PLAINFIELD, IL 60544 PREPARED BY: CRAWFORD, MURPHY & TILLY, INC. 550 NORTH COMMONS DRIVE, SUITE 116 AURORA, IL 60504 Noise Analysis Report Plainfield 143rd Street Extension TABLE OF CONTENTS Executive Summary ................................................................................................................................ 1 Project Information ................................................................................................................................. 2 Traffic Noise Analysis Background Information and Regulations ............................................................ 3 Federal Regulations ............................................................................................................................ 3 Table 1: FHWA Noise Abatement Criteria (NAC) Activity Categories .............................................. 4 IDOT Policy ......................................................................................................................................... 5 Existing Conditions and Modeled Noise Environment ............................................................................. 7 TNM Modeled Objects ........................................................................................................................ 7 Traffic Volumes ................................................................................................................................. 10 Noise Measurements and Model Validation ........................................................................................... 11 Field Noise Measurements ................................................................................................................ 11 Traffic Noise Model Validation .......................................................................................................... 11 Table 2: Model Validation Results .................................................................................................. 11 Traffic Noise Model Results and Impact Assessment ............................................................................ 12 Table 3: Representative Receptor Descriptions............................................................................. 12 Table 4: Traffic Noise Predictions and Impact Assessment ............................................................ 13 Consideration of Abatement ................................................................................................................. 14 Abatement Measures Considered ..................................................................................................... 14 Traffic Noise Barrier Analysis, CNE 2 ................................................................................................. 14 Table 5: Traffic Noise Predictions and Impact Assessment, CNE 2 Receptors ............................... 15 Table 6: Barrier Insertion Results and Allowable Cost Analysis, CNE 2 .......................................... 16 Table 7: Physical Features and Estimated Costs, Barriers for CNE 2 .............................................. 16 Traffic Noise Barrier Analysis, CNE 3 and CNE 4 .................................................................................17 Table 8: Traffic Noise Predictions and Impact Assessment, CNE 3 and CNE 4 ................................ 17 Table 9: Barrier Insertion Results and Allowable Cost Analysis, CNE 3 and CNE 4 Front-Row Receptors ...................................................................................................................................... 19 Table 10: Physical Features and Estimated Costs, Barriers for CNE-3 ........................................... 21 Construction Noise ............................................................................................................................... 22 Coordination With Local Government Officials ..................................................................................... 22 Conclusions and Recommendations ..................................................................................................... 22 Noise Analysis Report Plainfield 143rd Street Extension APPENDICES APPENDIX A: Figures APPENDIX B: Field Data APPENDIX C: Traffic and Design Data Noise Analysis Report Plainfield 143rd Street Extension 1 EXECUTIVE SUMMARY The Plainfield 143rd Street Extension project will connect the existing segments of 143rd Street located east of IL 126 (Main Street) and west of IL 59 (Division Street) in the Village of Plainfield, Will County, Illinois. The connector will be constructed on new alignment adjacent to the northern edge of an existing ComEd electrical transmission line corridor and will result in the modification of the intersection of 143rd Street with IL 59, the realignment of 143rd Street with IL 126 and a new intersection with South Naperville Road. The new roadway will consist of two travel lanes in each direction and both right and left turn lanes at the intersections with IL 126, IL 59 and Naperville Road. All three intersections will be signalized. The project area has mixed development. Along IL 59 development is primarily commercial and industrial. Along Naperville Road and IL 126, residential development and recreational uses predominate. Due to the relatively low traffic volumes on existing roadways in the latter area, both impacts based on exceedances of the NAC and impacts based on a substantial increase in noise were identified. Impacted Common Noise Environments (CNEs) included the following: x CNE-2: Residences on South Naperville Road north of its proposed intersection with 143rd Street x CNE-3: Mary Immaculate Cemetery, located south of the ComEd corridor on the east side of South Naperville Road x CNE-4: Residences in the Copper Drive neighborhood along the south side of the ComEd corridor west of IL 126 The proposed project is anticipated to have traffic noise impacts, but the noise barriers studied and identified in Tables 7 and 10 do not meet IDOT’s feasibility and reasonableness criteria. Due to this, traffic noise abatement measures are not likely to be implemented based on preliminary design. If the project’s final design is different from the preliminary design, IDOT will determine if revisions to the traffic noise analysis are necessary. A final decision on noise abatement will not be made until the project’s final design is approved and the public involvement process is complete. To limit noise during construction, the project will comply with local noise ordinances and with IDOT Standard Specification for Road and Bridge Construction Articles 107.35 and 107.41. Noise Analysis Report Plainfield 143rd Street Extension 2 PROJECT INFORMATION The Plainfield 143rd Street Extension project is located in Plainfield, Will County, Illinois and extends from the intersection of West 143rd Street with IL 59 eastward to the intersection of East 143rd Street with IL 126. The alignment is located directly north of an existing ComEd regional transmission line corridor (ComEd utility corridor). The project location is shown on the Location Map in Appendix A. The project was designed and reviewed in 2016 based on the original preferred location, which required an easement to be obtained from the ComEd utility corridor for construction of the roadway. No agreement with ComEd was reached. The current design moves the project north of the ComEd property onto property developed with residential, commercial and recreational uses. The project involves construction of the roadway on new location, and therefore it is classified as a Type I project for noise according to the definition of Type I projects in 23 CFR 772.5. The proposed 143rd Street Extension will consist of two through lanes in each direction with a center median that includes left turn lanes at the intersections with IL 59, IL 126 and Naperville Road. The project will add a fourth, eastern leg to the existing signalized intersection of 143rd Street with IL 59; the existing 143rd Street west of this intersection will be widened to include additional through and turn lanes. A new signalized intersection will be created at Naperville Road, which will be widened at the intersection to include left turn lanes in both directions and a southbound right turn lane. The existing one-way stop intersection of 143rd Street with IL 126 will be moved north and reoriented to reduce skew. It will be signalized, and a westbound left turn lane will be added to the existing East 143rd Street. IL 126 at this intersection will be widened to accommodate right and left turn lanes in both directions. To accommodate the northern shift onto the recreational Bass & Gill Club property located between IL 126 and Naperville Road, a portion of the existing fishing lake will be filled and a retaining wall will be constructed to minimize fill and to support the new roadway. Noise Analysis Report Plainfield 143rd Street Extension 3 TRAFFIC NOISE ANALYSIS BACKGROUND INFORMATION AND REGULATIONS Noise is generally defined as unwanted sound. Its loudness is measured in terms of sound pressure levels expressed in decibels (dB) and is composed of a wide range of frequencies. The decibel scale is logarithmic and expresses the ratio of the sound pressure unit being measured to a standard reference level. Most sounds occurring in the environment do not consist of a single frequency, but rather a broad band of differing frequencies. Frequencies are measured in hertz (Hz), which is the number of cycles per second. The human ear is typically capable of hearing frequencies from approximately 20 to 20,000 Hz, and is less sensitive to higher and lower frequencies than mid-range frequencies. To compensate for low-end and high-end frequency insensitivity and to render noise levels readings more relevant to human experience, an "A-weighting" scale is used to approximate the response of the human ear. The A-weighted decibel (dB(A)) unit emphasizes measurement of perceptible sound energy and factors out the frequencies not perceptible to humans. The dB(A) unit may indicate the level of environmental noise at an instant in time, but community noise levels vary continuously. Most environmental noise includes a composite of noise from different sources, creating a relatively steady background noise in which no particular source is identifiable. To describe the time-varying character of traffic noise, the equivalent hourly sound level Leq(h), is commonly used. Leq(h) is defined as the equivalent steady-state sound level over a one- hour period which contains the same acoustic energy as the time-varying sound level during the same period. Noise levels referred to in this report are stated as hourly-equivalent sound pressure levels Leq(h) expressed in units of dB(A). As decibels are logarithmic units, sound levels cannot be added by ordinary arithmetic means. The following general relationships provide a basic understanding of sound generation and propagation: x The noise level from a line source, such as moving traffic on a road, will decrease approximately 3 dB(A) with every doubling of distance from the source. x Research has indicated that a difference of 10 dB(A) is perceived as twice as loud (or half as loud) to the human ear. x Typically, the human ear can barely perceive a 3 dB(A) change in loudness. FEDERAL REGULATIONS The Federal Aid Highway Act of 1970 required the Federal Highway Administration (FHWA) to develop noise standards and abatement requirements for highway traffic noise. These standards are contained in Title 23, Code of Federal Regulations (CFR), Part 772, Procedures for Abatement of Highway Traffic Noise and Construction Noise. This regulation applies to highway construction projects where a state department of transportation has requested Federal funding for participation in the project. 