Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My Public Portal
About
03-04-2024 Village Board Agenda and Packet
Meeting of the President and the Board of Trustees Monday, March 04, 2024 7:00 PM 24401 W. Lockport Street Plainfield, IL 60544 In the Boardroom Agenda CALL TO ORDER, ROLL CALL, PLEDGE PRESIDENTIAL COMMENTS TRUSTEES COMMENTS PUBLIC COMMENTS (3-5 Minutes) BUSINESS MEETING 1.APPROVAL OF AGENDA 2.CONSENT AGENDA 2a.Minutes of the Board Meeting held on February 5, 2024. 02-05-2024 Village Board Minutes 2b.Bills Paid and Bills Payable Reports for March 4, 2024. Bills Paid and Bills Payable Reports for 03-04-2024 2c.Cash & Investment, Revenue, and Expenditure Reports for January, 2024. Cash & Investment Report through January 31, 2024 Budget Performance Report through January 31, 2024 Budget by Organization Reports through January 31, 2024 2d.Ordinance No. ____, increasing the Class “E” Liquor Licenses to 10 for Maple Butter Café to be located at 24020 W. 119th Street. Maple Butter Cafe Liquor License Staff Report and Ordinance 2e.Approval of legal fees for services rendered by Dunn, Martin & Miller, Ltd. for the 143rd Street East Extension for October 2023 totaling $38,322.50. 143rd Street East Legal Fees (Payment #5) & Supporting Doc 2f.Reduction of the Greenbriar Phase 1 bond from $1,555,645 to $613,666.75, Phase 2 bond from $793,549 to $2,500 and Phase 3 bond from $981,427.85 to $709,820.14. 1 Meeting of the President and the Board of Trustees Page - 2 Greenbriar Bond Board Packet 3.TRACY, JOHNSON & WILSON 3.a.Seeking Board consideration of a motion to authorize payment to Tracy, Johnson & Wilson in the amount of $10,015.75. Tracy, Johnson & Wilson 03-04-2024 4.HAWK AUTO DEALERSHIP DEVELOPMENT (CASE NUMBER 2036-120723.SPR.FP) 4.a.Seeking Board consideration of a motion to approve the site plan review for the project known as Hawk Auto, subject to the stipulations noted in the staff report. Hawk Auto Staff Report 4.b.Seeking Board consideration of a motion to approve the Final Plat of Subdivision for Hawk Auto, subject to the stipulations noted in the staff report. 5.TERRABIS - 16020 S. ROUTE 59 SPECIAL USE (CASE NUMBER 2040-010424.SU) 5.a.Seeking Board consideration of a motion to approve Ordinance No._____, approving a special use permit for an Adult-Use Cannabis Dispensary for the property located at 16020 S. Route 59, contingent on the stipulations in the staff report. Terrabis Staff Report Packet 6.WOODMAN’S FOOD MARKET DEVELOPMENT (CASE NUMBER 2041-010724.AA.REZ.SU.SPR.PP) 6.a.Seeking Board consideration of a motion to open the public hearing regarding the Woodman’s Annexation Agreement. 6.b.Seeking Board consideration of a motion to close the public hearing and return to the business meeting. 6.c.Seeking Board consideration of a motion to direct the Village Attorney to prepare the necessary ordinances granting approval of the annexation agreement and annexation for the project known as the Woodman’s Food Market development. Woodman's Staff Report Packet 6.d.Seeking Board consideration of a motion to adopt the findings of fact of the Plan Commission as the findings of fact of the Board of Trustees and, furthermore, to direct the Village Attorney to prepare the necessary ordinances granting approval of the requested map amendment (re-zoning) from R-1 to B-3 and approval of the requested special use for planned development, for the project known as the Woodman’s Food Market development. 7.14910 S. BARTLETT AVE. REHAB GRANT (CASE NUMBER 2038-121823.HPC) 2 Meeting of the President and the Board of Trustees Page - 3 7.a.Seeking Board consideration of a motion to approve the requested historic preservation rehabilitation grant in an amount not to exceed $2,500 for exterior painting for the historic landmark located at 14910 S. Bartlett Avenue. 14910 S. Bartlett Staff Report Packet 8.AUTUMN GLEN FINAL PLAT (CASE NUMBER 2037-121223.FP.SSA) 8.a.Seeking Board consideration of a motion to approve the Final plat of Subdivision of Autumn Glen, subject to the stipulations noted in the staff report. Autumn Glen Staff Report Packet 8.b.Seeking Board consideration of a motion to approve the Planned Unit Development Residential Statement of Intent and Agreement for Autumn Glen. 8.c.Seeking Board consideration of a motion to adopt Resolution No. ____, a Resolution Proposing the Establishment of Special Service Area Number 48, for the Autumn Glen Residential Subdivision, in Will County, in the Village of Plainfield and Providing for a Public Hearing and Other Procedures in Connection Therewith. 9.LOCKLEY PARK FINAL PLAT (CASE NUMBER 2043-011924.FP.SSA) 9.a.Seeking Board consideration of a motion to approve the Final Plat of Subdivision for Lockley Park, subject to the stipulations noted in the staff report. Lockley Park Staff Report Packet 9.b.Seeking Board consideration of a motion to adopt Resolution No. ____, a Resolution Proposing the Establishment of Special Service Area Number 50, for the Lockley Park Residential Subdivision, in Will County, in the Village of Plainfield and Providing for a Public Hearing and Other Procedures in Connection Therewith. 10.RENTAL ORDINANCE 10.a.Seeking Board consideration of a motion to remove this item from the table. 10.b.Seeking Board consideration of a motion to approve Ordinance No. _____, enacting Chapter 2.5, Article XIV, creating a Rental Ordinance. Rental Ordinance Staff Report Rental Ordiance 10.c.Seeking Board consideration of a motion to approve Ordinance No. _____, amending Chapter 2.5, Article XII to enact Section 2.5-504, creating rental regulation fees. Rental Regulation Fees Ordinance ADMINISTRATOR'S REPORT MANAGEMENT SERVICES REPORT ENGINEER'S REPORT 3 Meeting of the President and the Board of Trustees Page - 4 PLANNING DEPARTMENT REPORT BUILDING DEPARTMENT REPORT Building and Code Compliance Report for January 2024. Building and Code Compliance Board Report for January 2024 PUBLIC WORKS REPORT Seeking Board consideration of a motion to award the FY24 and FY25 Pavement Patching Program to Shroeder Asphalt Services, Inc., the low qualified bidder, in an amount of $222,500.00, plus a $20,000.00 contingency, for a total contract amount not to exceed $242,500.00. FY24 & FY25 Pavement Patching Village Board Memo & Supporting Doc Seeking Board consideration of a motion to authorize the purchase of one 2024 Ford Explorer XLT 4WD SUV from Ron Tirapelli Ford at a total cost not to exceed $43,206.03. 2024 Ford Explorer XLT 4WD SUV Bldg Dept Memo & Supporting Docs Seeking Board consideration of a motion to authorize the Village President to execute individual agreements for the Village Hall, Law Enforcement Center, Public Works Facility, Wastewater Treatment Plant, and Well Houses with Green Sky Consulting for the LED lighting conversion project. Village Public Buildings - ComEd Energy Efficiency Report LED Light Conversion Memo & Supporting Docs Seeking Board consideration of a motion to approve the proposal from Westside Mechanical for PEMA overhead heaters and related work in an amount not to exceed $46,550.00. PEMA VB Memo & Supporting Docs Seeking Board consideration of a motion to approve the proposal from Elliott Electric for PEMA electrical upgrades and related work in an amount not to exceed $49,210.00. Seeking Board consideration of a motion to approve the proposal from Big Ass Fans for fans, evaporative cooler, and related work in an amount not to exceed $19,210.00. POLICE CHIEF'S REPORT Seeking Board consideration of a motion to authorize the purchase of four (4) Ford Utility Police Interceptors from Currie Motors in Frankfort in the amount of $192,136.00; necessary lighting and equipment through Fleet Safety Supply in the amount of $71,491.98; installation of the necessary lighting and equipment through EVT Tech in the amount of $20,378.40; installation of police graphics through Harmonic Design in an amount of $3,550.00; authorize the IT department to purchase equipment for each squad, for an amount not to