23 CFR 772 provides procedures for preparing operational and construction noise studies and evaluating noise abatement considered for federal and federal-aid highway projects. The regulations do not mandate that the abatement criteria be met in all situations, but rather require that reasonable and feasible efforts be made to provide noise mitigation when the abatement criteria are approached or exceeded. Per 23 CFR 772.3, all highway projects that are developed in conformance with this regulation are deemed to be in conformance with FHWA noise standards. Noise Analysis Report Plainfield 143rd Street Extension 4 FHWA has developed three “project types” to assess noise analysis applicability. Federal regulations only apply to Type I and Type II projects. Type III projects are ones that do not meet the definition of a Type I or Type II project and do not require a noise analysis. The Plainfield 143rd Street Extension project will be constructed on new location and is a Type I project as defined in 23 CFR 772.5. Therefore, a traffic noise analysis is required for the full project limits. The FHWA regulations establish Noise Abatement Criteria (NAC) activity categories based on land use to assess potential traffic noise impacts as defined in 23 CFR 772. The FHWA NAC and description of activity categories are shown in Table 1. Traffic noise impacts occur when predicted design year noise levels under the build scenario approach, meet or exceed the NAC, or if there are substantial increases in traffic noise over existing conditions, independent of the NAC. The FHWA NAC are used to identify locations where traffic noise impacts occur. The NAC are not used as goals for noise attenuation design criteria or design targets. FHWA requires use of FHWA Traffic Noise Model (TNM) 2.5 to determine current and future traffic noise levels created by a proposed project; TNM 2.5 has been used to perform this noise analysis. FHWA has deferred to the State agencies to define the noise level that “approaches” the NAC and to define a substantial increase in traffic noise levels. TABLE 1: FHWA NOISE ABATEMENT CRITERIA (NAC) ACTIVITY CATEGORIES Activity Category Leq (1 hour) Description of Activity Category A 57 dBA (exterior) Lands on which serenity and quiet are of extraordinary significance and serve an important public need and where the preservation of those qualities is essential if the area is to continue to serve its intended purpose. B 67 dBA (exterior) Residential. C 67 dBA (exterior) Active sport areas, amphitheaters, auditoriums, campgrounds, cemeteries, day care centers, hospitals, libraries, medical facilities, parks, picnic areas, places of worship, playgrounds, public meeting rooms, public or nonp rofit institutional structures, radio studios, recording studios, recreation areas, Section 4(f) sites, schools, television studios, trails and trail crossings. D 52 dBA (interior) Auditoriums, day care centers, hospitals, libraries, medical facilities, places of worship, public meeting rooms, public or nonprofit institutional structures, radio studios, recording studios, schools and television studios. E 72 dBA (exterior) Hotels, motels, offices, restaurants/bars, and other developed lands, properties or activities not included in A-D or F. F - Agriculture, airports, bus yards, emergency services, industrial, logging, maintenance facilities, manufacturing, mining, rail yards, retail facilities, shipyards, utilities (water resources, water treatment, electrical) and warehousing. G - Undeveloped lands that are not permitted. Source: 23CFR772, Table 1 Noise Analysis Report Plainfield 143rd Street Extension 5 If one or both of these conditions (noise level approaching the NAC or substantial increase in noise level) are met as a result of the proposed project, 23 CFR 772 requires that noise abatement measures must be considered. Noise abatement measures may include the following: x Noise barrier construction: Noise barriers reduce noise by blocking the path of sound between the source of the noise and the receiver. To be effective, a noise barrier should be located adjacent to either the noise source or the receiver. There must be a long, continuous break of the line-of-sight from the highway to the receiver. x Traffic management measures: These may include restrictions on speed, restrictions on traffic volumes, restricted access for certain motor vehicle types, and restricted times of travel. x Alteration of horizontal and vertical alignments: Alignment of the road refers to the physical layout and location of the highway. A highway’s noise impacts may be altered by shifting it in the horizontal or vertical direction. x Noise insulation of public use or non-profit institution structures: For buildings listed under Category D in Table 1, insulation may be considered as a noise mitigation strategy; this strategy is not available to other types of noise-sensitive development. x Acquisition of real property: In this case, the DOT acquires, or acquires interest in, primarily undeveloped property near the roadway that is the noise source, to preempt its future development with noise-sensitive uses. IDOT POLICY FHWA requires that all states have an approved policy to identify and address highway traffic noise impacts. The Illinois Department of Transportation (IDOT) Highway Traffic Noise Assessment Manual, effective April 2018, was developed to implement the requirements of 23 CFR Part 772 and the noise-related requirements of the National Environmental Policy Act (NEPA) of 1969. The manual carries out the Illinois state policy established in Chapter 26-6 of IDOT’s Bureau of Design and Environment (BDE) Manual, which includes: x Criteria and procedures for noise analyses x Noise abatement measures and related coordination x Noise abatement criteria prescribed by Federal regulations IDOT policy defines noise impacts as modeled traffic-generated noise levels that are predicted to be within 1 dB(A) of, meet, or exceed the NAC for the appropriate activity category (the Noise Abatement criterion) in the design year if the project is constructed, or that increase by 15 dB(A) or more over the existing traffic-generated noise levels (the Substantial Increase criterion) in the design year if the project is constructed. Modeled noise levels are rounded to the nearest whole number; thus a result of 65.5 dB(A) at an Activity Category B receptor is considered an impact. To evaluate noise impacts, IDOT requires that all property uses within 500 feet of the project alignment be grouped into Common Noise Environments (CNE) that include receptors in the same Activity Category that are exposed to similar noise sources and levels; traffic volumes, traffic mix and speed; and topographic features. One Representative Receptor per CNE is modeled; the Representative Receptor has the worst-case noise condition of all receptors in its CNE. If a Noise Analysis Report Plainfield 143rd Street Extension 6 Representative Receptor is found to have a noise impact then all of the receptors in the CNE, including the Representative Receptor, are studied for abatement. IDOT policy states that barriers to mitigate traffic noise impacts are considered only if they are feasible and reasonable to construct. To be feasible, the barrier must provide a substantial decrease in noise levels, defined as at least 5 decibels for at least two impacted receptors, and must meet engineering requirements of constructability. A barrier that is reasonable to construct must achieve the noise reduction design goal of at least 8 decibels for at least one benefited receptor, must not exceed the allowable noise abatement cost and must be desired by more than 50% of benefited receptors as reflected by received votes in viewpoints solicitation. The allowable noise abatement cost is based on a cost per benefited receptor comparison, where a benefited receptor is defined as a receptor receiving at least 5 decibels of noise reduction. Adjustments are made to the per-benefited-receptor cost based on the magnitude of predicted noise levels, the increase in predicted noise levels in the design year over existing noise levels, and the construction date of the receptor compared to that of the original construction of the highway. Cost of right of way obtained solely for purposes of constructing the noise abatement measures is included in the total cost of the abatement. IDOT allows cost averaging among CNEs when multiple CNEs are being considered for abatement and the proposed abatement measures meet certain requirements. The objectives of this noise study are to: x Identify noise sensitive land uses within the traffic noise analysis area. x Characterize the existing noise environment through field noise measurement at representative noise receptor sites. x Validate the TNM computer model (the TNM) using traffic data collected during the field measurement period. x Use the TNM to predict the existing year and design year traffic noise levels at noise receptor sites using traffic volumes developed by IDOT-accepted models. x Identify impacted receptor sites and use the TNM to determine if noise abatement measures are reasonable and feasible. x Provide limited information in response to information requests during public involvement. Nearby residents located north of the traffic noise analysis area (i.e. more than 500 feet north of the 143rd Street extension) and with property fronting on the Bass & Gill Club fishing lakes expressed concern regarding changes in noise levels related to the proposed project. Where such information is provided, the recipients will be cautioned concerning the known limits of the TNM at this distance. Noise Analysis Report Plainfield 143rd Street Extension 7 EXISTING CONDITIONS AND MODELED NOISE ENVIRONMENT All properties in the noise study area, defined as the area within 500 feet of the proposed 143rd Street, were classified according to their Noise Abatement Criteria (NAC) land use activities. The Noise Abatement Criteria Land Use Activity Categories and Common Noise Environments (CNEs) and Representative Receptors (RRs) figures in Appendix A are accompanied by a description of the noise sensitive CNEs that were identified in the project area and a discussion of the properties that are not considered noise sensitive. The undeveloped properties in the area are also identified in the NAC figure and accompanying description, and include the undeveloped portion of a church property located southwest of the intersection of 143rd Street and IL 59, undeveloped parcels located southeast of the same intersection, undeveloped land along the DuPage River northwest of the residential properties in the northwest quadrant of the proposed intersection of 143rd Street with Naperville Road, and recreational land owned by the Plainville Park District that does not currently have any noise sensitive exterior gathering areas. The project area includes the DuPage River between IL 59 and South Naperville Road, the Bass and Gill Club fishing lakes east of South Naperville Road and north of the ComEd utility corridor, and the additional fishing lakes east of IL 126. These features are at a lower elevation compared to the surrounding, relatively level ground. While the river does not typically have a large expanse of water surface that would be expected to affect sound propagation, the potential for expedited sound propagation across the fishing lakes was considered in the TNM. Between Naperville Road and IL 126, the 143rd Street extension will be constructed on fill supported by a retaining wall placed within the southern edge of the lake. Between IL 59 and Naperville Road where it crosses the DuPage River, the new roadway will be on structure. The project design revises the alignment of 143rd Street east of IL 126 to reduce skew at the new four-leg intersection, and adds turn lanes on IL 59, Naperville Road and IL 126 at their intersections with 143rd Street. TNM MODELED OBJECTS Each model includes sensitive receivers, applicable roadways and sufficient terrain to represent local conditions, as discussed above. Representative receptors were used to validate the model and determine impacts. Additional receivers reflecting the represented receptors were added to the models for impacted CNEs during barrier analysis to calculate existing noise levels for potential benefitted receptors. In all cases, pavement width of travel lanes and center two-way left-turn lanes (TWLTL) is based on typical sections with one foot or less added to allow for lane overlap. Intersections were modeled in accordance with NCHRP guidance on modeling signalized and unsignalized intersections in TNM.1 Pavement width of each modeled lane is as indicated in typical sections within the project plans, with a small addition to promote continuous pavement across each roadway in TNM’s calculations. 1 National Cooperative Highway Research Program (2014). NCHRP Report 791, Supplemental Guidance on the Application of FHWA’s Traffic Noise Model (TNM). Noise Analysis Report Plainfield 143rd Street Extension 8 The Build and Barrier models incorporate the new 143rd Street roadway plan and profile as shown in project plans, and surface contour changes proposed for the project as detailed in the drawing for Bass & Gill Typical Section Alternative 1. Specific features of models for each area are as follows: Plainfield 143rd Street Extension Existing, Validation and 2050 No Build models x IL 59 north and south of 143rd Street: two travel lanes in each direction and center lane with no traffic to represent the TWLTL x 143rd Street west of IL 59: one travel lane in each direction, center lane with no traffic to represent the TWLTL and right-turn lane with no traffic to incorporate this paved area o At the intersection of IL 59 and 143rd Street, IL 59 is considered the dominant roadway x Naperville Road north and south of the proposed future 143rd Street: one travel lane in each direction x IL 126 north and south of 143rd Street: one travel lane in each direction x 143rd Street east of IL 126: one travel lane in each direction (on existing alignment) x Copper Drive west of IL 126: due to extremely low traffic, modeled as one travel lane extending the width of the pavement x Terrain lines at the top and bottom of the east and west banks of the DuPage River, taken from Will County-provided LiDAR x Terrain lines at the top and bottom of the slopes down to the Bass & Gill Club, Pure Rod & Gun Club and Deer Creek Recreation Club lakes x Water ground zones representing the Bass & Gill Club and Deer Creek Recreation Club lakes. The Pure Rod & Gun Club lake was not represented because no modeled noise was expected to travel from a roadway to a receptor across the lake x Building row to represent the buildings located between the receptors at Pure Rod & Gun Club (RR 6) and IL 126 x RRs 1 through 8 as shown on the Representative Receptor figure in Appendix A x Validation model only: GIS-determined locations for RRs 1 through 5, which were included in field monitoring Plainfield 143rd Street Extension 2050 Build model Based on the No Build model with the following additions/changes: x Southbound right turn lane added to IL 59 at 143rd Street x Eastbound right turn lanes and westbound outside merge lane added to 143rd Street west of IL 59 with no traffic, to represent expanded pavement width x 143rd Street extension added between IL 59 and IL 126, with two through lanes in each direction and a TWLTL with no traffic in the center. x Westbound right turn lane on 143rd Street added at IL 59 with no traffic, to represent pavement width x Appropriate segments of 143rd Street extension between IL 59 and Naperville Road modeled as on structure to represent DuPage River bridge x Terrain lines added at base of DuPage River bridge and existing terrain lines in this area modified to prevent intersections of TNM objects Noise Analysis Report Plainfield 143rd Street Extension 9 x Parapet barrier modeled on northern edge of DuPage River bridge x On Naperville Road at the new 143rd Street intersection, the following were added to represent pavement width: o Center lane with no traffic to represent left turn lanes o Southbound right turn lane o Pavement ground zones in northeast and southwest quadrants to represent right turn lanes at this skewed intersection x On the north side of 143rd Street between Naperville Road and IL 126, the following were added to represent the Bass & Gill Club retaining wall and associated changes: o Northern lane with no traffic represents the snow storage area between the roadway and the retaining wall; the edge of this lane models the top of the retaining wall o Terrain line representing the bottom of the retaining wall o Other terrain lines in this area modified to prevent intersections of TNM objects o Reduced extent of southern edge of water ground zone due to fill in this area x The intersection of 143rd Street and IL 126 was adjusted northward as proposed; terrain lines on the east side of IL 126 were adjusted to prevent intersections of TNM objects x Two center lanes with no traffic were added to 143rd Street east of IL 126 to represent the westbound left turn lane and the wider pavement provided to accommodate turns at this skewed intersection x Two pavement ground zones on the west side of IL 126 at 143rd Street reflect turn lanes at this skewed intersection x IL 126 through lanes spread apart and a center lane with no traffic was added to reflect the new northbound and southbound left turn lanes at 143rd Street x An additional lane with no traffic on the east side of IL 126 at 143rd Street reflects the northbound right turn lane and the additional pavement width north of the intersection x Barrier added to northern edge of snow storage lane adjacent to Bass & Gill Club to model various options for a sight/sound screen being considered at this location. These options were used for stakeholder discussions. Plainfield 143rd Street Extension Barrier models for CNE 2 and CNEs 3 and 4 Based on the Build model; adds barriers in locations discussed in the barrier analysis section below. x The Bass & Gill Club retaining wall barrier is located at the top of the proposed retaining wall along the Bass & Gill Club lake, at the edge of the snow storage lane x The DuPage Bridge barrier is identified as “on structure” where appropriate x Represented receptors were added at CNEs 2, 3 and 4 x A modified Existing model was created to calculate existing noise levels for all represented receptors in CNEs 2, 3 and 4 Noise Analysis Report Plainfield 143rd Street Extension 10 Plainfield 143rd Street Extension Extended Existing, No Build and Build models (for stakeholders) Based on the Existing, No Build and Build models, with the following modifications: x Add the residences on Naperville Road with frontage on the Bass & Gill Club lake, to approximately 1,000 feet north of the 143rd Street extension x Extend Naperville Road northward to approximately 1,000 feet north of the northernmost receptor x Extend the Bass & Gill Club lake water ground zone and associated terrain lines northward to just beyond the northern extent of the modeled receptors TRAFFIC VOLUMES Because traffic counts during field measurements were collected only for the nearest roadways to the measurement locations, no field traffic counts were available for IL 59, 143rd Street west of IL 59 or 143rd Street east of IL 126. The engineer’s existing traffic volumes were used for these roadways in place of field traffic counts in the Validation model. Existing traffic volumes were developed from turn counts performed by CMT and future traffic volumes were developed by CMT’s engineers, in both cases following best engineering practices. Because CMT’s traffic volumes were not developed with truck percentages, IDOT’s recent traffic count data published on IDOT’s Getting Around Illinois website2 was used to develop percentages of medium trucks (straight trucks in IDOT’s traffic data) and heavy trucks (multi-unit trucks) for the TNM. The data for Naperville Road and the portion of 143rd Street east of IL 126 did not develop a defined truck percentage and residents reported very low existing truck traffic during the public meeting; these roadways were modeled as having only auto traffic. Queue lengths used in the TNM models were developed by CMT’s engineers as part of project design. Traffic and design data relevant to the TNM is provided in Appendix C. 2 http://www.gettingaroundillinois.com/gai.htm?mt=aadt Noise Analysis Report Plainfield 143rd Street Extension 11 NOISE MEASUREMENTS AND MODEL VALIDATION FIELD NOISE MEASUREMENTS CMT collected field noise measurements on September 10, 2019. Field measurements were collected at RRs 1 (residence at 14302 Naperville Road), 2 (residence at 14213 Naperville Road), 3 (St. Mary Immaculate Cemetery columbarium), 4 (residence at 23412 West Copper Drive) and 5 (western dock at Bass & Gill Club, 23011 East Main Street). Access to the remaining RRs was restricted and repeated attempts to arrange access were unsuccessful. Noise measurement locations are shown on the CNE/RR map in Appendix A. Field data collection sheets are included in Appendix B and show measurement times, weather conditions and details of each measurement location. Traffic counts were recorded manually during the noise measurements; recording sheets are also provided in Appendix B. All noise measurements were collected with a Quest SoundPro DL2 sound level meter that had been calibrated with a Quest QC-10 acoustical calibrator. The meter was mounted on a tripod to establish a sampling height of five feet. The meter was set to Leq mode with slow response and 3 dB exchange rate, and the frequency response was set to the A-weighted scale as required by FHWA. All measurements were collected over 15-minute periods with simultaneous traffic counts on the applicable roadway(s). The sound level meter reports and calibration information for the meter and calibrator are included in Appendix B. TRAFFIC NOISE MODEL VALIDATION The TNM model of the existing condition was adjusted to reflect atmospheric conditions observed during the noise measurements. The traffic data collected during noise measurement were used to validate the model by multiplying the traffic counts from the 15-minute measurement period by four to obtain hourly traffic counts that were then entered into the Validation model. A model is considered validated when the modeled and measured (monitored) noise levels are within 3 dBA. Monitored noise levels for each model measurement location were within 3 dBA of the modeled noise levels, which validates the TNM. Model validation results are provided in Table 2. TABLE 2: MODEL VALIDATION RESULTS Model Measurement Location Address Field Measurement (dBA) TNM Model Result (dBA) Difference RR 1 – residence 14302 S Naperville Rd 55 52 3 RR 2 – residence 14213 S Naperville Rd 52 51 1 RR 3 – columbarium bench St Mary Immaculate Cemetery, S Naperville Rd 50 48 2 RR 4 – residence 23412 W Copper Rd 49 47 2 RR 5 –dock Bass & Gill Club, 23011 E Main St 52 51 1 Noise Analysis Report Plainfield 143rd Street Extension 12 TRAFFIC NOISE MODEL RESULTS AND IMPACT ASSESSMENT The validated TNM was used to predict existing and future traffic noise levels at noise sensitive land uses throughout the analysis area. A total of eight RRs were included in the model. Table 3 shows the sensitive land uses represented by each receptor. The number of dwelling units per receiver was not adjusted in the model. The Existing TNM predicted traffic noise levels for the current roadway configuration, the No Build model predicted traffic noise levels for the current roadway configuration and expected traffic increases in the design year of 2050, and the Build TNM predicted traffic noise levels for the proposed roadway configuration and expected traffic in the design year. The model results were evaluated to assess whether the proposed project results in noise levels that meet one or both of the traffic noise impact criteria described in the “Traffic Noise Analysis Overview” section discussed on page 5. TABLE 3: REPRESENTATIVE RECEPTOR DESCRIPTIONS Representative Receptor Represented Receptor Description RR 1 Residences on west side of South Naperville Road, south of the ComEd utility corridor and the proposed intersection with 143rd Street. RR 2 Residences on east and west sides of South Naperville Road, north of the proposed intersection with 143rd Street. 14217 South Naperville Road, which had already been identified as requiring acquisition for the project at the time of RR development, was not included in RR 1. RR 3 St Mary Immaculate Cemetery on east side of South Naperville Road, south of the ComEd utility corridor; four outdoor gathering areas RR 4 Residences on north and south sides of West Copper Drive along the southern edge of the ComEd utility corridor RR 5 Dock and picnic table at Bass & Gill Club lakes northwest of the ComEd utility corridor and IL 126 RR 6 Docks and community building deck at Pure Rod & Gun Club fishing lake, southeast of the intersection f IL 126 with Copper Drive RR 7 Dock at Bass & Gill Club lakes northeast of IL 126 and East 143rd Street RR 8 Dock and six mobile home sites at Deer Creek Recreation Club, southeast of the intersection of IL 126 and East 143rd Street Table 4 provides the TNM results for the representative receptors. RRs that are predicted to experience traffic noise levels that approach, meet or exceed the Noise Abatement Criterion (NAC) are identified by shading in the Build 2050 Noise Level column. RRs for which the design year “build” condition results in noise levels of at least 15 dBA over the existing condition, the substantial increase criterion, are identified by shading in the Difference between Existing and Build column. Noise Analysis Report Plainfield 143rd Street Extension 13 Based on the results of the TNM, CNE/RR 2 is impacted because the predicted noise level exceeds the FHWA NAC for Land Use Category B and because a substantial increase in noise is predicted. CNE/RR 3 and CNE/RR 4 both are impacted due to a predicted substantial increase in noise of at least 15 dBA. CNE/RR 1, CNE/RR 5, CNE/RR 6, CNE/RR 7 and CNE/RR 8 are not impacted because the predicted noise level does not approach, meet or exceed the FHWA NAC for their respective Land Use Categories and the TNM does not predict a substantial increase in noise at these representative receptors. TABLE 4: TRAFFIC NOISE PREDICTIONS AND IMPACT ASSESSMENT Receptor Activity Category / NAC (dBA) Existing 2019 Noise Level (dBA) No Build 2050 Noise Level (dBA) Build 2050 Noise Level (dBA) Increase from Existing to Build (dBA) Impact Assessment CNE 1/RR 1 – 14302 S Naperville Rd B / 67 52 54 64 12 No Impact CNE 2/RR 2 – 14213 S Naperville Rd B / 67 50 52 70 20 Impact CNE 3/RR 3 – St Mary Immaculate Cemetery C / 67 47 49 62 15 Impact CNE 4/RR 4 – 23412 W Copper Rd B / 67 47 49 63 16 Impact CNE 5/RR 5 – Bass & Gill Club Dock C / 67 54 55 62 8 No Impact CNE 6/RR 6 – Pure Rod & Gun Club Dock C / 67 58 59 60 2 No Impact CNE 7/RR 7 – Bass & Gill Club East Dock C / 67 60 61 62 2 No Impact CNE 8/RR 8 – Deer Creek Recreation Club Sites C / 67 51 53 55 4 No Impact Noise Analysis Report Plainfield 143rd Street Extension 14 CONSIDERATION OF ABATEMENT ABATEMENT MEASURES CONSIDERED FHWA regulations (23 CFR 772.15C) list the types of traffic noise abatement to be considered if noise impacts from a highway project approach the NAC or exceed the substantial increase criterion. The horizontal alignment of the 143rd Street Extension is constrained by the ComEd utility corridor on the south, the development on the north and the existing 143rd Street at each end of the project. If they were feasible given engineering constraints, changes to the vertical alignment in this relatively level area would be unlikely to result in reduced noise impacts. Traffic management measures would not be compatible with the purpose of this project. Noise insulation would not reduce noise levels for the outdoor activities associated with the residences and cemetery experiencing noise impacts, and there are no undeveloped properties that could be acquired to reduce the identified noise impacts. Because other options were not likely to abate the noise impacts, noise barrier construction was considered by analyzing noise barrier design using FHWA’s TNM 2.5. All proposed barriers were laid out by CMT’s engineers to ensure that they would be constructible, the first