exceed $52,000.00; for the total amount not to exceed the amount of $356,534.20. Police Vehicles Purchase Request Staff Report 4 Meeting of the President and the Board of Trustees Page - 5 Operations Report for December 2023 and January 2024. Police Operations Report for December 2023 Police Operations Report for January 2024 ATTORNEY'S REPORT REMINDERS - March 5th - Plan Commission at 7:00 p.m. March 11th - Committee of the Whole Workshop at 7:00 p.m. March 14th - Historic Preservation Commission at 7:00 p.m. March 18th - Next Village Board Meeting at 7:00 p.m. 5 VILLAGE OF PLAINFIELD MEETING MINUTES FEBRUARY 5, 2024 AT:VILLAGE HALL BOARD PRESENT: J. ARGOUDELIS, R.KIEFER, C.LARSON, T.RUANE, M.BONUCHI, AND P.KALKANIS. BOARD ABSENT: B.WOJOWSKI. OTHERS PRESENT: J.BLAKEMORE, ADMINISTRATOR; R.VOGEL, ATTORNEY; M.GIBAS, VILLAGE CLERK; D.WOLD, ENGINEER; S.THREEWITT, PUBLIC WORKS DIRECTOR; A.SCHATTKE, LEAD ENGINEER; J.PROULX, PLANNING DIRECTOR; J.MELROSE, ECONOMIC DEVELOPMENT DIRECTOR; A.DE BONI, COMMUNITY RELATIONS DIRECTOR; L.SPIRES, BUILDING OFFICIAL; T.PLECKHAM, MANAGEMENT SERVICES DIRECTOR; AND A.NOVAK, POLICE COMMANDER. CALL TO ORDER, ROLL CALL, PLEDGE Mayor Argoudelis called the meeting to order at 7:00 p.m. Roll call was taken, Trustee Wojowski was absent, all other Trustees were present. Mayor Argoudelis led the Pledge of Allegiance. There were approximately 37 persons in the audience. PRESIDENTIAL COMMENTS Trustee Bonuchi moved to appoint Brian Failing to the Historic Preservation Commission for a three- year term expiring on October 18, 2027. Second by Trustee Larson. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. Mayor Argoudelis commented on a meeting with the consultant for the traffic study at Route 59 & Riverwalk. TRUSTEES COMMENTS Trustee Bonuchi stated that Plainfield Fest will have a carnival this year and stated that is a major endeavor involving a lot of people. Trustee Larson: Commented on the State of the Village for Bolingbrook. Stated that she made a social media post that referred to the Mayor as a disgusting disgrace to the office and a resident liked the post, but not in the capacity of their employed position. The employer of the resident was contacted by the Mayor and demanded a public apology for a public offense and furthermore noted a lack of respect for him, his efforts, and his office. Stated that she has been voting no to attending executive sessions because of the Mayor releasing information/content of the executive session. PUBLIC COMMENTS (3-5 minutes) No Comments. 6 Village of Plainfield Meeting Minutes – February 5, 2024 Page 2 BUSINESS MEETING 1)APPROVAL OF AGENDA Trustee Kiefer moved to approve the Agenda. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 2)CONSENT AGENDA Trustee Bonuchi moved to approve the Consent Agenda to include: a) Minutes of the Board Meeting held on December 18, 2023. b)Bills Paid and Bills Payable Reports for February 5, 2024. c)Cash & Investment, Revenue, and Expenditure Reports for December 2023. d)Ordinance No. 3636, decreasing the number of Class F liquor licenses to 22 reflecting the closing of Opera House and Irish Tyme. e)Approval of the 2024 Plainfield Paddy Day Mile and associated road closures to be held on Sunday, March 17, 2024 at 12:30 p.m. f)Approval of the 2024 Irish Parade and associated road closures to be held on Sunday, March 17, 2024 at 1:00 p.m. g)Approval of the 2024 Cruise Nights and associated road closures to be held every Tuesday, June 4, 2024 through August 20, 2024 from 5:30 p.m. to 8:30 p.m. h)Approval of the 26th Annual Healthy Driven Plainfield Harvest Kidz Run, 5K Run/Walk and 10K Run and associated road closures to be held on Sunday, September 29, 2024 at 8:30 a.m. i)Approval of the 2024 Plainfield Fest, use of Village owned property, and associated road closures to be held June 28-30, 2024. j)Authorize the Village Administrator to approve a change order with Imperial Surveillance in the amount of $4,720.00 for the door access and security camera improvements. Second by Trustee Kalkanis. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 3) DUPAGE RIVER RESTORATION PROJECT Jennifer Hammer, Conservation Foundation, and Tim Pollowy, Hey & Associates, gave an update on the DuPage River Restoration project. Trustee Bonuchi moved to approve the Memorandum of Agreement with the Lower DuPage River Watershed Coalition related to the DuPage River Restoration Project. Second by Trustee Larson. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 4)PLAINFIELD LOGISTICS CENTRE (CASE NUMBER 2035-120623.FP) Trustee Larson moved to approve the Final Plat of Subdivision of Plainfield Logistics Centre, subject to the stipulations noted in the staff report. Second by Trustee Bonuchi. Jon Proulx stated that the applicant is seeking approval of a final plat of subdivision for the Plainfield Logistics Centre, which received zoning approvals for annexation, rezoning, preliminary plat and site plan review in August of 2022. The approved plans call for a warehouse/distribution facility of approximately 1.2 million square feet, which DHL Supply Chain (USA) would operate for a Fortune 7 Village of Plainfield Meeting Minutes – February 5, 2024 Page 3 500-type consumer products company. The final plat will grant the right-of-way dedications for 143rd Street and Ridge Road along with the appropriate utility easements but does not involve subdividing the property into multiple lots. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, no. 4 yes, 1 no, 1 absent. Motion carried. Trustee Ruane moved to approve Ordinance No. 3637, approving an Agreement Authorizing Reimbursement for the Construction of Improvements Beneficial to the Public for the Village of Plainfield, for the 143rd Street off-site sanitary sewer. Second by Trustee Larson. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, no. 4 yes, 1 no, 1 absent. Motion carried. Trustee Ruane moved to accept a grant of stormwater drainage and access easement from Exel Inc., d/b/a DHL Supply Chain (USA), related to stormwater management for the 143rd Street west extension. Second by Trustee Kiefer. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, no. 4 yes, 1 no, 1 absent. Motion carried. 5) LIBERTY GROVE OUTLOT Jon Proulx stated that staff is proposing to convey ownership of a large open space and detention outlot in Liberty Grove from the Village of Plainfield to the Liberty Grove Homeowners' Association (HOA). Attorney Vogel has prepared an ordinance, quitclaim deed, and PTAX form to implement the transfer of ownership. In Liberty Grove’s Annexation Agreement, ownership of the park and open space outlots are identified as being conveyed to the Village of Plainfield. This dedication was granted upon the recording of the final plat of Liberty Grove Unit 1 in 2002. Since that time, as the subdivision has built out, the HOA has maintained the outlot. Earlier this year, the HOA notified current Village staff of the Village's ownership of this outlot and expressed interest in taking ownership of the lot. There was some general discussion regarding connection of paths in Liberty Grove for public use. Cliff Yahnke, President of the Liberty Grove Homeowners Association, stated that they are open to discussion on connecting paths for public use. Trustee Ruane moved to approve Ordinance No. 3638, authorizing the Execution of a Deed Conveying Outlot B in Liberty Grove Unit 1 to the Liberty Grove Homeowners Association, and for the Village President to execute any related documents. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, abstain; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 4 yes, 0 no, 1 abstain, 1 absent. Motion carried. 6) RENTAL ORDINANCE Lonnie Spires reviewed the proposed rental ordinance. There was some general discussion regarding the proposed ordinance. Truste Larson identified several concerns with the proposed ordinance and will email a list of concerns to Administrator Blakemore. Trustee Larson moved to table the Rental Ordinance. Second by Trustee Kalkanis. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 8 Village of Plainfield Meeting Minutes – February 5, 2024 Page 4 7) UNSCHEDULED BUS ORDINANCE Administrator Blakemore stated that as discussed during the January 22nd COW, the Village Board expressed support for an ordinance regulating unscheduled intercity buses. The proposed ordinance is the same as was previously presented. Staff felt it was best to amend the Impound Ordinance as well to include a provision regarding the unscheduled bus ordinance, should the need arise to impound such a bus. An updated Impound Ordinance is also being presented for the Board’s consideration. Trustee Kiefer suggested sending the ordinance to the Texas Governor and Texas Emergency Management. There were no objections. Trustee Bonuchi moved to approve Ordinance No. 3639, enacting Chapter 5, Article X regulating Unscheduled Intercity Buses. Second by Trustee Kiefer. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. Trustee Kalkanis moved to approve Ordinance No. 3640, amending Chapter 2, Article VIII, related to vehicle impoundment. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 8) VIDEO GAMING Administrator Blakemore reviewed some changes that were made to the proposed ordinance since it was last presented to the Village Board. Staff noted that the text amendment prohibiting video gaming in the B-5 overlay district was denied unanimously by the Plan Commission. Staff noted that while the zoning map establishes a B-5 Overlay the zoning ordinance does not. The proposed text amendment ordinance amends Section 9-10 and 9-59 establishing the B-5 Overlay as a zoning district. Trustee Kiefer indicated that he did not think that a rope would be sufficient separation. Trustee Larson indicated concern with restricting downtown businesses and concern with the removal of the 18-month waiting period provision. Mayor Argoudelis stated that the 18-month waiting period provision puts new businesses at a disadvantage and that is why it was removed. Trustee Bonuchi stated that we need to help independent businesses and felt that there should not be a waiting period to receive a video gaming license. Trustee Kiefer also indicated that there should not be a waiting period. Trustee Ruane indicated that the signage ordinance needs to be followed and enforced and agreed that a rope would not be sufficient separation and suggested a hard barrier. Trustee Ruane moved to approve Ordinance No. 3641, enacting Chapter 4, Article IX, regulating video gaming with an amendment to article 4-495(e), to require a ½ wall or other solid barrier and to remove the word rope. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, no; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, no; Argoudelis, yes. 4 yes, 2 no, 1 absent. Motion carried. 9)VIDEO GAMING TEXT AMENDMENT (CASE NO. 2033-120523.TA) There was no action taken on this item. 9 Village of Plainfield Meeting Minutes – February 5, 2024 Page 5 ADMINISTRATOR'S REPORT Administrator Blakemore commented on Woodman’s, Cannabis Dispensaries, Hawk Auto, and the upgraded Bond rating. MANAGEMENT SERVICES REPORT No Report. ENGINEER’S REPORT No Report. PLANNING DEPARTMENT REPORT Trustee Kiefer moved to authorize Moe Joe’s to operate a food truck in three (3) parking spaces adjacent to the restaurant at 24013-24033 W. Lockport St. on February 12, 13 and 14, 2024 for a “Fat Tuesday” event. Second by Trustee Larson. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. BUILDING DEPARTMENT REPORT Mr. Lonnie Spires presented the Building and Code Compliance Report for December 2023. PUBLIC WORKS REPORT Trustee Bonuchi moved to authorize the Village President to award the 2024 Berm Lift Station Sanitary Sewer Force Main Repair Contract to Baish Excavating Inc., the lowest bidder, in an amount of $216,453.01, plus a $20,000.00 contingency with a total amount not to exceed $236,453.01. Second by Trustee Larson. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. Trustee Bonuchi moved to authorize the payment of $64,000.00 to Commonwealth Edison Company for temporary and permanent easements necessary for the 143rd Street East Roadway Extension, and to authorize the Village Administrator to execute all related documents. Second by Trustee Ruane. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. Trustee Kalkanis moved to authorize the execution of a Temporary Construction License with Commonwealth Edison Company necessary for the 143rd Street East Roadway Extension, and to authorize the Village Administrator to execute all related documents. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. Scott Threewitt gave a brief update on the Old Town project. POLICE CHIEF’S REPORT Trustee Ruane moved to approve Ordinance No. 3642, providing for a text amendment to Chapter 5, Article VI, pertaining to no-parking places. Second by Trustee Bonuchi. Vote by roll call. Kiefer, yes; Larson, yes; Ruane, yes; Wojowski, absent; Bonuchi, yes; Kalkanis, yes. 5 yes, 0 no, 1 absent. Motion carried. 10 Village of Plainfield Meeting Minutes – February 5, 2024 Page 6 Commander Novak presented the Operations Report for November 2023. ATTORNEY’S REPORT No Report. Mayor Argoudelis read the reminders. Trustee Ruane moved to adjourn. Second by Trustee Bonuchi. Voice Vote. All in favor, 0 opposed. Motion carried. The meeting adjourned at 9:40 p.m. Michelle Gibas, Village Clerk 11 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice Amount 10131 - BAXTER & WOODMAN 0251844 Edit 10/24/2023 03/04/2024 495.00 10131 - BAXTER & WOODMAN 0252907 Edit 11/20/2023 03/04/2024 339.30 10131 - BAXTER & WOODMAN 0252911 Edit 11/20/2023 03/04/2024 275.00 10131 - BAXTER & WOODMAN 0251841 Edit 10/24/2023 03/04/2024 1,100.00 10131 - BAXTER & WOODMAN 0252110 Edit 10/25/2023 03/04/2024 55.00 10131 - BAXTER & WOODMAN 0253115 Edit 11/21/2023 03/04/2024 1,160.00 10131 - BAXTER & WOODMAN 0251837 Edit 10/24/2023 03/04/2024 515.00 Invoice Transactions 7 $3,939.30 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 53,323.74 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 52,468.25 Invoice Transactions 2 $105,791.99 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 32,228.61 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 31,928.53 Invoice Transactions 2 $64,157.14 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 7,537.40 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 7,467.14 Invoice Transactions 2 $15,004.54 Accounts Payable by G/L Distribution Report Invoice Due Date Range 02/06/24 - 03/04/24 Invoice Description Fund 01 - General Fund Account 0121.110 - Unbilled Receivable-Developer FED INCOME TAX - Federal Income Tax* FED INCOME TAX - Federal Income Tax* Account 0210.223 - Medicare W/H Payable Totals Account 0210.237 - IMRF Payable FED INCOME TAX - Federal Income Tax* FED INCOME TAX - Federal Income Tax* Account 0210.222 - FICA Payable Totals Account 0210.223 - Medicare W/H Payable FED INCOME TAX - Federal Income Tax* FED INCOME TAX - Federal Income Tax* Account 0210.220 - Federal W/H Payable Totals Account 0210.222 - FICA Payable Hawk Auto Springbank Construction Services Account 0121.110 - Unbilled Receivable-Developer Totals Account 0210.220 - Federal W/H Payable M/I Homes Tilden Place Springbank Construction Services M/I Homes Tilden Place M/I Homes Riverstone Hawk Auto Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 1 of 41 12 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10527 - ILL MUNICIPAL RETIREMENT REGULAR 2024-00001303 Paid by Check # 133588 02/16/2024 02/16/2024 02/16/2024 67,311.11 Invoice Transactions 1 $67,311.11 10949 - PLAINFIELD POLICE PEN ACCT#4236- 2308 2024-00001310 Paid by Check # 133595 02/16/2024 02/16/2024 02/16/2024 25,520.72 10949 - PLAINFIELD POLICE PEN ACCT#4236- 2308 2024-00001387 Paid by Check # 133627 03/01/2024 03/01/2024 03/01/2024 25,520.72 Invoice Transactions 2 $51,041.44 10315 - DIVERSIFIED INVESTMENT ADVISORS 2024-00001301 Paid by Check # 133586 02/16/2024 02/16/2024 02/16/2024 22,313.41 13243 - MISSION SQUARE 2024-00001308 Paid by Check # 133593 02/16/2024 02/16/2024 02/16/2024 13,623.42 10774 - METLIFE 2024-00001306 Paid by Check # 133591 02/16/2024 02/16/2024 02/16/2024 67.49 10774 - METLIFE 2024-00001384 Paid by Check # 133624 03/01/2024 03/01/2024 03/01/2024 67.49 13243 - MISSION SQUARE 2024-00001385 Paid by Check # 133625 03/01/2024 03/01/2024 03/01/2024 13,672.48 10315 - DIVERSIFIED INVESTMENT ADVISORS 2024-00001380 Paid by Check # 133620 03/01/2024 03/01/2024 03/01/2024 21,719.16 Invoice Transactions 6 $71,463.45 10778 - METROPOLITAN ALLIANCE OF POLICE 2024-00001307 Paid by Check # 133592 02/16/2024 02/16/2024 02/16/2024 2,385.00 Invoice Transactions 1 $2,385.00 11244 - UNITED WAY OF WILL COUNTY 2024-00001312 Paid by Check # 133597 02/16/2024 02/16/2024 02/16/2024 24.66 11244 - UNITED WAY OF WILL COUNTY 2024-00001389 Paid by Check # 133629 03/01/2024 03/01/2024 03/01/2024 24.66 Invoice Transactions 2 $49.32 10030 - AFLAC 2024-00001300 Paid by Check # 133585 02/16/2024 02/16/2024 02/16/2024 722.76 10030 - AFLAC 2024-00001379 Paid by Check # 133619 03/01/2024 03/01/2024 03/01/2024 722.76 Invoice Transactions 2 $1,445.52 Account 0210.241 - Deferred Comp. Plan Totals Account 0210.242 - Union Dues MAP - Metropolitan Alliance of Police Account 0210.242 - Union Dues Totals 457-ICMA-FLAT - Deferred Comp ICMA* 457-METLIFE-PCT - Deferred Comp Metlife 457-METLIFE-PCT - Deferred Comp Metlife 457-ICMA-FLAT - Deferred Comp ICMA* 457-IPPFA-PCT - Deferred Comp IPPFA* POL PEN - Police Pension Annual* Account 0210.238 - Police Pension W/H Payable Totals Account 0210.241 - Deferred Comp. Plan 457-IPPFA-PCT - Deferred Comp IPPFA* IMRF - Illinois Municipal Retirement *Account 0210.237 - IMRF Payable Totals Account 0210.238 - Police Pension W/H Payable POL PEN - Police Pension Annual* Account 0210.245 - AFLAC Post-Tax Account 0210.244 - AFLAC Pre-Tax AFLAC - PRETAX - AFLAC Pretax* AFLAC - PRETAX - AFLAC Pretax* Account 0210.244 - AFLAC Pre-Tax Totals Account 0210.243 - United Way Donations UNITED WAY - United Way of Will County UNITED WAY - United Way of Will County Account 0210.243 - United Way Donations Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 2 of 41 13 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10030 - AFLAC 2024-00001300 Paid by Check # 133585 02/16/2024 02/16/2024 02/16/2024 385.09 10030 - AFLAC 2024-00001379 Paid by Check # 133619 03/01/2024 03/01/2024 03/01/2024 385.09 Invoice Transactions 2 $770.18 11124 - STATE DISBURSEMENT UNIT 2024-00001311 Paid by Check # 133596 02/16/2024 02/16/2024 02/16/2024 2,331.03 12714 - WILL COUNTY CIRCUIT CLERK'S OFFICE 2024-00001314 Paid by Check # 133599 02/16/2024 02/16/2024 02/16/2024 471.77 12714 - WILL COUNTY CIRCUIT CLERK'S OFFICE 2024-00001391 Paid by Check # 133631 03/01/2024 03/01/2024 03/01/2024 471.77 11124 - STATE DISBURSEMENT UNIT 2024-00001388 Paid by Check # 133628 03/01/2024 03/01/2024 03/01/2024 2,331.03 Invoice Transactions 4 $5,605.60 10427 - GLENN B STEARNS, CHAPTER 13 TRUSTEE 2024-00001302 Paid by Check # 133587 02/16/2024 02/16/2024 02/16/2024 355.38 10427 - GLENN B STEARNS, CHAPTER 13 TRUSTEE 2024-00001381 Paid by Check # 133621 03/01/2024 03/01/2024 03/01/2024 355.38 Invoice Transactions 2 $710.76 11266 - VILLAGE OF PLAINFIELD 2024-00001313 Paid by Check # 133598 02/16/2024 02/16/2024 02/16/2024 2,934.15 11266 - VILLAGE OF PLAINFIELD 2024-00001390 Paid by Check # 133630 03/01/2024 03/01/2024 03/01/2024 2,618.76 Invoice Transactions 2 $5,552.91 10854 - NCPERS GROUP LIFE INS.2024-00001309 Paid by Check # 133594 02/16/2024 02/16/2024 02/16/2024 64.00 10854 - NCPERS GROUP LIFE INS.2024-00001386 Paid by Check # 133626 03/01/2024 03/01/2024 03/01/2024 64.00 Invoice Transactions 2 $128.00 10175 - CARCARE TOWING 2024-00001394 Edit 01/31/2024 03/04/2024 350.00 Account 0210.246 - Child Support/Maintenance Assignment CHILD SUPPORT - Child Support Wage Assignment* SPOUSAL SUP - Spousal/Maintenance Support SPOUSAL SUP - Spousal/Maintenance Support CHILD SUPPORT - Child Support Wage Assignment* AFLAC - PRETAX - AFLAC Pretax* AFLAC - PRETAX - AFLAC Pretax* Account 0210.245 - AFLAC Post-Tax Totals Account 0210.301 - Employee Life Insurance Totals Account 0220.250 - Police Tow Fee 01/01/24 - 01/31/24 2 Tows Account 0210.249 - Flex 125-FSA Totals Account 0210.301 - Employee Life Insurance SUP LIFE INS - NCPERS SUP LIFE INS - NCPERS Account 0210.248 - Wage Assignment Totals Account 0210.249 - Flex 125-FSA FSA MED PT - Flex Spending - WEX* FSA MED PT - Flex Spending - WEX* Account 0210.246 - Child Support/Maintenance Assignment Totals Account 0210.248 - Wage Assignment WAGE ASSIGN - Wage Assignments WAGE ASSIGN - Wage Assignments Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 3 of 41 14 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 1 $350.00 RANDALL A. HOLZHAUER 2024-00001392 Edit 02/20/2024 03/04/2024 5.00 ROBERT HANNAY 2024-00001393 Edit 02/02/2024 03/04/2024 5.00 Invoice Transactions 2 $10.00 11280 - WASTE MANAGEMENT 6578245-2007-3 Edit 02/01/2024 03/04/2024 442,811.80 Invoice Transactions 1 $442,811.80 Invoice Transactions 1 $442,811.80 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001321 Paid by EFT # 3284 01/29/2024 02/16/2024 02/16/2024 62.00 10237 - COMCAST 2024-00001335 Paid by EFT # 3293 01/28/2024 02/21/2024 02/21/2024 34.74 12820 - 7-ELEVEN #33859 2024-00001331 Paid by Check # 133601 02/14/2024 02/21/2024 02/21/2024 95.46 13325 - AMAZON CAPITAL SERVICES 17G4-CFWX-9RDQ Edit 02/01/2024 03/04/2024 54.80 10937 - PLAINFIELD SHOREWOOD AREA CHAMBER OF COMMERCE 38189 Edit 01/31/2024 03/04/2024 200.00 12734 - TAI GINSBERG & ASSOCIATES, LLC 2918 Edit 02/02/2024 03/04/2024 8,718.00 11278 - WAREHOUSE DIRECT 5668103-0 Edit 02/15/2024 03/04/2024 275.49 11315 - WILL COUNTY GOVERNMENTAL LEAGUE 2024-1159 Edit 02/09/2024 03/04/2024 30.00 Invoice Transactions 8 $9,470.49 Invoice Transactions 8 $9,470.49 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001321 Paid by EFT # 3284 01/29/2024 02/16/2024 02/16/2024 500.00 Invoice Transactions 1 $500.00 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 1,005.07 Invoice Transactions 1 $1,005.07 Account 0600.602 - Administrative Fines(P-Tickets) Overpayment of Admin. Ticket Overpayment of Admin. Ticket Account 0600.602 - Administrative Fines(P-Tickets) Totals Account 0220.250 - Police Tow Fee Totals Public Relations 2024 Legislative Luncheon- Blakemore Account 8070 - Public Relations Totals Division 01 - Legislative Program Totals Acct. 8771 01 001 0001526 Coffee With the Mayor 02/14/2024 Coffee With the Mayor State of the County Luncheon Board Approved 02/12/2018 Division 00 - Non-Divisional Totals Division 01 - Legislative Program Account 8070 - Public Relations Pleckham Unit 04 - Administration/Finance Division 00 - Non-Divisional Account 8100 - Fees to Refuse Hauler January 2024 Account 8100 - Fees to Refuse Hauler Totals Account 3015 - IL Unemployment Insurance 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Division 02 - Administration Program Account 3000 - Travel/Training Pleckham Account 3000 - Travel/Training Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 4 of 41 15 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 153.61 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 155.23 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 123.17 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 128.97 Invoice Transactions 4 $560.98 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 42.28 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 56.88 Invoice Transactions 2 $99.16 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 11.16 13325 - AMAZON CAPITAL SERVICES 1QP4-7DHL-799W Edit 02/01/2024 03/04/2024 131.76 Invoice Transactions 2 $142.92 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001321 Paid by EFT # 3284 01/29/2024 02/16/2024 02/16/2024 500.00 Invoice Transactions 1 $500.00 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.80 Invoice