part of determining whether a barrier is feasible. TRAFFIC NOISE BARRIER ANALYSIS, CNE 2 Two barrier placement options were considered for CNE 2, each consisting of an eastern and a western component. Both eastern components extended along proposed 143rd Street and onto the Bass & Gill Club retaining wall to the east of the proposed intersection of 143rd Street and Naperville Road, and both western components extended along 143rd Street west of its proposed intersection with South Naperville Road. The options differed in the placement of the eastern barrier component at the northeast corner of the proposed intersection. Option 1 placed the barrier along 143rd Street and extending a short distance north along South Naperville Road. Option 2 moved the barrier in the northeast quadrant of the proposed intersection northeast to follow the north line of the property to be acquired at 14217 South Naperville Road. Table 5 provides the predicted design year traffic noise impacts and adjusted allowable cost per benefitted receptor analysis for each receptor in CNE 2. The western barrier component was eliminated from consideration early in the analysis because it contributed a high cost while benefitting only one receptor. Therefore, design focused on the barrier east of South Naperville Road. Noise Analysis Report Plainfield 143rd Street Extension 15 TABLE 5: TRAFFIC NOISE PREDICTIONS AND IMPACT ASSESSMENT, CNE 2 RECEPTORS Receptor Existing Noise Level (dBA) Build Noise Level (dBA) Increase from Existing to Build (dBA) Impact Assessment Receptor Present Before Roadway? Traffic Noise Factor Noise Increase Factor Built Before Roadway Factor Adjusted Allowable Cost per Benefitted Receptor 14213 S Naperville 50 70 20 NAC and Increase Yes $1,000 $5,000 $5,000 $41,000 14209 S Naperville 49 65 16 Increase Yes $0 $5,000 $5,000 $40,000 14205 S Naperville 50 63 13 None Yes $0 $2,500 $5,000 $37,500 14201 S Naperville 49 61 12 None Yes $0 $2,500 $5,000 $37,500 14127 S Naperville 47 60 13 None Yes $0 $2,500 $5,000 $37,500 14123 S Naperville 47 58 11 None Yes $0 $2,500 $5,000 $37,500 14119 S Naperville 49 57 8 None Yes $0 $1,000 $5,000 $36,000 14115 S Naperville 47 56 9 None Yes $0 $1,000 $5,000 $36,000 14218 S Naperville 50 68 18 Increase Yes $0 $5,000 $5,000 $40,000 14208 S Naperville 54 64 10 None Yes $0 $2,500 $5,000 $37,500 14130 S Naperville 53 61 8 None Yes $0 $1,000 $5,000 $36,000 14126 S Naperville 56 61 5 None Yes $0 $1,000 $5,000 $36,000 14122 S Naperville 55 60 5 None Yes $0 $1,000 $5,000 $36,000 In Table 6, benefitted receptors receiving at least 5 dBA of traffic noise reduction are shaded in yellow and impacted receptors receiving at least 8 dBA of traffic noise reduction are shaded in green. Both Barrier Option 1 and Barrier Option 2 are feasible (feasibility criterion passed) because both can obtain traffic noise reduction of at least 5 dBA for at least two impacted receptors. However, Option 1 relies on benefitting 14213 South Naperville Road; after the noise analysis was underway, the owner of this residence requested that the property be acquired as part of the project and the request has been approved. Therefore, this option was dropped from further consideration. Option 2 also passed reasonableness criterion 1, the IDOT Noise Reduction Design Goal, because it can obtain at least an 8 dBA reduction at a benefitted receptor, as shown in Table 6. Noise Analysis Report Plainfield 143rd Street Extension 16 TABLE 6: BARRIER INSERTION RESULTS AND ALLOWABLE COST ANALYSIS, CNE 2 Receptor Build Noise Level, dBA Noise Impact? (Table 5) Adjusted Allowable Cost per Benefitted Receptor Option 1 Option 2 Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss 14213 S Naperville 70 Yes $41,000 61 9 70 0 14209 S Naperville 65 Yes $40,000 60 5 57 8 14205 S Naperville 63 No $37,500 60 3 58 5 14201 S Naperville 61 No $37,500 59 2 57 4 14127 S Naperville 60 No $37,500 58 2 56 4 14123 S Naperville 58 No $37,500 57 1 55 3 14119 S Naperville 57 No $36,000 56 1 55 2 14115 S Naperville 56 No $36,000 55 1 54 2 14218 S Naperville 68 Yes $40,000 68 0 68 0 14208 S Naperville 64 No $37,500 63 1 63 1 14130 S Naperville 61 No $36,000 60 1 60 1 14126 S Naperville 61 No $35,000 61 0 61 0 14122 S Naperville 60 No $36,000 59 1 59 1 However, Option 2 did not pass reasonableness criterion 2 because, as shown in Table 7, the cost for the barrier exceeded the total adjusted allowable cost per benefitted receptor. Therefore, traffic noise abatement measures are not likely to be implemented for CNE-2 based on preliminary design. The CNE 2 Barriers Modeled figure in Appendix A shows the initial modeled extent of both barrier options and the final extent of Option 2 that met the NRDG. TABLE 7: PHYSICAL FEATURES AND ESTIMATED COSTS, BARRIERS FOR CNE 2 Barrier Placement Barrier Length, ft Average Barrier Height, ft Square Footage Estimated Cost Total Benefitted Receptors Barrier Cost per Benefitted Receptor Allowable Cost per Benefitted Receptor Option 2 1,035 11 11,639 $349,167 2 $174,584 $40,500 Noise Analysis Report Plainfield 143rd Street Extension 17 TRAFFIC NOISE BARRIER ANALYSIS, CNE 3 AND CNE 4 CNEs 3 and 4 were considered together because of their adjacent placement and similar exposure to the projected traffic noise. Initial analysis indicated that if a feasible and reasonable barrier could be designed for CNE 4, then a barrier could likely be developed for CNE 3 that could be cost effective with cost averaging, making design of a continuous barrier the most efficient approach. For CNEs 3 and 4, three barrier placement options were considered. Option 1 extended along 143rd Street between the southern edge of the roadway and the adjacent multi-use path, and included barrier segments south of the path at the eastern and western ends where intersection sight distances would be affected by a barrier north of the path. Option 2 extended along the southern side of the multi-use path. Option 3 was placed on the ComEd utility corridor along the north line of the Copper Drive residences and St. Mary Immaculate Cemetery. Options 2 and 3 require the acquisition of additional easement from ComEd, separate from that to be acquired for the roadway. Option 3 also requires the relocation of an overhead utility local distribution line. As discussed below, these costs were developed for final evaluation of total cost per benefitted receptor for the barriers that easily met the cost per benefitted receptor requirement when only the barrier construction costs were considered. Table 8 provides the predicted impacts and adjusted allowable cost per benefitted receptor analysis for each receptor in CNE 3 and CNE 4. TABLE 8: TRAFFIC NOISE PREDICTIONS AND IMPACT ASSESSMENT, CNE 3 AND CNE 4 Receptor Existing Noise Level (dBA) Build Noise Level (dBA) Increase from Existing to Build (dBA) Impact Assessment Receptor Present Before Roadway? Traffic Noise Factor Noise Increase Factor Built Before Roadway Factor Adjusted Allowable Cost per Benefitted Receptor Cemetery bench, NW 47 62 15 Increase Yes $0 $5,000 $5,000 $40,000 Cemetery bench, NE 47 62 15 Increase Yes $0 $5,000 $5,000 $40,000 Cemetery bench, SE 47 62 15 Increase Yes $0 $5,000 $5,000 $40,000 Cemetery Grotto 48 59 11 None Yes $0 $2,500 $5,000 $37,500 23532 W Copper Dr 46 62 16 Increase Yes $0 $5,000 $5,000 $40,000 23524 W Copper Dr 45 62 17 Increase Yes $0 $5,000 $5,000 $40,000 23518 W Copper Dr 45 62 17 Increase Yes $0 $5,000 $5,000 $40,000 23510 W Copper Dr 45 62 17 Increase Yes $0 $5,000 $5,000 $40,000 23504 W Copper Dr 45 61 16 Increase Yes $0 $5,000 $5,000 $40,000 Noise Analysis Report Plainfield 143rd Street Extension 18 Receptor Existing Noise Level (dBA) Build Noise Level (dBA) Increase from Existing to Build (dBA) Impact Assessment Receptor Present Before Roadway? Traffic Noise Factor Noise Increase Factor Built Before Roadway Factor Adjusted Allowable Cost per Benefitted Receptor 23430 W Copper Dr 46 61 15 Increase Yes $0 $5,000 $5,000 $40,000 23422 W Copper Dr 46 62 16 Increase Yes $0 $5,000 $5,000 $40,000 23412 W Copper Dr 47 63 16 Increase Yes $0 $5,000 $5,000 $40,000 23406 W Copper Dr 48 63 15 Increase Yes $0 $5,000 $5,000 $40,000 23402 W Copper Dr 49 62 13 None Yes $0 $2,500 $5,000 $37,500 23326 W Copper Dr 50 63 13 None Yes $0 $2,500 $5,000 $37,500 23320 W Copper Dr 51 63 12 None Yes $0 $2,500 $5,000 $37,500 23312 W Copper Dr 53 63 10 None Yes $0 $2,500 $5,000 $37,500 23306 W Copper Dr 55 63 8 None Yes $0 $1,000 $5,000 $36,000 23302 W Copper Dr 58 64 6 None Yes $0 $1,000 $5,000 $36,000 23234 W Main St 62 65 3 None Yes $0 $0 $5,000 $35,000 23305 W Copper Dr 62 65 3 None Yes $0 $0 $5,000 $35,000 23311 W Copper Dr 58 62 4 None Yes $0 $0 $5,000 $35,000 23319 W Copper Dr 56 60 4 None Yes $0 $0 $5,000 $35,000 23325 W Copper Dr 54 59 4 None Yes $0 $0 $5,000 $35,000 23331 W Copper Dr 52 58 6 None Yes $0 $1,000 $5,000 $36,000 23403 W Copper Dr 51 57 6 None Yes $0 $1,000 $5,000 $36,000 14319 S Golden Ln 50 57 7 None Yes $0 $1,000 $5,000 $36,000 14320 S Golden Ln 49 58 9 None Yes $0 $1,000 $5,000 $36,000 23423 W Copper Dr 48 58 10 None Yes $0 $2,500 $5,000 $37,500 23503 W Copper Dr 47 58 11 None Yes $0 $2,500 $5,000 $37,500 Noise Analysis Report Plainfield 143rd Street Extension 19 Receptor Existing Noise Level (dBA) Build Noise Level (dBA) Increase from Existing to Build (dBA) Impact Assessment Receptor Present Before Roadway? Traffic Noise Factor Noise Increase Factor Built Before Roadway Factor Adjusted Allowable Cost per Benefitted Receptor 23509 W Copper Dr 47 57 10 None Yes $0 $2,500 $5,000 $37,500 23523 W Copper Dr 46 58 12 None Yes $0 $2,500 $5,000 $37,500 23529 W Copper Dr 46 59 13 None Yes $0 $2,500 $5,000 $37,500 In Table 9, benefitted receptors receiving at least 5 dBA of traffic noise reduction are shaded in yellow and impacted receptors receiving at least 8 dBA of traffic noise reduction are shaded in green. As shown in Table 9, Barrier Options 1, 2 and 3 are all feasible (feasibility criterion passed) because all can obtain at least a 5 dBA traffic noise reduction for at least two impacted receptors. All three barrier options also meet reasonableness criterion 1, the IDOT Noise Reduction Design Goal, because all can obtain a reduction of at least 8 dBA at a benefitted receptor. TABLE 9: BARRIER INSERTION RESULTS AND ALLOWABLE COST ANALYSIS, CNE 3 AND CNE 4 FRONT-ROW RECEPTORS Receptor Build Noise Level, dBA Noise Impact? (Table 8) Adjusted Allowable Cost per Benefitted Receptor Option 1 Option 2 Option 3 Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss Cemetery bench, NW 62 Yes $40,000 58 4 56 6 57 5 Cemetery bench, NE 62 Yes $40,000 58 4 56 6 57 5 Cemetery bench, SE 62 Yes $40,000 58 4 56 6 57 5 Cemetery Grotto 59 No $37,500 57 2 56 3 58 1 23532 W Copper Dr 62 Yes $40,000 56 7 55 8 57 5 23524 W Copper Dr 62 Yes $40,000 56 6 55 7 57 5 23518 W Copper Dr 62 Yes $40,000 55 7 55 7 57 5 23510 W Copper Dr 62 Yes $40,000 54 8 54 8 57 5 23504 W Copper Dr 61 Yes $40,000 55 8 55 8 56 5 23430 W Copper Dr 61 Yes $40,000 55 8 55 8 56 6 Noise Analysis Report Plainfield 143rd Street Extension 20 Receptor Build Noise Level, dBA Noise Impact? (Table 8) Adjusted Allowable Cost per Benefitted Receptor Option 1 Option 2 Option 3 Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss 23422 W Copper Dr 62 Yes $40,000 54 8 54 8 57 8 23412 W Copper Dr 63 Yes $40,000 55 8 55 8 55 8 23406 W Copper Dr 63 Yes $40,000 55 8 55 8 55 8 23402 W Copper Dr 62 No $37,500 54 7 54 8 56 8 23326 W Copper Dr 63 No $37,500 56 6 55 8 57 7 23320 W Copper Dr 63 No $37,500 56 6 56 6 57 6 23312 W Copper Dr 63 No $37,500 58 5 57 6 58 5 23306 W Copper Dr 63 No $36,000 60 3 59 4 61 2 23302 W Copper Dr 64 No $36,000 62 2 61 3 63 1 23234 W Main St 65 No $35,000 65 0 64 1 65 0 23305 W Copper Dr 65 No $35,000 64 1 64 1 65 0 23311 W Copper Dr 62 No $35,000 61 1 60 2 61 1 23319 W Copper Dr 60 No $35,000 58 2 58 2 60 0 23325 W Copper Dr 59 No $35,000 58 1 58 1 58 1 23331 W Copper Dr 58 No $36,000 55 3 54 4 57 1 23403 W Copper Dr 57 No $36,000 54 3 53 4 56 1 14319 S Golden Ln 57 No $36,000 53 4 52 5 57 0 14320 S Golden Ln 58 No $36,000 52 6 52 6 56 2 23423 W Copper Dr 58 No $37,500 52 6 52 6 56 2 23503 W Copper Dr 58 No $37,500 52 6 52 6 56 2 23509 W Copper Dr 57 No $37,500 52 5 52 5 56 1 Noise Analysis Report Plainfield 143rd Street Extension 21 Receptor Build Noise Level, dBA Noise Impact? (Table 8) Adjusted Allowable Cost per Benefitted Receptor Option 1 Option 2 Option 3 Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss Noise Level with Barrier, dBA Insertion Loss 23523 W Copper Dr 58 No $37,500 53 5 53 5 56 2 23529 W Copper Dr 59 No $37,500 55 4 54 5 57 2 No barrier option met reasonableness criterion 2 because, as shown in Table 10, the cost for each exceeded the total adjusted allowable cost per benefitted receptor. The three barriers were evaluated for reasonableness criterion 2 in two steps: an initial evaluation using only the cost for barrier engineering, materials and construction as provided in the IDOT barrier cost estimate of $30 per square foot, and a detailed evaluation considering the additional land easement and utility relocation required in order to construct the barrier that passed the initial evaluation. Options 1 and 2 were determined not cost reasonable using only the IDOT barrier construction cost. Option 3 was not cost reasonable due to the added expense. The CMT Preliminary Engineer’s Opinion of Probable Construction Cost is included in Appendix C; the barrier analysis considered