Transactions 1 $59.80 13237 - OLD NATIONAL BANK - LOCKBOX 2024-00001374 Paid by EFT # 126 01/31/2024 02/14/2024 02/14/2024 146.66 12201 - VANCO SERVICES 00014161441 Paid by EFT # 3277 02/01/2024 02/15/2024 02/15/2024 236.53 11838 - COMCAST - ACCOUNT #901868063 191960233 Paid by EFT # 3294 01/15/2024 02/21/2024 02/21/2024 1,670.79 12090 - PHYSICIANS IMMEDIATE CARE 2024-00001369 Edit 01/09/2024 03/04/2024 221.00 11080 - SIKICH LLP 42562 Edit 02/19/2024 03/04/2024 600.00 11192 - THIRD MILLENNIUM ASSOCIATES, INC. 30978 Edit 01/31/2024 03/04/2024 1,111.13 11889 - ASCAP 2024-00001376 Edit 01/20/2024 03/04/2024 435.75 11429 - AZAVAR AUDIT SOLUTIONS 157559 Edit 01/25/2024 03/04/2024 163.70 11429 - AZAVAR AUDIT SOLUTIONS 157636 Edit 02/19/2024 03/04/2024 51.63 Invoice Transactions 9 $4,637.19 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001315 Paid by EFT # 3278 01/31/2024 02/07/2024 02/07/2024 29.73 Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Acct. 00114799 Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals January 2024 Acct. 901868063 06/2023 - 12/2023 Acct. 43155 1099 Filing February 2024 01/07/24 - 02/06/24 Account 8035 - Maintenance Contracts/Lease Totals Account 8135 - Contractual Services January 2024 Lock Box Fees Account 5015 - Dues & Subscriptions Pleckham Account 5015 - Dues & Subscriptions Totals Account 8035 - Maintenance Contracts/Lease Account 5005 - Office Supplies/Postage VH Postage VH Account 5005 - Office Supplies/Postage Totals Account 8135.008 - Settlement Charges Gov. Services January 2024 Music Royalty Fees Acct. 500691995 Sales Tax Audit Pmts. 2, 3, & 4 Sales Tax Audit Pmt. 5 Account 8135 - Contractual Services Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 5 of 41 16 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001316 Paid by EFT # 3279 01/31/2024 02/07/2024 02/07/2024 9.95 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001317 Paid by EFT # 3280 01/31/2024 02/07/2024 02/07/2024 84.01 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001318 Paid by EFT # 3281 01/31/2024 02/07/2024 02/07/2024 9.95 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001319 Paid by EFT # 3282 01/31/2024 02/07/2024 02/07/2024 109.62 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001320 Paid by EFT # 3283 01/31/2024 02/07/2024 02/07/2024 2,806.11 Invoice Transactions 6 $3,049.37 Invoice Transactions 27 $10,554.49 10937 - PLAINFIELD SHOREWOOD AREA CHAMBER OF COMMERCE 38189 Edit 01/31/2024 03/04/2024 50.00 Invoice Transactions 1 $50.00 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 14.40 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 14.55 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 11.55 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 12.09 Invoice Transactions 4 $52.59 Invoice Transactions 5 $102.59 13017 - HELM SERVICE CHI194315 Edit 12/03/2023 03/04/2024 973.39 10585 - INTERSTATE ALL BATTERY CENTER 1915201039279 Edit 01/26/2024 03/04/2024 211.40 10585 - INTERSTATE ALL BATTERY CENTER 1915201039292 Edit 01/26/2024 03/04/2024 42.00 Invoice Transactions 3 $1,226.79 12610 - COSMOPOLITAN CLEANING & MAINTENANCE 8685 Edit 02/02/2024 03/04/2024 2,375.00 Invoice Transactions 1 $2,375.00 Invoice Transactions 4 $3,601.79 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001328 Paid by EFT # 3291 01/29/2024 02/16/2024 02/16/2024 650.00 Invoice Transactions 1 $650.00 Division 03 - Community Relations Program Account 3000 - Travel/Training State of the County Luncheon Account 3000 - Travel/Training Totals Utilities January 2024 Utilities Web January 2024 Account 8135.008 - Settlement Charges Totals Division 02 - Administration Program Totals Gov. Services Web January 2024Fines January 2024 Fines Web January 2024 Division 06 - Human Resources Program Account 3000 - Travel/Training Harris Account 3000 - Travel/Training Totals Account 8135 - Contractual Services February 2024 Account 8135 - Contractual Services Totals Division 04 - Facility Management Program Totals Account 5000 - Building Supplies VH VH VH Account 5000 - Building Supplies Totals Account 4000 - Telephone/Internet Totals Division 03 - Community Relations Program Totals Division 04 - Facility Management Program Account 4000 - Telephone/Internet Acct. 00114799 Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 6 of 41 17 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 19.20 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 19.40 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 15.40 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 16.12 Invoice Transactions 4 $70.12 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 42.28 Invoice Transactions 1 $42.28 12619 - MARY HARRIS 2024-00001415 Edit 02/16/2024 03/04/2024 26.80 Invoice Transactions 1 $26.80 12619 - MARY HARRIS 2024-00001415 Edit 02/16/2024 03/04/2024 200.00 Invoice Transactions 1 $200.00 Invoice Transactions 8 $989.20 12535 - TYLER TECHNOLOGIES, INC 2686 Edit 02/08/2024 03/04/2024 1,199.00 12535 - TYLER TECHNOLOGIES, INC 2695 Edit 02/08/2024 03/04/2024 1,199.00 Invoice Transactions 2 $2,398.00 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 9.60 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 9.70 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 7.70 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 8.06 Invoice Transactions 4 $35.06 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 173.10 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 144.90 Invoice Transactions 2 $318.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001322 Paid by EFT # 3285 01/29/2024 02/16/2024 02/16/2024 3.00 Invoice Transactions 1 $3.00 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 94.96 Division 08 - IT Program Account 3000 - Travel/Training Tyler Connect 2024-Roose Tyler Connect 2024- Kastrantas Account 3000 - Travel/Training Totals Service Awards & Mileage Account 8070 - Public Relations Totals Division 06 - Human Resources Program Totals Account 5020 - Gas/Oil/Mileage/Carwash Service Awards & Mileage Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 8070 - Public Relations Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Account 4005 - Cellular Phones Totals Acct. 00114799 Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 8030 - Server/Network Supplies Acct. 485081837-00001 Account 4005 - Cellular Phones Totals Account 5020 - Gas/Oil/Mileage/Carwash Kastrantas Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4000 - Telephone/Internet Acct. 00114799 Acct. 00114799 Acct. 1211165 Acct. 1211165 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 7 of 41 18 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 44.97 13325 - AMAZON CAPITAL SERVICES 1NY4-6M7C-4RRJ Edit 02/01/2024 03/04/2024 91.88 Invoice Transactions 3 $231.81 12520 - ELINEUP LLC 1416 Edit 02/13/2024 03/04/2024 600.00 13122 - INSIGHT PUBLIC SECTOR 1101130161 Edit 02/22/2024 03/04/2024 5,375.00 12736 - KnowBe4 INV307071 Edit 02/05/2024 03/04/2024 4,472.00 13071 - OPENGOV, INC.INV12430 Edit 01/18/2024 03/04/2024 49,500.00 10027 - ZOHO CORPORATION 69862721 Edit 02/03/2024 03/04/2024 3,595.00 Invoice Transactions 5 $63,542.00 12819 - METRONET 2024-00001368 Edit 01/28/2024 03/04/2024 92.25 Invoice Transactions 1 $92.25 13325 - AMAZON CAPITAL SERVICES 1LCQ-MV7L-49TF Edit 02/01/2024 03/04/2024 269.00 Invoice Transactions 1 $269.00 Invoice Transactions 19 $66,889.12 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 19.20 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 19.40 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 15.40 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 16.12 Invoice Transactions 4 $70.12 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 42.28 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 46.89 Invoice Transactions 2 $89.17 13340 - PITNEY BOWES - POSTAGE 2024-00001336 Paid by EFT # 3299 02/23/2024 02/23/2024 02/23/2024 413.10 13325 - AMAZON CAPITAL SERVICES 194X-N3MX-9HJK Edit 02/01/2024 03/04/2024 130.99 12957 - GARVEY'S