Alternative 1, Noisewall Built on ComEd Property, and utilized line items 7, 8 and 9. The permanent easement line item includes sufficient easement purchase to allow for maintenance of the barrier after construction. Alternative 2, Noisewall Built on Pennland Subdivision Property, was not considered because the additional costs are higher for this alternative and therefore this alternative is not expected to meet reasonableness criterion 2. The CNE 3 Barriers Modeled figure in Appendix A shows the initial modeled extent of all three barrier options and the final extent of each option that met the NRDG. TABLE 10: PHYSICAL FEATURES AND ESTIMATED COSTS, BARRIERS FOR CNE-3 Barrier Placement Barrier Length, ft Average Barrier Height, ft Square Footage Estimated Cost Total Benefitted Receptors Barrier Cost per Benefitted Receptor Allowable Cost per Benefitted Receptor Option 1 2,330 13 30,766 $922,979a 18 $51,277 $37,417 Option 2 2,761 14 38,656 $1,159,675a 23 $50,421 $38,674 Option 3 2,240 8 18,120 $667,595b 16 $41,725 $39,375 a Initial evaluation, includes IDOT barrier cost estimate only b Includes cost of easement acquisition and utility relocation ($124,000 as determined from lines 7, 8, and 9 of Alternative 1 shown in Engineer’s Opinion of Probable Construction Cost table in Appendix C) Noise Analysis Report Plainfield 143rd Street Extension 22 CONSTRUCTION NOISE Noise from construction activities will add to the average noise level during the construction phase of this project. However, construction activities will be temporary. This contract will be constructed in accordance with IDOT Standard Specification for Road and Bridge Construction, including Articles 107.35 and 107.41. Article 107.35 requires equipment to be properly maintained and equipped with an adequate muffler and generally limits construction within 1,000 feet of a residence to the hours between 7:00 a.m. and 10:00 p.m. Article 107.41 limits idling of construction equipment and requires location of staging areas where diesel vehicles may idle away from sensitive areas such as residential neighborhoods. Noise may also be generated by increases in heavy truck traffic to and from the project area. This increase in noise is also expected to be confined to daytime hours, but night-time operations may be warranted on US Route 30, IL 59 and IL 126 to minimize impacts to peak hour traffic. In general, construction operations will be held within the local noise ordinance unless specifically approved by the local authority during construction. COORDINATION WITH LOCAL GOVERNMENT OFFICIALS Because TNM 2.5’s contour module, which produces sound level contours for undeveloped areas to assist in community planning, does not function well with modern computer operating systems, “dummy” receivers were used to evaluate the distance from the 143rd Street extension within currently undeveloped areas at which the Noise Abatement Criteria (NAC) for various types of land uses would be exceeded. Arrays of these receivers were modeled on each undeveloped area identified for planning analysis. The resulting 66 dB contour lines are shown on the Noise Contour Map in Appendix A. This information will be shared with local planning authorities when IDOT has approved the noise analysis. CONCLUSIONS AND RECOMMENDATIONS Eight common noise environments (CNEs) were evaluated as part of this study. For CNEs 1, 5, 6, 7 and 8, future noise levels for the receptors would not approach, meet, or exceed the noise abatement criteria, or substantially exceed existing noise levels. Because no traffic noise impacts were identified, no abatement measures were considered for these CNEs. Based on modeling results for the represented receptors, traffic noise impacts are predicted for CNEs 2, 3 and 4 and abatement measures were considered. The proposed project is anticipated to have traffic noise impacts, but the noise barriers studied and identified in Tables 7 and 10 do not meet IDOT’s feasibility and reasonableness criteria. Due to this, traffic noise abatement measures are not likely to be implemented based on preliminary design. If the project’s final design is different from the preliminary design, IDOT will determine if revisions to the traffic noise analysis are necessary. A final decision on noise abatement will not be made until the project’s final design is approved and the public involvement process is complete. Plainfield 143rd Extension APPENDIX A: FIGURES 143rd Street Extension Location Map - Will County, IL 02.55Miles -+ Service Layer Credits: Sources: Esri, HERE, Garmin, USGS, Intermap, INCREMENT P, NRCan, Esri Japan, METI, Esri China (Hong Kong), Esri Korea, Esri (Thailand), NGCC, © OpenStreetMap contributors, and the GIS User Community Project Location ^_ S NAPERVILLE RDW MAI N ST/IL R T 126IL RT 59W COPPER DR IL RT 59/US RT 30W 143RD ST S PENNY LNW A S H S T S SILVER LNW 143RD ST/US R T 3 0 S GOLDEN LNW RIVERWALK CT W PENNINGTON LN S MAPLE CTS GARDEN CTW MELODY LN 143rd Street Extension, Plainfield, Will County, Illinois NOISE ABATEMENT CRITERIA LAND USE ACTIVITY CATEGORIES -, 0 500 1,000250 Feet NAC Activity Category B C F G Service Layer Credits: $+$+ $+ $+ $+ $+ $+ $+8 7 6 5 3 2 1 4 S NAPERVILLE RDW MAI N ST/IL R T 126IL RT 59W COPPER DR IL RT 59/US RT 30W 143RD ST S PENNY LNW A S H S T S SILVER LNW 143RD ST/US R T 3 0 S GOLDEN LNW RIVERWALK CT W PENNINGTON LN S MAPLE CTS GARDEN CTW MELODY LN 143rd Street Extension, Plainfield, Will County, Illinois COMMON NOISE ENVIRONMENTS (CNEs) AND REPRESENTATIVE RECEPTORS -, 0 500 1,000250 Feet Common Noise Environment $+Representative Receptor £¤30 £¤30 Service Layer Credits: MEMORANDUM 143rd Street Extension, Plainfield, Will Co. DATE: June 6, 2019, rev. August 12 and December 13, 2019 SUBJECT: Noise Sensitive Areas and Representative Receptors The following is a list of the noise sensitive areas identified for the 143rd Street Extension project and a discussion of those parcels that were not assigned NSA status. This memorandum is intended to accompany the Noise Abatement Criteria Land Use Activity Categories map and Common Noise Environments (CNEs) and Representative Receptors map. List of Noise Sensitive Areas (NSAs) and Representative Receptors (RRs) NSA/RR NO. LOCATION RR LOCATION NSA/RR-1 Naperville Road residential neighborhood south of ComEd line Rear patio/deck of northernmost residence NSA/RR-2 Naperville Road residential neighborhood north of ComEd line Rear patio of second residence north of ComEd line and east of South Naperville Road; note that first residence is located within the preferred alignment NSA/RR-3 St. Mary Immaculate Cemetery Bench at columbarium in northeast quadrant NSA/RR-4 Copper Drive residential neighborhood, including one undeveloped parcel used as a side yard for a residence on an adjacent parcel Patio adjacent to shed in rear yard of 23412 West Copper Drive residence NSA/RR-5 Bass & Gill Club Dock serving southern fishing lakes NSA/RR-6 Pure Rod & Gun Club Patio/deck at rear of main building adjacent to docks NSA/RR-7 Bass & Gill Club south of West Main Street Dock on western end of fishing lake NSA/RR 8 Deer Creek Recreation Club Northernmost mobile home/RV site Category C and E parcels excluded from NSAs LOCATION EXPLANATION Crosswinds Church 14360 S Rt 59 No exterior areas of frequent human use within 500 feet of the proposed project. The portion of the parcel within the 500-foot distance is primarily agricultural land included in the church parcel. The church entrance is located outside the 500-foot distance. Plainfield Township Park District walking/biking trail, west of NSA-1 This is a Section 4(f) property, but has no exterior area of frequent human use as defined in IDOT Highway Traffic Noise Assessment Manual Table 3-1. The trail ends in a wide loop adjacent to the ComEd corridor with no benches, informational signs or other stopping points. Memorandum 143rd Street Extension, Plainfield, Will Co. Page 2 Category F parcels; no further study warranted: x Ravagos Americas LLC – manufacturing x Dayfield Properties LLC – possible multiple uses in warehouse-style building, including electronics recycling x MZG Associates II LLC – agricultural x Plainfield Partners LLC – Chicago Bridge & Iron (CB&I) office and manufacturing x CB&I (A) – Insulation Betterment Center – manufacturing/R&D x CB&I (B) – manufacturing shared with Plainfield Partners property x CB&I (C) – agricultural x Cubesmart LP – self-storage (warehouse) x Commonwealth Edison Co (ComEd) (all) – utility line: overhead high-voltage power line x Vulcan Lands Inc – Vulcan Plainfield Quarry Category G parcels; estimated noise levels to be provided: x Next Egg LLC and PMI Venture LLC properties on east side of South Route 59 – wooded and open land with a stream running through it x Plainfield Township Park District land north of ComEd corridor and west of NSA 2 - no improvements currently present x RC Enterprises LP property north of NSA 2 - within 500 feet of the proposed project, this land is covered with scrub vegetation at the edge of the DuPage River. Further to the north the parcel is farmed. 143rd Street Extension, Pl ainfield, Will County, Illinois CNE 2 BARRIERS MODELED -, 0 300 600150 Feet Initial barrier, both options Initial barrier, Option 1 Initial barrier, Option 2 Option 2 barrier meeting NRDG Service Layer Credits: 143rd Street Extension, Pl ainfield, Will County, Illinois CNE 3 AND CNE 4 BARRIERS MODELED -, 0 200 400100 Feet Initial barrier, Option 1 Option 1 barrier meeting NRDG Option 2, initial and meets NRDG Initial barrier, Option 3 Option 3 barrier meeting NRDG Service Layer Credits: 14027 S Naperville Rd 49 / 51 / 55 / 53 14023 S Naperville Rd 49 / 51 / 54 / 53 14103 S Naperville Rd 47 / 49 / 54 / 51 14107 S Naperville Rd 50 / 52 / 56 / 54 14111 S Naperville Rd 49 / 51 / 56 / 54 14115 S Naperville Rd 47 / 52 / 56 / 55 14119 S Naperville Rd 49 / 53 / 57 / 56 14123 S Naperville Rd 47 / 50 / 58 / 56 14209 S Naperville Rd 49 / 51 / 65 / 64 14205 S Naperville Rd 50 / 52 / 63 / 61 14127 S Naperville Rd 47 / 49 / 60 / 57 14201 S Naperville Rd 49 / 51 / 61 / 59 143rd Street Extension, Pl ainfield, Will County, Illinois PREDICTED NOISE LEVELS FOR PROPERTIES FACING BASS & GILL CLUB -, 0 200 400100 Feet Evaluated property: noise level 2019 / 2050 without project / 2050 with project / 2050 with project and "barrier" at retaining wall (in decibels) Service Layer Credits: Notes: 1) FHWA's Traffic Noise Model is not considered reliable at distances greater than 1,000 feet from the proposed roadway, so analysis was limited to this distance 2) Predictions of noise levels with the Bass & Gill Club "barrier" are subject to the materials and construction methods used in any fence or barrier constructed along the Bass & Gill Club retaining wall. Materials and/or construction methods that do not rise to the standards of a noise barrier will provide less noise reduction that cannot be predicted by FHWA's Traffic Noise Model. 2) A change of 3 dB or less is typically not detectable by the average human ear. A change of 5 dB is generally noticeable. An increase of 10 dB is usually felt to be "twice as loud" as before. 3) The noise level at which FHWA requires consideration of noise abatement at residential properties is 67 dB. This noise level is understood to approach the upper limit of the range allowing comfortable conversation for most people without straining to hear. 45 dB has been compared to the noise level in a library, and 55 dB has been compared to the noise of a babbling brook. 66 dB66 dB66 dB 143rd Street Extension, Pl ainfield, Will County, Illinois PROJECTED 2050 66 dBA CONTOUR LINES ON CURRENTLY UNDEVELOPED PROPERTIES -, 0 250 500125 Feet Undeveloped properties within noise study area Projected 66 dBA contour on undeveloped properties Service Layer Credits: Plainfield 143rd Extension APPENDIX B: FIELD DATA L_ Akic - &• LA -Sew --SS• Existing Noise Measurements Site Data Log 143rd Street 5+ re (-r � 3'. c' -• 45 Vie`. l. Date: 1O/2QI9 LocatitnMPess and/or latJlong)i 143O2•`iVajerville Road (Residence) &§erver: US Travel Direction: N -S Site Surface: i f r r\ Nearby Landmark: I NIf \ Grade (%): --..._ Pavement Type: 'TZ. 44- Distance to Landmark: Nit\ Plan View: it 9e--• i Profile View: ` f s a d ec - Temperature: (°F) Relative Humidity (%) Wind Speed (mph) Wind Direction Cloud Cover Class Weather Conditions Classes of Cloud Cover •Class;_.. - •- 74Lig.41 - ,,—.7- pes'erjp 0 1 Heavily overcast 2 Lightly overcast (either w/ continuous sun or the sun obscured intermittently by clouds 20% to 80% of the time) 3 Sunny (sun essentially unobscured by clouds at 80% of the time) 4 Clear night (less than 50% cloud cover) 5 Overcast night ( 50% or more cloud cover) L P- oNA• L [v 3. 3 - LAS erg — S1 • (v Existing Noise Measurements Site Data Log 143rd Street Site: W 2 Date: 9/10/2019 Location (address and/or 14213 Naperville Road fat/long): (esidence) Observer: US Travel Direction: N-5 Site Surface: 4 �1 r‘ Nearby Landmark: �,1 +v ] Grade (%): Pavement Type: 'g1+ Distance to Landmark: NI Plan View: i' 19 L 56 ) r '---- p d__. i 0 - 7-)r.kCle, eaUtr Profile View: (rr _ .1�L Temperature: CT) Relative Humidity (%) Wind Speed (mph) Wind Direction Cloud Cover Class Weather Conditions —4$`9 S o Est -6'3 -9 3 - Classes of Cloud Cover r - _ '41.110111K. _ beSer 002 1 Heavily overcast 2 Lightly overcast (either wl continuous sun or the sun obscured intermittently by clouds 20% to 80% of the time) 3 Sunny (sun essentially unobscured by clouds at 80% of the time) 4 Clear night (less than 50% cloud cover) 5 Overcast night ( 50% or more cloud cover) ��Se�� Existing Noise Measurements Site Data Log 143rd Street .