OFFICE PRODUCTS PINV2528734 Edit 02/02/2024 03/04/2024 598.69 Acct. 485081837-00002 IT Account 8030 - Server/Network Supplies Totals Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Division 08 - IT Program Totals Division 09 - Legal Program Account 4000 - Telephone/Internet Acct. 00114799 Account 8135 - Contractual Services Totals Account 9115 - Office Furniture & Equipment PD Account 9115 - Office Furniture & Equipment Totals Annual Subscription Helpdesk Software Manage Engine Subscription Account 8031 - Software Licensing/Renewals Totals Account 8135 - Contractual Services Acct. 1372977 Account 8031 - Software Licensing/Renewals 03/16/24 - 03/15/25 FortiGate VH Annual Renewal Annual Cyber Security Training Annual Renewal OpenGov Year 4 of 5 Account 5005 - Office Supplies/Postage PD Postage Legal Legal Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 8 of 41 19 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10891 - OFF THE PRESS 23809 Edit 02/05/2024 03/04/2024 87.00 Invoice Transactions 4 $1,229.78 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001325 Paid by EFT # 3288 01/29/2024 02/16/2024 02/16/2024 225.00 12804 - ILLINOIS STATE BAR ASSOCIATION 2024-00001370 Edit 02/05/2024 03/04/2024 380.00 11297 - THOMSON REUTERS-WEST PUBLISHING CO 849655675 Edit 02/01/2024 03/04/2024 600.00 11343 - WILL COUNTY BAR ASSOCIATION 2024-00001371 Edit 02/05/2024 03/04/2024 100.00 Invoice Transactions 4 $1,305.00 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 30.00 Invoice Transactions 1 $30.00 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 Invoice Transactions 1 $59.85 13126 - CAMIC JOHNSON, LTD.224 Edit 10/26/2023 03/04/2024 300.00 13126 - CAMIC JOHNSON, LTD.227 Edit 01/26/2024 03/04/2024 300.00 Invoice Transactions 2 $600.00 Invoice Transactions 18 $3,383.92 Invoice Transactions 90 $537,803.40 10924 - PETTY CASH - PD 8635 Paid by Check # 133582 01/04/2024 02/09/2024 02/09/2024 30.00 10924 - PETTY CASH - PD 8637 Paid by Check # 133582 01/11/2024 02/09/2024 02/09/2024 72.62 10924 - PETTY CASH - PD 8638 Paid by Check # 133582 02/01/2024 02/09/2024 02/09/2024 30.00 10649 - KENDALL COUNTY CHIEFS OF POLICE ASSN. 1091 Edit 02/02/2024 03/04/2024 17.00 Invoice Transactions 4 $149.62 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 4,699.86 Invoice Transactions 1 $4,699.86 Dues W. Lite Account 5015 - Dues & Subscriptions Totals Account 5020 - Gas/Oil/Mileage/Carwash Account 5005 - Office Supplies/Postage Totals Account 5015 - Dues & Subscriptions McQuaid New Member Dues-W. Lite W. Lite Will County Chief's Meeting Ostreko,Miller, Zigterman Training Account 3000 - Travel/Training Totals Account 3015 - IL Unemployment Insurance Unit 05 - Police Department Division 02 - Administration Program Account 3000 - Travel/Training Will County Chief's Meeting Janis-IL LEAP meeting Account 8065 - Legal Fees Totals Division 09 - Legal Program Totals Unit 04 - Administration/Finance Totals Account 8035 - Maintenance Contracts/Lease Totals Account 8065 - Legal Fees October 2023 January 2024 January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 8035 - Maintenance Contracts/Lease 01/07/24 - 02/06/24 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 9 of 41 20 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 21.12 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 21.34 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 4.32 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 4.52 Invoice Transactions 4 $51.30 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 84.56 Invoice Transactions 1 $84.56 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 11.17 13340 - PITNEY BOWES - POSTAGE 2024-00001336 Paid by EFT # 3299 02/23/2024 02/23/2024 02/23/2024 2.56 12957 - GARVEY'S OFFICE PRODUCTS PINV2528751 Edit 02/02/2024 03/04/2024 21.29 13448 - MIDWEST PROMOTIONAL GROUP 67104-1 Edit 01/30/2024 03/04/2024 1,352.96 10891 - OFF THE PRESS 23804 Edit 01/31/2024 03/04/2024 70.00 Invoice Transactions 5 $1,457.98 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001327 Paid by EFT # 3290 01/29/2024 02/16/2024 02/16/2024 39.00 Invoice Transactions 1 $39.00 10924 - PETTY CASH - PD 8640 Paid by Check # 133582 02/02/2024 02/09/2024 02/09/2024 9.92 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 15.00 Invoice Transactions 2 $24.92 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 10275 - CUMMINS-ALLISON CORP.6875886 Edit 02/09/2024 03/04/2024 417.00 Invoice Transactions 2 $476.85 10924 - PETTY CASH - PD 8633 Paid by Check # 133582 12/21/2023 02/09/2024 02/09/2024 70.18 10924 - PETTY CASH - PD 8642 Paid by Check # 133582 02/06/2024 02/09/2024 02/09/2024 54.92 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001325 Paid by EFT # 3288 01/29/2024 02/16/2024 02/16/2024 33.43 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001326 Paid by EFT # 3289 01/29/2024 02/16/2024 02/16/2024 159.96 10237 - COMCAST 2024-00001335 Paid by EFT # 3293 01/28/2024 02/21/2024 02/21/2024 9.48 10249 - CONRAD CO.102027131 Edit 02/01/2024 03/04/2024 699.99 VH Postage PD Postage Office Supplies Leather Padfolios B.C. Janis & Funk Account 4005 - Cellular Phones Acct. 485081837-00001 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Acct. 00114799 Account 8040 - Custodial Supplies/Building Maintenance Kitchen Supplies Kitchen Supplies McQuaid Novak Account 8035 - Maintenance Contracts/Lease 01/07/24 - 02/06/24 PD Shredder Account 8035 - Maintenance Contracts/Lease Totals Account 5020 - Gas/Oil/Mileage/Carwash Janis Mileage January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5005 - Office Supplies/Postage Totals Account 5015 - Dues & Subscriptions R. Miller Account 5015 - Dues & Subscriptions Totals Acct. 8771 01 001 0001526 Vacuum Cleaner PD Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 10 of 41 21 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10249 - CONRAD CO.102027130 Edit 02/01/2024 03/04/2024 56.48 13428 - DJB JANITORIAL SUPPLY 48030 Edit 02/12/2024 03/04/2024 603.32 13017 - HELM SERVICE CHI146964C Edit 01/26/2024 03/04/2024 2,988.75 10767 - MENARDS INC. # 3182 37138 Edit 01/30/2024 03/04/2024 29.88 10767 - MENARDS INC. # 3182 37225 Edit 02/01/2024 03/04/2024 93.97 10767 - MENARDS INC. # 3182 37473 Edit 02/07/2024 03/04/2024 56.39 10767 - MENARDS INC. # 3182 36784 Edit 01/22/2024 03/04/2024 258.00 10767 - MENARDS INC. # 3182 36708 Edit 01/19/2024 03/04/2024 106.37 12115 - COLLEY ELEVATOR COMPANY 254202 Edit 02/01/2024 03/04/2024 233.00 13325 - AMAZON CAPITAL SERVICES 1RT6-3DL1-6NRM Edit 02/01/2024 03/04/2024 279.96 12059 - PLAINFIELD LOCK TECHS 37850 Edit 01/26/2024 03/04/2024 31.15 12324 - TERMINIX PROCESSING CENTER 442222228 Edit 01/29/2024 03/04/2024 178.00 12275 - THE FITNESS CONNECTION 55364 Edit 02/06/2024 03/04/2024 180.00 Invoice Transactions 19 $6,123.23 12536 - ILLINOIS SECRETARY OF STATE 2024-00001292 Paid by Check # 133577 01/17/2024 02/09/2024 02/09/2024 151.00 Invoice Transactions 1 $151.00 Invoice Transactions 40 $13,258.32 11529 - BRAD MALCOLM 2024-00001290 Paid by Check # 133575 01/31/2024 02/09/2024 02/09/2024 66.95 10924 - PETTY CASH - PD 8635 Paid by Check # 133582 01/04/2024 02/09/2024 02/09/2024 30.00 10924 - PETTY CASH - PD 8638 Paid by Check # 133582 02/01/2024 02/09/2024 02/09/2024 30.