��I 0, . R v _ .r C. C.-3 .. Date: it 9/10/2019 Location (address and/or fat/Iong): 19` . lr St. MatyImmacutate Cemetery (Naperville Road) Obseri+er: us 111111 Travel Direction: N-5 Site Surface: 1 k 1..4.1V-\ Nearby Landmark: Grade (%): Pavement Type: r�� Distance to Landmark: -~ Plan View: di �� T\ s i }_f �� I�� ti e viii [ ` - tt` " , f V (--_-______ , 1 a n ...t 4011 K i 4. ''-(3 ) - Profile View: a. r) t" -" a) ' Temperature: ('Fj Relative Humidity (%) Wind Speed (mph) Wind Direction Cloud Cover Class Weather Conditions q3o 1 0 f'S\ ? ,9' IQ up _... Classes of Cloud Cover Class 1110:4'1P -Trig' 1 Heavily overcast 2 Lightly overcast (either w/ continuous sun or the sun obscured intermittently by clouds 20% to 80% of the time) 3 Sunny (sun essentially unobscured by clouds at 80% of the time) 4 Clear night (less than 50% cloud cover) 5 Overcast night (50%or more cloud cover) L A s L Pc-Ses - Existing Noise Measurements Site Data Log 143rd Street 1pir [� Sot.tcer ere, — Site;, v Date: 1P 1fl 2U19 Location (address and/or lat/long): 23412. West cop ,er Drive (Residence) Observer: us Travel Direction: E -W Site Surface: ,--a CO 1F1 Nearby Landmark: N 1 Grade (%): �~ Pavement Type: ' -,4-, Distance to Landmark: Ni Plan View: Temperature: (°F) Relative Humidity (%) Wind Direction Wind Speed (mph) J deco Cloud Cover Class Weather Conditions '45° Co-\ W T Classes of Cloud Cover 1 Heavily overcast 2 Lightly overcast (either w/ continuous sun or the sun obscured intermittently by clouds 20% to 80% of the time) 3 Sunny (sun essentially unabscured by clouds at 80% of the time) 4 Clear night (less than 50% cloud cover) 5 Overcast night ( 50% or more cloud cover) 70.1 Existing Noise Measurements Site Data Log 143rd Street Site: 5 Date: 9/10/2019 Location (address and/or lat/long): 23011 E Main Street (Bass and Gill. Club (Western Dock)) Observer: US Travel Direction: N -S Site Surface: di r+FetaVe1 Nearby Landmark: �A pU'T Grade (%): ....____— Pavement Type: Distance to Landmark: Plan View: Profile View: grLtJ✓C: ( Temperature: (°F) Relative Humidity (%) Wind Speed (mph) Wind Direction Cloud Cover Class Weather Conditions (o' Classes of Cloud Cover u54 11282 d() V... cripticiri 1 Heavily overcast 2 Lightly overcast (either w/ continuous sun or the sun obscured intermittently by clouds 20% to 80% of the time) 3 Sunny )sun essentially unobscured by clouds at 80% of the time) 4 Clear night (less than 50% cloud cover) 5 Overcast night ( 50% or more cloud cover) Existing Noise Measurements Vehicle Data Log 143rd Street Site: I Date: 9/10/2019 Location:'- 143O2-3aperville Road (Residence) Ob1s�errver: Travel Direction: Time: Nredominant Vehicle Speed (mph) Auto: Medium Truck: Heavy Truck: Bus: Motorcycle: Other: F—tbki, {5 . •0 Comments: North Bound r 7 �. 32 C 4 pr 1,,:r a I wi, ai'41- .p r 1i j ! I -- ti v.51 51 - si{-v ;. vaati 101,Vurik-e-k, 1 A csAitAkraik.� A~�;�or South Bound Y t Aikr PP'r I� r ' Jj f i ) r Existing Noise Measurements Vehicle Data Log 143rd Street Site: 2 Date: 9/10/2019 Location: � 24 tNap nr4ile Road (Residence) QV52rve1/1-- Travel Direction: Time: Predominant Vehicle Speed (mph) Auto: Medium Truck: Heavy Truck; Bus: Motorcycle: Other Comments: North pici Bound S av,2 vorknA �� {, 'Trawl 4 X l XYi 4 k '� 7:9 - A O { I i`i'.FQr tdc/ � irk ' c}�'� L --/..5c1 � South Bound fif 1(k 4 Existing Noise Measurements Vehicle Data Log 143rd Street Site: 3 orate: 9/10/ NIB Location StAilary_Immaculate CerneteryLN rviile.Road) Observer: -- _ - Travel Direction: Time: Predominant Vehicle Speed (mph) I Auto: ' Medium Truck: Heavy Truck. Bus: Motorcycle: Other: ;UM /5 .- CU Comments: p& co � c5� r 5 S-mel, + /. '4 ' �s}��1 X�.4 jr 1 1 'l W `- 3.-24. North Bound �. � � South Bound k , 1305 ` Sane. Or J.14, aft' 0:,:1-t. -- J -kr -3kr I( 4 t.,,-) 1 V. l; f Existing Noise Measurements Vehicle Data Log 143rd Street Site: A Date: 9/10/2019 Location: est Copper Drive (Residence) - Observer: Travel Direction: Time: Nreaominant Vehicle Speed (mph) Auto: Medium Truck: Heavy Truck: Bus: Motorcycle: Other: Fe4444 5 C>.; Co Comments: 3;s a. East Bound S(3 r1 ?/.eSikletA-Cci V ¢ fm tip- (30 r �. 2to s/ -401 1r. P 1() 2f) LiE West Bound l ;..05 I . u5 I -u "179 Existing Noise Measurements Vehicle Data Log 143rd Street Site: 5 Date: 9/1012019 Location: 23&2 _E'Main,Street ($ass and Gilf Club (Western Doc ;.: -: Travel Direction: Time: Predominant Vehicle Speed (mph) Auto: Medium Truck: Heavy Truck: Bus: Motorcycle: Other: Comments: North Bound 9Pir ?vv... l A 3g, k. 55►eef { 1 Al ! “ _ I ( 02) ' f 11 u ( t , 15 co ` Z Cif _ South Bound /-- 10-15- 5 „4--11 Rif 01 > ii.1' AK jer 1( I ( (4) _lec i i 1 c3) PREMIER SAFETY CALIBRATION LABORATORY sArtrne PREMIER Calibration Certificate 0004047 Instrument: Acoustical Calibrator Date Calibrated: 10/25/2018 Cal Due: 10/25/2019 Model: QC -10 Status: Received Sent Manufacturer: Quest in tolerance: X X Serial number: QIK010063 Out of tolerance: Class (fEC 60942): 1 See comments: Barometer type: Barometer s/n: Customer: Tel/Fax: / Contains non -accredited tests: Yes X No Address: Tested in accordance with the following procedures and standards: Calibration of Noise Dosimeters, Sound Meters, and Calibratos., Rev. Chf 04 Instrumentation used for calibration: Nor -1504 Norsonic Test System: Instrument- Manufacturer Description 5/N Cal. Date Traceability evidence Cal. Due Cal. Lab / Accreditation 4838-Norsonic SME Cal Unit 31079 May 11, 2018 Norsonic SA May 11, 2019 D5 -360 -SRS Function Generator 123268 May 10, 2018 SRS May 10, 2019 34401A-Agilent Technologies Digital Voltmeter MY53003818 May 15, 2018 Agilent Provider 493107 May 15, 2019 5D700-Extech Meteo Station Q769118 May 11, 2018 INNOCAt May 11, 2019 140-Norsonic Real Time Analyzer 1405966 May 11, 2018 Norsonlc SA May 11, 2019 PC Program 1018 Norsonic Calibration software v,6.1T Validated Nov 2014 Scantek, Inc. - 40AG-GRAS Microphone 173539 May 21, 2018 Scantek, Inc. / NVIAP May 21, 2019 NN1203-Norsonic Preamplifier 138531 May 21, 2018 Norsonic SA May 21, 2019 Instrumentation and test results are traceable to SI (International System of Units) through standards maintained by NIST (USA) and NPL (UK) Calibrated by: Steven Boertmann Authorized signatory: Eric Ford Signature Steven Boertmann Signature Eric Ford Date 10-25-18 Date 10-25-18 Calibration Certificates or Test Reports shall not be reproduced, except in full, without written approval of the laboratory. This Calibration Certificate or Test Reports shall not be used to claim product certification, approval or endorsement by NVLAP, MIST, or any agency of the federal government. Document stared as: C:/Nor1504/Cal/2014/Questc10-old_QIK010063_M3.doc Page 1 of 2 Results summary: Device was tested and complies with following clauses of mentioned specifications: CLAUSES' FROM STANDARDS REFERENCED IN PROCEDURES: MET2 NCI: - ET COMMENTS Manufacturer specifications Manufacturer specifications: Sound pressure level X Manufacturer specifications: Frequency X Manufacturer specifications: Total harmonic distortion X Current standards ANSI 51.40:2006 8.3 / IEC 60942: 2003 8.2 - Preliminary inspection X Unit older than the standard ANSI 51.40:2006 8.4.4 / lEC 60942: 2003 B.3.4 - Sound pressure level X Unit older than the standard ANSI 51.40:2006 A.5.4 / IEC 60942: 2003 A.4.4 - Sound pressure level stability - - Unit older than the standard ANSI 51.40:20060.4.S / lEC 60942: 2003 8.3.5 - Frequency X Unit older than the standard ANSI 51.40:2005 B.4.6 / 1EC 60942: 2003 8.3.6 -Total harmonic distortion X Unit older than the standard Older standards (obsolete) IEC 60942: 1997 B.2 - Preliminary inspection X IEC 60942: 1997 6.3.3 - Sound pressure level X IEC 60942: 1997 B.3.4 -Sound pressure level stability X iEC 60942: 1997 B.3.5- Frequency It IEC 60942: 1997 8.3.6 - Total harmonic distortion X ANSI 51.40: 1984 (R1997) 4.4.2 Sound pressure level in the coupler X Not applicable ANSI 51.40: 1984 (81997) 4.4 Frequency sound in the coupler X Not applicable ANSI 51.40: 1984 (R1997) 4.10 Total harmonic distortion X Not applicable I The results of this calibration apply only to the instrument type with serial number identified in this eport. 2 Main measured parameters 3. Measured4/Acceptable5 Tone frequency (Hz): Measured4/Acceptable5 Total Harmonic Distortion (%): Measured 4/Acceptable Levels (dB): 994.57 ± 0.99/1000.0 ± 10.0 0.62 ± 0.10/ < 3 114.07 ± 0.00/114.0 ± 0.4 3 The stated level is valid at reference conditions. A The above expanded uncertainties for frequency and distortion are calculated with a coverage factor k=2; for level k2.00 5 Acceptable parameters values are from the current standards Barometer indication Nominal indication Environmental conditions: Temperature ('C) Barometric pressure (kPa) Relative Humidity (%) 23.0 ± 1.0 100.00 ± 0.001 31.0 ± 2.0 Tests made with following attachments to instrument: Calibrator'/:" Adaptor Type: Other: Adjustments: Unit was not adjusted. Comments: C:\Nar1504\Ca1\2014\Ctuestcl0-old_QIK010063_M3.doc Note: The instrument was tested for the parameters listed in the table above, using the test methods described in the listed standards. All tests were performed around the reference conditions. The test results were compared with the manufacturer's or with the standard's specifications, whichever are larger. Compliance with any standard cannot be claimed based solely on the periodic tests. Place of Calibration: Premier Safety 46410 Continental Dr. Chesterfield, MI 48047 Ph/Fax: 586-840-3220/ -3221 www.premier safety.com Calibration Certificates or Test Reports shall not be reproduced, except in full, without written approval of the laboratory. This Calibration Certificate or Test Reports shall not be used to claim product certification, approval or endorsement by NVLAP, MST, or any agency of the federal government. Document stored as: C:\Nor1504\Cal\2014\Ctuestc10_Q11070028_M1.doc Page 2 of 2 PREMIER SAFE T Y CALIBRATION LABORATORY PREMIER SAFlaY calibration Certificate No. 1086975 Instrument: Model: Manufacturer: Serial number: Tested with: Type (class): Customer: Tel/Fax: Sound Level Meter SoundPro SE _DU Quest BIH030025 Microphone QE7052 s/n 39975 Preamplifier n/a s/n 0214 9465 2 1 Date Calibrated:10/25/2018 Cal Due: 10/25/2019 Status: Received Sent In tolerance: X X Out of tolerance: See comments: Contains non -accredited tests: Yes X No Calibration service: _ Basic X Standard Address: Tested in accordance with the following procedures and standards: Calibration of Sound Level Meters, Scantek Inc., Rev. 6/22/2012 SLM & Dosimeters— Acoustical Tests, Scantek Inc., Rev. 7/6/2011 Instrumentation used for calibration: Nor -1504 Norsonic Test System: Instrument - Manufacturer Description S/N Cal. Date Traceability evidence Cal. Due Cal. Lab / Accreditation 483B-Norsonic SME Cal Unit 31079 May 11, 2018 Norsonic SA May 11, 2019 DS -360 -SRS Function Generator 123268 May 10, 2018 SRS May 10, 2019 34401A-Agitent Technologies Digital Voltmeter MY53003818 May 15, 2018 Agitent Provider #93107 May 15, 2019 $0700-Extech Meteo Station C?769118 May 11, 2018 INNOCAL May 11, 2019 PC Program 1019 Norsonic Calibration software v.6.1T Validated Nov 2014 Scantek, Inc. - 1251-Norsonic Calibrator 34103 May 21, 2018 Scantek, Inc./ NVLAP May 21, 2019 Instrumentation and test results are traceable to 51 (International System of Units) through standards maintained by MST (USA) and NPL (UK). Environmental conditions: Temperature ('C) Barometric pressure (kPa) Relative Humidity (%) 23.0 100.00 31.0 Calibrated by: Steven Boertmann Authorized signatory: Eric Ford Signature Steven Boertmann Signature Eric Ford Date 10-25-18 Date 10-25-18 Calibration Certificates or Test Reports shall not be reproduced, except in full, without written approval of the laboratory. Document stored C:\Nor1504\Sim\2014\QSproSE2,_BIH030025_M2.doc Page 1 of 2 Results summary: Device complies with following clauses of mentioned specifications: x CLAUSES FROM IEC/ANSI STANDARDS REFERENCED IN PROCEDURES: RESULT43 EXPANDED UNCERTAINTY (coverage factor 2) [dB] INDICATION AT THE CALIBRATION CHECK FREQUENCY - ANSI 51.4 CLAUSE 3,2 Passed 0.20.15 FREQUENCY WEIGHTINGS: A NETWORK - IEC 61572.3 ED.1 CLAUSE 12 Passed 0.2 FREQUENCY WEIGHTINGS: C NETWORK - IEC 61672-3 ED.1 CLAUSE 12 Passed 0.2 FREQUENCY WEIGHTINGS: Z NETWORK - IEC 61672-3 ED.1 CLAUSE 12 Passed 0.2 FREQUENCY AND TIME WEIGHTINGS AT 1 KHZ IEC 61672.3 ED.1 CLAUSE 13 Passed 0.2 LEVEL LINEARITY ON THE REFERENCE LEVEL RANGE - IEC 61672-3 ED.1 CLAUSE 14 Passed 0.3 LEVEL LINEARITY INCLUDING THE LEVEL RANGE CONTROL - IEC 61672-3 ED.1 CLAUSE 15 Passed 0,3 TONESURST RESPONSE - IEC 61672-3 ED.1 CLAUSE 16 Passed 0.3 PEAK C SOUND LEVEL- IEC 61672-3 ED.1 CLAUSE 17 Passed 0.35 FILTER TEST 1/1OCTAVE: FLAT FREQUENCY RESPONSE - IEC 61260, CLAUSE 4.10 & 115.9 Passed 0.25 FILTER TEST 1/30CTAVE: FLAT FREQUENCY RESPONSE - IEC 61260, CLAUSE 4.10 & X5.9 Passed 0,25 The results of this calibration apply only to the instrument type with serial number identified in this report. 1 Parameters are certified at actual environmental conditions. 