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001324 Paid by EFT # 3287 01/29/2024 02/16/2024 02/16/2024 440.00 10649 - KENDALL COUNTY CHIEFS OF POLICE ASSN. 1091 Edit 02/02/2024 03/04/2024 17.00 10017 - ACCURATE REPRO INC.0000199666 Edit 12/20/2023 03/04/2024 36.80 Invoice Transactions 6 $620.75 11838 - COMCAST - ACCOUNT #901868063 191960233 Paid by EFT # 3294 01/15/2024 02/21/2024 02/21/2024 1,670.79 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 768.06 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 776.14 Account 8040 - Custodial Supplies/Building Maintenance Totals Account 8060 - Vehicle Maintenance M1 Account 8060 - Vehicle Maintenance Totals PD Elevator Inspection Tower Heaters PD Custodial Supplies PD Preventative Maintenance- PD Custodial Supplies Custodial Supplies Custodial Supplies Custodial Supplies Custodial Supplies Vacuum Cleaner Supplies PD Custodial Supplies PD Qtrly Maint. Acct. 00114799 Account 3000 - Travel/Training Totals Account 4000 - Telephone/Internet Acct. 901868063 Acct. 00114799 Will County Chief's Meeting Will County Chief's Meeting Ostreko,Miller, Zigterman Zigterman Training Gloss Laminate Division 02 - Administration Program Totals Division 51 - Police Patrol Account 3000 - Travel/Training Notary Training Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 11 of 41 22 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 156.93 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 164.32 11262 - VERIZON WIRELESS 9954787636 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 2,030.43 Invoice Transactions 6 $5,566.67 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 520.43 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 118.91 Invoice Transactions 2 $639.34 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001324 Paid by EFT # 3287 01/29/2024 02/16/2024 02/16/2024 49.00 13340 - PITNEY BOWES - POSTAGE 2024-00001336 Paid by EFT # 3299 02/23/2024 02/23/2024 02/23/2024 17.14 13325 - AMAZON CAPITAL SERVICES 1RL1-YYNJ-4QMG Edit 02/01/2024 03/04/2024 16.33 Invoice Transactions 3 $82.47 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001324 Paid by EFT # 3287 01/29/2024 02/16/2024 02/16/2024 50.00 Invoice Transactions 1 $50.00 11689 - FMP 50-5013117 Edit 01/10/2024 03/04/2024 72.75 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 450.00 Invoice Transactions 2 $522.75 13155 - JUSTIN BARMA 2024-00001291 Paid by Check # 133581 01/10/2024 02/09/2024 02/09/2024 146.28 10997 - RAY O'HERRON CO., INC.2323702 Edit 02/08/2024 03/04/2024 128.00 10997 - RAY O'HERRON CO., INC.2323735 Edit 02/08/2024 03/04/2024 268.48 10997 - RAY O'HERRON CO., INC.2323736 Edit 02/08/2024 03/04/2024 60.75 10997 - RAY O'HERRON CO., INC.2323737 Edit 02/08/2024 03/04/2024 10.78 10997 - RAY O'HERRON CO., INC.2321882 Edit 02/01/2024 03/04/2024 128.00 10997 - RAY O'HERRON CO., INC.2320648 Edit 01/25/2024 03/04/2024 133.63 10997 - RAY O'HERRON CO., INC.2320647 Edit 01/25/2024 03/04/2024 145.78 10997 - RAY O'HERRON CO., INC.2321884 Edit 02/01/2024 03/04/2024 73.80 10997 - RAY O'HERRON CO., INC.2320619 Edit 01/25/2024 03/04/2024 52.64 10997 - RAY O'HERRON CO., INC.2320620 Edit 01/25/2024 03/04/2024 80.99 13325 - AMAZON CAPITAL SERVICES 1FF1-WQD4-643H Edit 02/01/2024 03/04/2024 36.66 10351 - EMBROIDME - SHOREWOOD 48433 Edit 01/31/2024 03/04/2024 385.00 10353 - ENTENMANN-ROVIN COMPANY 0178876-IN Edit 01/19/2024 03/04/2024 347.00 Acct. 1211165 Acct. 1211165 Acct. 485081837-00003 Account 4000 - Telephone/Internet Totals Motor Oil January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5095 - Uniforms/Clothing Account 5015 - Dues & Subscriptions Zigterman Account 5015 - Dues & Subscriptions Totals Account 5020 - Gas/Oil/Mileage/Carwash Account 5005 - Office Supplies/Postage Zigterman PD Postage Office Supplies Account 5005 - Office Supplies/Postage Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Sester Pruchnicki Sergeant Patches Uniforms Sester Sester Doornbosch Buttons Sester Holster Robles Malcolm Malcolm Funk Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 12 of 41 23 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10608 - JCM UNIFORMS 800825 Edit 01/31/2024 03/04/2024 5.00 Invoice Transactions 15 $2,002.79 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001324 Paid by EFT # 3287 01/29/2024 02/16/2024 02/16/2024 25.67 13325 - AMAZON CAPITAL SERVICES 16YZ-XGGL-F3YL Edit 01/24/2024 03/04/2024 (17.33) Invoice Transactions 2 $8.34 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001326 Paid by EFT # 3289 01/29/2024 02/16/2024 02/16/2024 67.54 Invoice Transactions 1 $67.54 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 Invoice Transactions 1 $59.85 12536 - ILLINOIS SECRETARY OF STATE 2024-00001294 Paid by Check # 133579 01/17/2024 02/09/2024 02/09/2024 151.00 10666 - K & M TIRE 422223126 Edit 01/26/2024 03/04/2024 148.72 10666 - K & M TIRE 422223127 Edit 01/26/2024 03/04/2024 309.04 10666 - K & M TIRE 422221591 Edit 01/23/2024 03/04/2024 696.00 10767 - MENARDS INC. # 3182 36663 Edit 01/18/2024 03/04/2024 73.91 11020 - ROD BAKER FORD SALES, INC F0CS89779 Edit 01/23/2024 03/04/2024 262.43 11020 - ROD BAKER FORD SALES, INC 41269 Edit 01/24/2024 03/04/2024 54.36 11020 - ROD BAKER FORD SALES, INC F0CS90575 Edit 02/06/2024 03/04/2024 566.73 11020 - ROD BAKER FORD SALES, INC 41623 Edit 01/26/2024 03/04/2024 36.00 11020 - ROD BAKER FORD SALES, INC 41921 Edit 02/01/2024 03/04/2024 16.33 11020 - ROD BAKER FORD SALES, INC 41781 Edit 01/31/2024 03/04/2024 293.35 11020 - ROD BAKER FORD SALES, INC 42140 Edit 02/06/2024 03/04/2024 31.86 11020 - ROD BAKER FORD SALES, INC 41553 Edit 01/26/2024 03/04/2024 147.06 11020 - ROD BAKER FORD SALES, INC 41713 Edit 01/29/2024 03/04/2024 44.22 11840 - SAFELITE AUTO GLASS 536753 Edit 01/30/2024 03/04/2024 557.41 10139 - WEBB CHEVROLET PLAINFIELD 45037814 Edit 01/19/2024 03/04/2024 23.20 10394 - FLEET SAFETY SUPPLY 82439 Edit 02/06/2024 03/04/2024 248.81 10394 - FLEET SAFETY SUPPLY 82410 Edit 02/01/2024 03/04/2024 151.49 11689 - FMP 53-468951 Edit 01/30/2024 03/04/2024 (159.43) 11689 - FMP 50-5052551 Edit 01/30/2024 03/04/2024 159.43 Invoice Transactions 20 $3,811.92 Account 5095 - Uniforms/Clothing Totals Account 5115.001 - Traffic Program Zigterman Traffic Program Meyer M16 M24 M39 M19 M39 M5 M41 M20 M45 Vehicle Maintenance Account 8035 - Maintenance Contracts/Lease 01/07/24 - 02/06/24 Account 8035 - Maintenance Contracts/Lease Totals Account 8060 - Vehicle Maintenance Account 5115.001 - Traffic Program Totals Account 5115.004 - Community Programs-Explorer Program Novak Account 5115.004 - Community Programs-Explorer Program Totals Account 8060 - Vehicle Maintenance Totals Account 8069 - Bike Unit Vehicle Maintenance M15, M16 & M29 M13 Vehicle Maintenance Vehicle Maintenance M19 M41 M41 M42 M39 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 13 of 41 24 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10413 - GALLS INC.026847226 Edit 01/19/2024 03/04/2024 103.50 Invoice Transactions 1 $103.50 12090 - PHYSICIANS IMMEDIATE CARE 2024-00001369 Edit 01/09/2024 03/04/2024 1,432.60 Invoice Transactions 1 $1,432.60 11291 - WESCOM 20240315 Edit 02/01/2024 03/04/2024 52,415.58 Invoice Transactions 1 $52,415.58 11311 - WILL COUNTY ANIMAL CONTROL G23020009 Edit 11/29/2023 03/04/2024 130.00 11311 - WILL COUNTY ANIMAL CONTROL G23040009 Edit 11/29/2023 03/04/2024 530.00 11311 - WILL COUNTY ANIMAL CONTROL G23030009 Edit 11/29/2023 03/04/2024 330.00 11311 - WILL COUNTY ANIMAL CONTROL G23050009 Edit 11/29/2023 03/04/2024 530.00 11311 - WILL COUNTY ANIMAL CONTROL G23060009 Edit 11/29/2023 03/04/2024 530.00 11311 - WILL COUNTY ANIMAL CONTROL G23070009 Edit 11/29/2023 03/04/2024 260.00 11311 - WILL COUNTY ANIMAL CONTROL G23080009 Edit 11/30/2023 03/04/2024 860.00 11311 - WILL COUNTY ANIMAL CONTROL G23090009 Edit 11/30/2023 03/04/2024 240.00 11311 - WILL COUNTY ANIMAL CONTROL G23110009 Edit 11/30/2023 03/04/2024 790.00 11311 - WILL COUNTY ANIMAL CONTROL G23120009 Edit 12/01/2023 03/04/2024 460.00 11311 - WILL COUNTY ANIMAL CONTROL G24010009 Edit 01/24/2024 03/04/2024 200.00 Invoice Transactions 11 $4,860.00 Invoice Transactions 73 $72,244.10 10924 - PETTY CASH - PD 8634 Paid by Check # 133582 01/03/2024 02/09/2024 02/09/2024 15.00 10924 - PETTY CASH - PD 8635 Paid by Check # 133582 01/04/2024 02/09/2024 02/09/2024 30.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001325 Paid by EFT # 3288 01/29/2024 02/16/2024 02/16/2024 445.