3 Comments: The instrument was tested and met all specifications found in the referenced procedures. Note: The instrument was tested for the parameters listed in the table above, using the test methods described in the listed standards. All tests were performed around the reference conditions. The test results were compared with the manufacturer's or with the standard's specifications, whichever are larger. Compliance with any standard cannot be claimed based solely on the periodic tests. Tests made with the following attachments to the instrument: Microphone: Quest QE7052 s/n 39975 for acoustical test Preamplifier: Quest n/a s/n 0214 9465 for all tests btl er.€'linE'atjaptorADP005 {18pF]for electricaltests and 1.448 (18pF) far noise test Accompanying acoustical calibrator: Quest QC -1O s/n QIK010063 Windscreen: none Measured Data: in Test Report # of ... pages. Place of Calibration: Premier Safety 46410 Continental Dr. Chesterfield, MI 48047 Ph/Fax: 586-840-3220/ -3221 www.premier safety.com Calibration Certificates or Test Reports shall not be reproduced, except in full, without written approval of the laboratory. Document stored C:\Nor1504\51m\2014\QSpra5E2_81H030025_M2.doc Page 2 of 2 SoundPio SE_DL2 sin: BIH030025 ID: Date: 10/25/2018 By: SB Due: 10/25/2019 Session Report 9/10/2019 Information Panel Name Site 1 (S058_BIH030025_10092019_104433) Start Time 9/10/2019 7:16:44 AM Stop Time 9/10/2019 7:31:44 AM Device Name BIH030025 Model Type SoundPro DL Device Firmware Rev R.13H Comments Calibration History Date Calibration Action Level Cal. Model Type Serial Number Cert. Due Date 9/9/2019 9:45:46 PM Calibration 114.0 Statistics Chart Site 1 (S058_BIH030025_10092019_104433): Statistics Chart Summary Data Panel Description Meter Value Description Meter Value Lmax 1 78.9 dB Leq 1 55.4 dB Exchange Rate 1 3 dB Weighting 1 A Response 1 SLOW Exchange Rate 2 3 dB Weighting 2 A Response 2 SLOW Logged Data Table Date/Time Leq-2 9/10/2019 7:17:44 AM 63 7:18:44 AM 52 7:19:44 AM 55.3 7:20:44 AM 57.6 7:21:44 AM 53.1 7:22:44 AM 52.7 7:23:44 AM 52.7 7:24:44 AM 52.8 7:25:44 AM 51.9 7:26:44 AM 53.4 7:27:44 AM 53.8 7:28:44 AM 53.1 7:29:44 AM 53.8 7:30:44 AM 52.9 7:31:44 AM 52.9 Logged Data Chart Site 1 (S058_BIH030025_10092019_104433): Logged Data Chart Session Report 9/10/2019 Information Panel Name Site 2 (S059_BIH030025_10092019_104434) Start Time 9/10/2019 7:43:49 AM Stop Time 9/10/2019 7:58:49 AM Device Name BIH030025 Model Type SoundPro DL Device Firmware Rev R.13H Comments Calibration History Date Calibration Action Level Cal. Model Type Serial Number Cert. Due Date 9/9/2019 9:45:46 PM Calibration 114.0 Statistics Chart Site 2 (S059_BIH030025_10092019_104434): Statistics Chart Summary Data Panel Description Meter Value Description Meter Value Lmax 1 63.7 dB Leq 1 51.6 dB Exchange Rate 1 3 dB Weighting 1 A Response 1 SLOW Exchange Rate 2 3 dB Weighting 2 A Response 2 SLOW Logged Data Table Date/Time Leq-2 9/10/2019 7:44:49 AM 52.3 7:45:49 AM 50.8 7:46:49 AM 51.2 7:47:49 AM 50.7 7:48:49 AM 51 7:49:49 AM 51.2 7:50:49 AM 51.3 7:51:49 AM 50.9 7:52:49 AM 50.5 7:53:49 AM 51.7 7:54:49 AM 51 7:55:49 AM 52.2 7:56:49 AM 52.6 7:57:49 AM 53.5 7:58:49 AM 52.1 Logged Data Chart Site 2 (S059_BIH030025_10092019_104434): Logged Data Chart 6HVVLRQ5HSRUW ,QIRUPDWLRQ3DQHO 1DPH 6B%,+BB 6WDUW7LPH 30 6WRS7LPH 30 'HYLFH1DPH %,+ 0RGHO7\SH 6RXQG3UR'/ 'HYLFH)LUPZDUH5HY 5+ &RPPHQWV &DOLEUDWLRQ+LVWRU\ 'DWH &DOLEUDWLRQ$FWLRQ /HYHO &DO0RGHO7\SH 6HULDO1XPEHU &HUW'XH'DWH 30 &DOLEUDWLRQ 6WDWLVWLFV&KDUW 6B%,+BB6WDWLVWLFV&KDUW /RJJHG'DWD7DEOH 'DWH7LPH /HT 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 6XPPDU\'DWD3DQHO 'HVFULSWLRQ 0HWHU 9DOXH 'HVFULSWLRQ 0HWHU 9DOXH /PD[G%/HT G% ([FKDQJH5DWH G%:HLJKWLQJ $ 5HVSRQVH 6/2: ([FKDQJH5DWH G%:HLJKWLQJ $ 5HVSRQVH 6/2: /RJJHG'DWD&KDUW 6B%,+BB/RJJHG'DWD&KDUW Session Report 9/10/2019 Information Panel Name Site 4 (S060_BIH030025_10092019_104435) Start Time 9/10/2019 8:19:26 AM Stop Time 9/10/2019 8:49:26 AM Device Name BIH030025 Model Type SoundPro DL Device Firmware Rev R.13H Comments Calibration History Date Calibration Action Level Cal. Model Type Serial Number Cert. Due Date 9/9/2019 9:45:46 PM Calibration 114.0 Statistics Chart Site 4 (S060_BIH030025_10092019_104435): Statistics Chart Summary Data Panel Description Meter Value Description Meter Value Lmax 1 71.6 dB Leq 1 48.5 dB Exchange Rate 1 3 dB Weighting 1 A Response 1 SLOW Exchange Rate 2 3 dB Weighting 2 A Response 2 SLOW Logged Data Table Date/Time Leq-2 9/10/2019 8:20:26 AM 55.2 8:21:26 AM 46.7 8:22:26 AM 46.3 8:23:26 AM 46.6 8:24:26 AM 47.1 8:25:26 AM 46.6 8:26:26 AM 47 8:27:26 AM 46.2 8:28:26 AM 47 8:29:26 AM 47.8 8:30:26 AM 46.5 8:31:26 AM 47.3 8:32:26 AM 46 8:33:26 AM 47.3 8:34:26 AM 47.4 8:35:26 AM 47.1 8:36:26 AM 47.2 8:37:26 AM 47.3 8:38:26 AM 48.4 8:39:26 AM 48.2 8:40:26 AM 48.1 8:41:26 AM 49.5 8:42:26 AM 49.7 8:43:26 AM 47.6 8:44:26 AM 49 8:45:26 AM 47.7 8:46:26 AM 51.9 8:47:26 AM 51.7 8:48:26 AM 47.4 8:49:26 AM 47.6 Logged Data Chart Site 4 (S060_BIH030025_10092019_104435): Logged Data Chart 6HVVLRQ5HSRUW ,QIRUPDWLRQ3DQHO 1DPH 6LWH6B%,+BB 6WDUW7LPH 30 6WRS7LPH 30 'HYLFH1DPH %,+ 0RGHO7\SH 6RXQG3UR'/ 'HYLFH)LUPZDUH5HY 5+ &RPPHQWV &DOLEUDWLRQ+LVWRU\ 'DWH &DOLEUDWLRQ$FWLRQ /HYHO &DO0RGHO7\SH 6HULDO1XPEHU &HUW'XH'DWH 30 &DOLEUDWLRQ 6WDWLVWLFV&KDUW 6LWH6B%,+BB6WDWLVWLFV&KDUW /RJJHG'DWD7DEOH 'DWH7LPH /HT 30 30 30 30 30 30 30 30 30 30 30 30 30 30 30 6XPPDU\'DWD3DQHO 'HVFULSWLRQ 0HWHU 9DOXH 'HVFULSWLRQ 0HWHU 9DOXH /PD[G%/HT G% ([FKDQJH5DWH G%:HLJKWLQJ $ 5HVSRQVH 6/2: ([FKDQJH5DWH G%:HLJKWLQJ $ 5HVSRQVH 6/2: /RJJHG'DWD&KDUW 6LWH6B%,+BB/RJJHG'DWD&KDUW Plainfield 143rd Extension APPENDIX C: TRAFFIC AND DESIGN DATA LEGEND PAVEMENT AGGREGATE SUBGRADE IMPROVEMENT CURB & GUTTER B-6.24 RETAINING WALL SELECT RETAINING WALL BACKFILL ROCK FILL STRUCTURAL FILL GUARDRAIL NOISE / SIGHT SCREEN WALL TOPSOIL AGGREGATE SHOULDER PAVED MEDIAN SURFACE 50 -YEAR FLOOD ELEVATION NORMAL WATER LEVEL BASS & GILL CLUB POND J POND BOTTOM 10' LEGEND Q PAVEMENT © AGGREGATE SUBGRADE IMPROVEMENT CURB & GUTTER B-6.24 ROCK FILL STRUCTURAL FILL GUARDRAIL NOISE / SIGHT SCREEN WALL * TOPSOIL AGGREGATE SHOULDER PAVED MEDIAN SURFACE 50 -YEAR FLOOD ELEVATION NORMAL WATER LEVEL BASS & GILL CLUB POND POND BOTTOM EL. 603.3 * NOISE / SIGHT SCREEN WALL TYPE TO FINALIZED UPON COMPLETION OF NOISE STUDY 70' PR CL w t 40' 0 0ww 12' 12' VAR. 12' 12' 7' :r 18-8' L I 2 0 u BASS & GILL CLUB FLETCHER LAKE COMED CORRIDOR FLOOD EVENT FREQUENCY FLOOD ELEVATION N W L 602.0 10 -YEAR 10% ANNUAL CHANCE 602.9 50 -YEAR 2% ANNUAL CHANCE 603.3 100 -YEAR 1% ANNUAL CHANCE 603.6 90' C ti 7.5 6' cc F- 0 0 z PR CL w 40' _ 0 O w cc 12' 12' VAR. 12' 12' 7' 18'-8 Lu 2 0 9' / u 2.0 % 2.0% ®©®B © AVE. 65',./ t w 2.0 % 7.0% �1 BASS & GILL TYPICAL SECTION ALTERNATIVE 1 COMBINATION FILL & WALL FUTURE TRANSMISSION FACILITIES EX TRANSMISSION FACILITIES 2 0 w 150' SHED SINGLE FAMILY RESIDENTIAL Z � (LOOKING EAST) PENNLAND SUBDIVISION FUTURE TRANSMISSION FACILITIES EX TRANSMISSION FACILITIES x a � --- 18' 10' 22' 35' 'kz w 150' BASS & GILL TYPICAL SECTION ALTERNATIVE 2 FILL ONLY w 0 x w 0 O 3 w 0 X LU SHED SINGLE FAMILY RESIDENTIAL Z P (LOOKING EAST) BASS & GILL CLUB FLETCHER LAKE COMED CORRIDOR PENNLAND SUBDIVISION CMT Lie.. No. 180.000613 FILE NAME = D1(43ah4BassGill_Typicadgn DESIGNED - MJW REVISED - MSE UPDATE 8/20/28 MODEL NAME = Default DRAWN - MJW REVISED - PLOT SCALE = 40.0000 ' / CHECKED - CMC REVISED - PLOT DATE = 8/28/2019 (10:33:20 AM) DATE - 06/27/2019 REVISED - 19 STATE OF ILLINOIS DEPARTMENT OF TRANSPORTATION BASS & GILL ALTERNATIVES 143RD STREET F.A.U. RTE. 0380 SECTION COUNTY TOTAL SHEETS SHEET NO. 06 -00040 -00 -FP WILL SCALE: SHEET 1 OF 1 SHEETS STA. TO STA. CONTRACT NO. ILLINOIS FED. AID PROJECT Traffic for existing and future models2018 ExistingModel countsRouteSegmentPosted speedCalculated speed Pk hr vol B percent C percent P&A split lane B split lane C split lane143rd Street EB W of IL 59 40 396 0.041 0.126 330 16 50IL 59 to NapervilleNaperville to IL 126E of IL 126 45 236 ND ND 236 0 0143rd Street WB W of IL 59 40 641 0.041 0.126 534 26 81IL 59 to NapervilleNaperville to IL 126E of IL 126 45 88 ND ND 88 0 0IL 59 SB N of 143rd 45 1626 0.027 0.025 1541 770.5 44 22 41 20.5S of 143rd 45 1521 0.031 0.054 1392 696 47 23.5 82 41IL 59 NB N of 143rd 45 1322 0.027 0.025 1253 626.5 36 18 33 16.5S of 143rd 45 1462 0.031 0.054 1338 669 45 22.5 79 39.5Naperville SB Entire 35 42 308 ND ND 308 0 0N of 143rdS of 143rdNaperville NB Entire 35 42 286 ND ND 286 0 0N of 143rdS of 143rdIL 126 SB N of 143rd 45 765 0.093 0.084 630 71 64S of 143rd 611 0.035 0.061 553 21 37IL 126 NB N of 143rd 45 524 0.093 0.084 431 49 44S of 143rd 518 0.035 0.061 468 18 32Copper Drive Sole segment, one lane* unposted 30 N/A N/A N/A 5 1 0*Because Copper Drive is a residential street with no expectation of increased numbers of residences and is not a through street, no increase in future traffic was included in the future models. Traffic for existing and future modelsRouteSegment143rd Street EB W of IL 59IL 59 to NapervilleNaperville to IL 126E of IL 126143rd Street WB W of IL 59IL 59 to NapervilleNaperville to IL 126E of IL 126IL 59 SB N of 143rdS of 143rdIL 59 NB N of 143rdS of 143rdNaperville SB EntireN of 143rdS of 143rdNaperville NB EntireN of 143rdS of 143rdIL 126 SB N of 143rdS of 143rdIL 126 NB N of 143rdS of 143rdCopper Drive Sole segment, one lane*2050 No BuildModel countsPk hr vol B percent C percent P&A split lane B split lane C split lane577 0.041 0.126 4802473322 ND ND32200935 0.041 0.126 77938118121 ND ND121002099 0.027 0.025 1990 995 57 28.5 52 261943 0.031 0.054 1778 889 60 30 105 52.51651 0.027 0.025 1565 782.5 45 22.5 41 20.53793 0.031 0.054 3470 1735 118 59 205 102.5498 ND ND49800462 ND ND46200990 0.093 0.084 8159283780 0.035 0.061 7052748673 0.093 0.084 5536357664 0.035 0.061 6002341N/A N/A N/A510 Traffic for existing and future modelsRouteSegment143rd Street EB W of IL 59IL 59 to NapervilleNaperville to IL 126E of IL 126143rd Street WB W of IL 59IL 59 to NapervilleNaperville to IL 126E of IL 126IL 59 SB N of 143rdS of 143rdIL 59 NB N of 143rdS of 143rdNaperville SB EntireN of 143rdS of 143rdNaperville NB EntireN of 143rdS of 143rdIL 126 SB N of 143rdS of 143rdIL 126 NB N of 143rdS of 143rdCopper Drive Sole segment, one lane*2050 BuildModel countsPk hr vol B percent* C percent* P&A split lane B split lane C split lane694 0.041 0.126 5792887659 0.041 0.126 549 274.5 27 13.5 83 41.5604 0.041 0.126 503 251.5 25 12.5 76 38389 ND ND389001123 0.041 0.126 93646141799 0.041 0.126 665 332.5 33 16.5 101 50.5632 0.041 0.126 526 263 26 13 80 40287 ND ND287001885 0.027 0.025 1787 893.5 51 25.5 47 23.51578 0.031 0.054 1444 722 49 24.5 85 42.51533 0.027 0.025 1454 727 41 20.5 38 191517 0.031 0.054 1388 694 47 23.5 82 41561 ND ND56100327 ND ND32700521 ND ND52100304 ND ND304001361 0.093 0.084 1120127114675 0.035 0.061 6102441932 0.093 0.084 7678778573 0.035 0.061 5182035510*medium and heavy truck percentages carried over from 2018 because no better data were available From:Jeremy Metz To:Jennifer Miller Cc:Tice "Charles" Cole Subject:RE: Plainfield - 143rd Street Extension noise measurements Date:Wednesday, September 4, 2019 5:55:03 PM Good afternoon Jennifer, I offer the following information: 1. Our traffic count data collection unfortunately did not split the vehicles into the tree separate classes. (Tice following up to see if we can get the truck % split) 2. The heavy vehicle percentage includes all trucks. 3. 2050 Build Queue Lengths (AM or PM whatever is higher): a. IL 59 @ 143rd St. i. SBL = 356 ft ii. SBT = 816 ft iii. SBR = 494 ft iv. NBL = 516 ft v. NBT = 723 ft vi. NBR = 182 ft vii. EBL = 381 ft viii. EBT = 463 ft ix. EBR = 251 ft x. WBL = 364 ft xi. WBT = 414 ft xii. WBR = 455 ft b. Naperville Rd @ 143rd St. i. SBL = 109 ft ii. SBT/R = 633 ft iii. NBL = 39 ft iv. NBT/R = 493 ft v. EBL = 119 ft vi. EBT/R = 355 ft vii. WBL = 40 ft viii. WBT/R = 432 c. IL 126 @ 143rd St. i. SBL = 263 ft ii. SBT = 814 ft iii. SBR = 0 ft (Free Flow) iv. NBL = 58 ft v. NBT/R = 573 ft vi. EBL = 542 ft vii. EBT/R = 187 ft viii. WBL = 126 ft ix. WBT/R = 446 ft 4. 2050 No-Build Queue Lengths (AM or PM whatever is higher): a. IL 59 @ 143rd St. i. SBT/R = 572 ft ii. NBL = 653 ft iii. NBT = 440 ft iv. EBL = 510 ft v. EBR = 251 ft b. Naperville Rd at 143rd St. i. N/A c. IL 126 at 143rd St. i. WBL/R = 403 ft ii. NBT/R = Free Flow iii. SBT/L = 33 ft (Free Flow Unless Left Made) 5. 2018 Existing Queue Lengths (AM or PM whatever is higher): a. IL 59 @ 143rd St. i. SBT/R = 538 ft ii. NBL = 491 ft iii. NBT = 322 ft iv. EBL = 359 ft v. EBR = 207 ft b. Naperville Rd at 143rd St. i. N/A c. IL 126 at 143rd St. i. WBL/R = 118 ft ii. NBT/R = Free Flow iii. SBT/L = 18 ft (Free Flow Unless Left Made) Let me know if you need anything else. Thanks, Jeremy From: Jennifer Miller <jkmiller@cmtengr.com> Sent: Wednesday, September 4, 2019 11:21 AM To: Jeremy Metz <jmetz@cmtengr.com> Cc: Tice 'Charles' Cole <ccole@cmtengr.com> Subject: RE: Plainfield - 143rd Street Extension noise measurements Hi Jeremy, Getting into the details now. In the spreadsheet, there are truck percentages. For the noise models, I prefer to separate traffic into the TNM categories of cars/2-axle passenger trucks, medium trucks (3 axle – mostly panel trucks and dualies) and heavy trucks (basically everything else). Is there a way to achieve this categorization with the data at hand? Do the spreadsheet’s truck percentages represent the TNM heavy truck category? Also, do you know where I can find queue lengths (in feet) for the signalized intersections for the 2018, 2050 no build and 2050 build conditions? I ran across some material in the project folder, but want to make sure I’m using the correct information. Thanks, Jennifer JENNIFER MILLER | Crawford, Murphy & Tilly | w 937.701.6583 Senior Environmental Scientist From: Jeremy Metz <jmetz@cmtengr.com> Sent: Monday, August 19, 2019 9:35 AM To: Jennifer Miller <jkmiller@cmtengr.com> Cc: Tice 'Charles' Cole <ccole@cmtengr.com> Subject: RE: Plainfield - 143rd Street Extension noise measurements Jennifer, Here is a spreadsheet which shows the current and projected traffic counts in the project area, let me know if I can point you to anything else or need me to clarify anything within the spreadsheet. The two relevant tabs should be 2018 No-Build (Existing) and 2050 Build (Projected). L:\Plainfield\18024201-00_PhaseIAddendum\Eng_Planning\Disciplines\Traffic\2019-0218 Turning_Movements.xlsx Thanks, Jeremy From: Jennifer Miller <jkmiller@cmtengr.com> Sent: Friday, August 16, 2019 4:21 PM To: Jeremy Metz <jmetz@cmtengr.com> Cc: Tice 'Charles' Cole <ccole@cmtengr.com> Subject: RE: Plainfield - 143rd Street Extension noise measurements Thanks, Jeremy. Can you point me toward whatever information you currently have on existing and design year traffic counts for the project area? I believe that’s the only other traffic information I’ll need for the noise models. JENNIFER MILLER | Crawford, Murphy & Tilly | w 937.701.6583 Senior Environmental Scientist From: Jeremy Metz <jmetz@cmtengr.com> Sent: Friday, August 16, 2019 4:56 PM To: Jennifer Miller <jkmiller@cmtengr.com> Cc: Tice 'Charles' Cole <ccole@cmtengr.com> Subject: RE: Plainfield - 143rd Street Extension noise measurements Hi Jennifer, Here are the traffic peak hours the team is using: 143rd Street at IL 126/Main Street 7:00 – 8:00 am and 4:00 – 5:00 pm Naperville Road 7:00 – 8:00 am and 4:45 to 5:45 pm Let me know if you need any additional traffic information and I will try and get it to you in a timely manner. Thanks, Jeremy From: Tice 'Charles' Cole <ccole@cmtengr.com> Sent: Friday, August 16, 2019 3:11 PM To: Jeremy Metz <jmetz@cmtengr.com> Subject: Fwd: Plainfield - 143rd Street Extension noise measurements From: Jennifer Miller <jkmiller@cmtengr.com> Sent: Friday, August 16, 2019 3:10:33 PM To: Tice 'Charles' Cole <ccole@cmtengr.com> Cc: Lana Sumner <lsumner@cmtengr.com> Subject: FW: Plainfield - 143rd Street Extension noise measurements Hi Tice, What are the peak traffic hours for the Plainfield-143rd extension project? Of primary concern for the noise measurements would be West Main Street/SR 126 and South Naperville Road. Thanks, Jennifer JENNIFER MILLER | Crawford, Murphy & Tilly | w 937.701.6583 Senior Environmental Scientist From: Lana Sumner <lsumner@cmtengr.com> Sent: Friday, August 16, 2019 4:07 PM To: Jennifer Miller <jkmiller@cmtengr.com> Subject: RE: Plainfield - 143rd Street Extension noise measurements When are the peak traffic hours for the project area? Do you plan to have measurements done at all 7 RR’s? IDOT only requires 25 to 50% of the RR’s to be monitored. Lana LANA SUMNER | Crawford, Murphy & Tilly, Inc. | w 217.572.1082 Senior Transportation and Environmental Planner From: Jennifer Miller <jkmiller@cmtengr.com> Sent: Tuesday, August 13, 2019 9:51 AM To: Lana Sumner <lsumner@cmtengr.com> Cc: Alexandra Zelles <azelles@cmtengr.com> Subject: Plainfield - 143rd Street Extension noise measurements Hi Lana, Thanks for agreeing to do the field measurements for the 143rd Street Extension project! Here are some items I know you’ll need; let me know what else I can get for you. The representative receptor map, map with NAC categories and a discussion of what RR’s were selected and why (and why some were left out) are all located in this folder: L:\Plainfield\18024201- 00_PhaseIAddendum\Eng_Planning\Disciplines\Environmental\Noise I’m working on a best practice for field noise measurements, for which Alex has already given me some comments. I’d appreciate your input as well, particularly since it’s what I’d do if I were in the field: G:\CMTOffices\Columbus\Surface Transportation\!General\Reference - Env\Best Practices & Templates\Best Practices\Draft BP_Traffic Noise Field Measurements.docx Thanks, Jennifer JENNIFER MILLER | Senior Environmental Scientist Crawford, Murphy & Tilly | Engineers & Consultants 84 Remick Blvd. | Springboro, OH 45066 w 937.701.6583 | f 614.854.0569 | jkmiller@cmtengr.com Centered in Value C) aril -hots Department of Tia s ortation Omer Osman, Ardng Secretary 0 10 Thorotierry On r7 11:2001 St 13 3- 0'0i 3 5th Sta m sfoi COE I. w v14350 1075;11100' 143rd 59150 16. r u 0 ,,_2600 15400 a yo 2: ,0 4a a m i I O g. 5 7 a2 4Y i^ +O V•R r a. p v3 G. CV i ,. o f a�° VI 3 5' ,s w Lackpart 5t 1725 1s 400 Plain'2_2 Oe'W Lrt0'S'xot S a 7200 co l Traffic Volume Year : 2017 Count : 9150 Truck Volume Year: 2017 Count : 1525 Multi -Unit r 1150 Single -Unit : 375 W Drtawa 51 R w rial r-.9` CC li # _ 4 ▪ 4.n 'f0�, 11:i Es c 41.00 5 c Lake Renwick W Mini Dr 2. to 7 A m ye� ., U , U5 Oa Eri '• • . ' 50 6100 84501 6850 W Renwick Rd 9440 'Selfridget g4 p W Lockport Rd 9000 Pilch& Rd W 135t!6050 W Lockport :D0 44. rr Four Seasons Park -E Renwick Rd 12400 Legend Click on map symbols to get more detail Traffic Count / Traffic Volume Truck Volume 19600 Traffic Label 1 it, Truck Label IT' Identify Historic Traffic Counts ae Tuetany 1.rn Ashbropke p� Helen [Jr A Airport Rd v h4rslrsnod Go1{Clv6 W Renwick Rd W Renwick Rd 3800 Gran '414$0 C)Illinois Department of Tiangpatation Aver Osman; Acting Secretary 11;7001 5t o m 5 - + r o m rn 4 m rn Lel • a r uti w ;4=4050 1875. 111OO'1 143rd 59150 15l.5 o co rl 13 SNI 8 S, cc) 1 Fd Ak : ,D . rc rc a v, n 13 80035th 5t Thamllerry ❑ r RMMH $ 5�4 n V (34'fib " Lockport St 1725 13400 Plain'.2_2 O0V L{O'SSOtSt 0 9 0 s0 a a W Ottawa St 9040 Traffic Volume. Year: 2017 Count : 29600 Truck Volume Year : 2017 Count: 1550 Mufti -Unit ; 750 Single -Unit : S06 7200 # Q ▪ cn 04. Q� y m 5r Pt ` 4100 0 lake Renwick' Wi'lliniEV S G;, Vs 7 O �R N Is 64s vs O, 6-00 3050 _ 513 6850 W Renwick Rd 9440 0) a4 7 w Lol:kpotl :jt0 0 Four Seasons Pmk W Lockport Rd E Renwick Rd 12490 Legend Click on map symbols to get more detail - Traffic Count • Traffic Volume • Truck Volume 1960o Traffic Label 1515 Truck Label 1_- Identify Historic Traffic Counts TLY[8ny Ln pshbrogke �tl Helen Dr Airport Rd Aup o' Adistwond Golf Cub Pro. W Renwick Rd VJ Renwick Rd 1.l'44C 3890 O a, f Illinois Department of Tran�ortatian {4ti�J/� Omer Osman, Acting Secretary S.T00,1h St ►-hornbem/ Dr 10 0 rs 112001 St 13 80'635th St sTal k a dp ueA 56450 5 w14?4050 18751twow143rd S915Q 152 o Year:2017 G Count: 34144 m EN n a Truck Volume o Year : 2017 v r , �a Count : 2950 fl r�. Multi -Unit : 1854 0. Single -Unit : 1054 fib" { - `. 1 3 a o. a lan, 44a o 'r N. M C. 414 rs s 1.2600 15400 W Lockport St 1725 18400 Alain' -2_2306W Lt0'S5:0' ST 7200 - o o 9000 211 LIT w Identify Historic Traffic Counts Traffic Volume w Ottawa St os , L CA 41 5 co e 4100 o wick Lake Ren AtIIIinior s - 4- 7 -,yt m 1' ,x'447. uo o Pf1 6100 8050 6850 W Renwick Rd 9400 Pa 5a Pitcher Rd W1351:6050 W LatkponT00 E 1431550 Four Seasons Park W Lockport Rd Click on map symbols to get more detail E Traffic Count Traffic Vo!Lim e Truck Volume 19600 Traffic Label l hrh Truck Label in i Rd Tuscany Ln Ashlor Doke, RU I-lelen Gr e0F Airport Rd 5. 0 Anil orl 113: Misr -wood Goff Cub. Gran. E Renwick Rd 12400 r W Renwick R I W Renwick HU '1440{ a 3800 ar r, 9 Illinois Deperhnent of T ariortation Omer Osman, Acting Secretary Thornbe+ry Or 13800l3Svh St n UI be/Page River W 14'4050 1875,1i100'i 143rd 59-150 154' Q. 0 w 0 ✓ 0 4. O 11:600 -15400 way1604, qa W Lockport St 1725. 15 400 Plain'2_2100W L90'5:50'1 S o 12fi 40 O 1. 0r W Ottawa 51 W allini or tOl -ea- en. 0. p ' u:, th 4 N 7200 CO a' ?4 4 4-e .pj ▪ La '7 d' r : h7 4a -g 4100 a 4 -30 '4a`µ ad 1� g150 6100 8050 Selfridges 54 6850 4 w W Renwick Rd c a Co W Capper Or ▪ Lake Renwick <2, 7� r0, 9400 Lw PO-cher Rd W 1351?6050 ,0 ,.5jry9 ply cDS "1. 45 W Lockport Rd Traffic Volume Year :2017 Count :14800 Truck Volume Year :2017 Count : 2825 Mufti -Unit : 1250 Single -Unit : 1375 W Lockpanj:Db E Renwick Rd Legend Click on map symbols to get more detail E, Traffic Count ▪ Traffic Volume ▪ Truck Volume 19500 Traffic Label 1515 Truck Label 0 identify Historic Traffic Counts Tuscany Ler Airport Rd 3 'irj ASh6ropkQ Ad `g p Helen Clr .a 0 Mrstvmorl Golf Club hl r W Renwick Rd W Renwick Rd R'4��f 12400 0 0, M1 6 Airport Gra 3800 °Illinois Department of Transportation Omer Osman, hrting Secretary ihornberry Dr W 104050 1540▪ 4 0 rs r 11;2441 St 13 803013 5th St $R c▪ laJe in 4 vS an 1875:11140v 143rd 59156 1525 c N 0 0 r-, ktnH uIozu§Q,5 w 1 g ": •0, 3C.31 ii W Lockport St 1725 15440 Plain'2_2.a04W L10'5_S01 Sts 4 y m W OftaV s 51 W I1Iini Dr 5a a ` roof '09. ri'l O ---riso 61..00 8050 afrl.Qt$etfrid91',y 54 rz r) 0 C 7200 0y s. 4° p4 ▪ 01 0`'� h 5 4100 6650 In 0 C 43 W Renwick Rd Traffic Volume Year : 2017 Count : 13500 Truck Volume Year : 2017 Count : 1300 Multi -Unit : 625 Single -Unit : 475 4. Lake Renwick 9400 0 W Lockpongl:30 W Lockport Rd Legend Click on map symbols to get more detail V L. Traffic Count Traffic Volume Truck Volume 1966t} Traffic Label 15f6 Truck Label Identify HistoricTrafrc Counts TuIiBny Ln Fear 5205015 Park 0 Al 1�. Rd P Ashbrooke .6 O Helen Or •E Renwick Rd 12400 W Renwick Rd 3000 Airport Rd Mrshwod Got{ ChM. W Renwick Rd 0 0, m- a Airport rj; Gra. '4tr44C 0iltarois Department of Transportation Omer 6urian, Acting Secretary 112001 St try Dr r5 13800'3tI" St xa az O In In 4050 1 875)11100V 143rd 59150 h525 0.1 d AfItH ear C !0 5P • 126 I •�44--- 2' rJ 7 0 4g a� - a 0. 9000 buPrtge River wc‹.q 4 '1 con m' 4�4 • c' C 64 45C3 cn JJ Lt15'400'• St 1725 18404 Plain'2_21001V L'D'S:501 5 c 7200 col en W Ottawa 5t W tllini Or h b4 ae AY i • h 5 ri 4100 60 .1•1 500 6850 W Renwick Rd 0 , U IQ o i ix 0 Loke Renwie o !y, c 4 w m o4. us 6. a0 W Capper Dr 9400 44 Year: 2016 Count : 1556 r'.}'155C Truk Volume 1 Year : undefined Truck Countundefined Multi -Unit : undefined Single -Unit : undefrned I 0 V1 uo w r:3'450 Tuscany to Four Seasons Park v 0 W t.orkpon91 d0 — _ = W Lockport Rd a+q4 a Ashby Doke }td Helen Dr ik d. 72400 r W Renwick Rd +h1 Renwick Rd 3800 YT a d Legend Click on map symbols to get more detail E Traffic Count ❑d Traffic Volume Truck Volume 19600 Traffic Label 15r Truck Label Identify Historic Traffic Counts Airport Rd FA• AICOLO' Mrs/woad Golf Chrb n Airport r13200 Grand }to'+e once 1'4404vick Rd az 0 0 0Illinois Department ofTransportation Omer °means Acting Secretary drao to st Thornberry or W 14340 50 a a 1.600 15400 107M11100V143rd 53150 15Za .0FI u1a7ubO 0 1 t,7.on, St a tv :16001 as 13804':'-1I' 1,1 m W Lockport 5t 1725 18400 Plain7_2g00W ▪ L10'5501 Sta I 9000 0 In buP4ge River a 0 0 a m. w '!1 0 - m' Orb 1 0 Q. 3 r W Ottawa St It' ' k In h c W Mini or .' tt4� 6100 805:11 94 I 1- 7200 CO j, in y la w f?0. S rp 4100 a ▪ Lake Renwick G 7 a ▪ 0' c re W Pitcher Rd W 135t'.6050 Traffic Count ❑ X Year 2016 Count :502.6 Truck Volume Year : undefined Truck Countundefned Mufti -Unit : undefined Single -Unit: undefined W Coppe 6850 W Renwick Rd 9400 O e o.. cP 4, Er143S550 Four Seasons Park W Lotkpon l:ib0 W Lockport Rd 30 Legend Click an map symbols to get more detail I Traffic Count Traffic Volume Truck Volume 19600 Traffic Label 1575 Truck Label L Identify Historic Traffic Counts Tunidny to rn eRd A Ashby 'awe Rd Helen Dr cc cc rn E Renwick Rd 12400 W Renwick Rd W Renwick HO '44740 3800 4n ti Airport Rd Misrvmod Golf Club Graf n 0Illinois Deparbnent of Tiari u tation Owner Osman, Acting Secretary 470b'th st Thomberry Dr W 14'40§0 rl 'U U 0 11?.Ooi St 13861Y351h St 7, 1675j1100 143rd 59.150 +{^H hO w 154'6 0 0 0 rp C w 9000 CuFogc River Traffic Count ❑x Q 026• r3 Year 2016 Count 43:: Truck Volume Year undefined Truck Countundefined Multi -Unit : undefined Single -Unit : undefined C o' �P. 01 ' v Q- .5 ti O� PS S W Lack rtSt 172518444 Plain'2_2 00' L40'5.501 St 7200 X604 15A46 F° r0.l fii P) • AD' Ln LA c1` 4• '4 F.: e IA y s 7 41 a4 0 W Onawa St W 111ini or 54 m -+ nd 1. SD Ul 5 71 ulna 8050 6850 ar 0 FM up W Renwick Rd Lake Renwick 9400 4 E 14'-1550 \� I w LockPerl9[iOOP = OA et, rr Four Seosons Park W Lockport Rd Legend Click on map symbols to pet more detail Traffic Count ❑f Traffic Volume i Truck Volume 1$6131} Traffic. Label 1575 Truck Label IJ Identify Historic Traffic Counts m rn 12400 1 W Renwick Rd W Renwick Rd '4'441 Tuscany Lo Ashbrooke I-lelen Dr Airport Rd Airpon 793 U Mliislwood Goff Club Gran 3590 'DWH 'HVLJQHU &075RXWH UG6W&LW\&RXQW\ 3ODLQILHOG:LOO6HFWLRQ )3%DVH<HDU 8QLW&RVW 4XDQWLW\ 8QLW([WHQVLRQ VTIW %XLOGLQJVKHG'HPROLWLRQ5HORFDWLRQ HDFK VT\G 6XEWRWDO DFUH DFUH 2YHUKHDG(OHFWULF8WLOLW\5HORFDWLRQ OVXP8QLW&RVW 4XDQWLW\ 8QLW([WHQVLRQ VTIW %XLOGLQJVKHG'HPROLWLRQ5HORFDWLRQ HDFK VT\G 6XEWRWDO DFUH DFUH 2YHUKHDG(OHFWULF8WLOLW\5HORFDWLRQ OVXP7RWDO3URMHFW&RVW/LQHV$OWHUQDWLYH1RLVHZDOO%XLOWRQ3HQQODQG6XEGLYLVLRQ3URSHUW\:RUN&ODVVLILFDWLRQ(VWLPDWHG&RVWV1RLVHZDOOIRRWWDOO(URVLRQ&RQWURODQG/DQGVFDSLQJ&RQWLQJHQF\&RQFHSW7RWDO&RQVWUXFWLRQ&RVW/LQHVDQG/DQG$FTXLVLWLRQ7HPSRUDU\(DVHPHQW/DQG$FTXLVLWLRQ3HUPDQHQW(DVHPHQW'HVLJQ(QJLQHHULQJRI/LQH'HVLJQ(QJLQHHULQJRI/LQH7RWDO3URMHFW&RVW/LQHV$OWHUQDWLYH1RLVHZDOO%XLOWRQ&RP(G3URSHUW\/DQG$FTXLVLWLRQ3HUPDQHQW(DVHPHQW&RQWLQJHQF\&RQFHSW7RWDO&RQVWUXFWLRQ&RVW/LQHVDQG/DQG$FTXLVLWLRQ7HPSRUDU\(DVHPHQW1RLVHZDOOIRRWWDOO(URVLRQ&RQWURODQG/DQGVFDSLQJϭϰϯƌĚ^ƚƌĞĞƚǆƚĞŶƐŝŽŶWŚĂƐĞ/ŶŐŝŶĞĞƌŝŶŐWƌĞůŝŵŝŶĂƌǇŶŐŝŶĞĞƌΖƐKƉŝŶŝŽŶŽĨWƌŽďĂďůĞŽŶƐƚƌƵĐƚŝŽŶŽƐƚEŽŝƐĞǁĂůůĞƚǁĞĞŶEĂƉĞƌǀŝůůĞZŽĂĚĂŶĚ/>ZƚĞ͘ϭϮϲ:RUN&ODVVLILFDWLRQ(VWLPDWHG&RVWV