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001327 Paid by EFT # 3290 01/29/2024 02/16/2024 02/16/2024 515.00 10645 - BRETT KEAG 2024-00001401 Edit 02/07/2024 03/04/2024 25.00 12853 - IAFCI 2024-00001410 Edit 02/02/2024 03/04/2024 350.00 10649 - KENDALL COUNTY CHIEFS OF POLICE ASSN. 1091 Edit 02/02/2024 03/04/2024 17.00 Account 8135 - Contractual Services 06/2023 - 12/2023 Acct. 43155 Account 8135 - Contractual Services Totals Account 8265 - Contractual Services-Wescom Jeka Account 8069 - Bike Unit Totals Account 8267 - Animal Control Totals Division 51 - Police Patrol Totals Division 52 - Police Administration July 2023 August 2023 October 2023 November 2023 December 2023 March 2023 February 2023 April 2023 May 2023 June 2023 March 2024 Account 8265 - Contractual Services-Wescom Totals Account 8267 - Animal Control January 2023 Special Olympics Conference CFCI Exam - Chris Allen Training Account 3000 - Travel/Training Bayless Will County Chief's Meeting McQuaid R. Miller Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 14 of 41 25 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10873 - NORTH EAST MULTI-REGIONAL TRAINING, INC. 344486 Edit 01/22/2024 03/04/2024 450.00 Invoice Transactions 8 $1,847.00 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 21.12 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 21.34 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 4.32 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 4.52 Invoice Transactions 4 $51.30 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 507.36 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 537.64 Invoice Transactions 2 $1,045.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001325 Paid by EFT # 3288 01/29/2024 02/16/2024 02/16/2024 122.78 13340 - PITNEY BOWES - POSTAGE 2024-00001336 Paid by EFT # 3299 02/23/2024 02/23/2024 02/23/2024 101.33 13325 - AMAZON CAPITAL SERVICES 1C7Q-QNYR-7GK7 Edit 02/01/2024 03/04/2024 49.99 10379 - FEDERAL EXPRESS 8-387-22800 Edit 01/24/2024 03/04/2024 20.98 Invoice Transactions 4 $295.08 13325 - AMAZON CAPITAL SERVICES 1D69-TGXR-7G7M Edit 02/01/2024 03/04/2024 164.90 Invoice Transactions 1 $164.90 12131 - POLICE CHIEFS OF WILL COUNTY - MCTF ACCOUNT 2024-00001396 Edit 02/15/2024 03/04/2024 1,000.00 Invoice Transactions 1 $1,000.00 10557 - ILLINOIS TOLLWAY G129000006286 Edit 02/02/2024 03/04/2024 53.79 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 270.00 Invoice Transactions 2 $323.79 13325 - AMAZON CAPITAL SERVICES 1FQC-W9C3-9LFT Edit 02/01/2024 03/04/2024 299.88 11085 - SIRCHIE 0630434-IN Edit 02/07/2024 03/04/2024 114.45 Invoice Transactions 2 $414.33 13450 - DEAN KLIER 2024-00001295 Paid by Check # 133576 01/26/2024 02/09/2024 02/09/2024 150.00 Acct. 1211165 Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Account 4000 - Telephone/Internet Acct. 00114799 Acct. 00114799 Acct. 1211165 Training Account 3000 - Travel/Training Totals January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5040.002 - Crime Scene/Evidence Tech Supply Crime Scene/Evidence Tech Supplies 2024 Dues Account 5015 - Dues & Subscriptions Totals Account 5020 - Gas/Oil/Mileage/Carwash Acct. 8955 Account 5010 - Replacement Supplies Replacement Supplies Account 5010 - Replacement Supplies Totals Account 5015 - Dues & Subscriptions PD Postage Office Supplies PD Account 5005 - Office Supplies/Postage Totals Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage McQuaid Crime Scene/Evidence Tech Supplies Account 5040.002 - Crime Scene/Evidence Tech Supply Totals Account 5095 - Uniforms/Clothing Boot Reimbursement Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 15 of 41 26 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11544 - RUSSELL PRUCHNICKI 2024-00001332 Paid by Check # 133605 02/14/2024 02/21/2024 02/21/2024 150.00 Invoice Transactions 2 $300.00 11291 - WESCOM 20240315 Edit 02/01/2024 03/04/2024 586.56 Invoice Transactions 1 $586.56 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 Invoice Transactions 1 $59.85 12536 - ILLINOIS SECRETARY OF STATE 2024-00001293 Paid by Check # 133578 01/17/2024 02/09/2024 02/09/2024 151.00 11020 - ROD BAKER FORD SALES, INC 41791 Edit 01/30/2024 03/04/2024 11.67 11020 - ROD BAKER FORD SALES, INC 41967 Edit 02/02/2024 03/04/2024 192.47 10394 - FLEET SAFETY SUPPLY 82404 Edit 02/01/2024 03/04/2024 116.46 11689 - FMP 53-468953 Edit 01/30/2024 03/04/2024 159.43 Invoice Transactions 5 $631.03 10569 - INNOVATIVE CREDIT SOLUTIONS, INC. 202312272 Edit 12/01/2023 03/04/2024 75.00 Invoice Transactions 1 $75.00 Invoice Transactions 34 $6,793.84 10591 - ISP ASSET FORFEITURE SECTION 2024-00001334 Paid by Check # 1897 02/15/2024 02/21/2024 02/21/2024 529.00 13173 - TODD'S TOWING & RECOVERY LLC 24-19190 Edit 01/11/2024 03/04/2024 200.00 Invoice Transactions 2 $729.00 Invoice Transactions 2 $729.00 10924 - PETTY CASH - PD 8636 Paid by Check # 133582 01/04/2024 02/09/2024 02/09/2024 30.00 10924 - PETTY CASH - PD 8638 Paid by Check # 133582 02/01/2024 02/09/2024 02/09/2024 30.00 10924 - PETTY CASH - PD 8639 Paid by Check # 133582 02/01/2024 02/09/2024 02/09/2024 30.00 10649 - KENDALL COUNTY CHIEFS OF POLICE ASSN. 1091 Edit 02/02/2024 03/04/2024 17.00 Invoice Transactions 4 $107.00 Account 8060 - Vehicle Maintenance INV6 INV5 INV5 SRO7 Account 8003 - Radio Maintenance Totals Account 8035 - Maintenance Contracts/Lease 01/07/24 - 02/06/24 Account 8035 - Maintenance Contracts/Lease Totals Boot Reimbursement Account 5095 - Uniforms/Clothing Totals Account 8003 - Radio Maintenance March 2024 Will County Chief's Meeting Ostreko,Miller, Zigterman Will County Chief's Meeting Novak Training Account 3000 - Travel/Training Totals Division 54 - Seizure/Forfeiture Totals Division 56 - Police Support Services Account 3000 - Travel/Training Will County Chief's Meeting Novak Account 5012 - Asset Seizure/Forfeiture Expense Case 23-8872 23-7763 Account 5012 - Asset Seizure/Forfeiture Expense Totals Account 8250 - Background Check Services Totals Division 52 - Police Administration Totals Division 54 - Seizure/Forfeiture INV-5 Account 8060 - Vehicle Maintenance Totals Account 8250 - Background Check Services Background Check Services Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 16 of 41 27 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 42.24 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 42.69 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 8.63 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 9.04 Invoice Transactions 4 $102.60 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 126.84 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 128.93 13325 - AMAZON CAPITAL SERVICES 1LR9-97TV-CM97 Edit 02/01/2024 03/04/2024 269.00 Invoice Transactions 3 $524.77 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001326 Paid by EFT # 3289 01/29/2024 02/16/2024 02/16/2024 49.00 13340 - PITNEY BOWES - POSTAGE 2024-00001336 Paid by EFT # 3299 02/23/2024 02/23/2024 02/23/2024 265.87 11278 - WAREHOUSE DIRECT 5659229-0 Edit 02/06/2024 03/04/2024 36.53 12957 - GARVEY'S OFFICE PRODUCTS PINV2528755 Edit 02/02/2024 03/04/2024 5.99 Invoice Transactions 4 $357.39 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 15.00 Invoice Transactions 1 $15.00 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 119.70 Invoice Transactions 1 $119.70 10581 - INT'L CONFERENCE OF POLICE CHAPLAINS 2024-00001296 Paid by Check # 133580 02/07/2024 02/09/2024 02/09/2024 425.00 10581 - INT'L CONFERENCE OF POLICE CHAPLAINS 2024-00001297 Paid by Check # 133580 02/07/2024 02/09/2024 02/09/2024 425.00 10581 - INT'L CONFERENCE OF POLICE CHAPLAINS 2024-00001298 Paid by Check # 133580 02/07/2024 02/09/2024 02/09/2024 195.00 10581 - INT'L CONFERENCE OF POLICE CHAPLAINS 64704 Paid by Check # 133584 02/01/2024 02/12/2024 02/12/2024 125.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001324 Paid by EFT # 3287 01/29/2024 02/16/2024 02/16/2024 58.24 Invoice Transactions 5 $1,228.24 Invoice Transactions 22 $2,454.70 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001322 Paid by EFT # 3285 01/29/2024 02/16/2024 02/16/2024 2,799.29 Account 5020 - Gas/Oil/Mileage/Carwash January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 8035 - Maintenance Contracts/Lease PD Postage Office Supplies Office Supplies Account 5005 - Office Supplies/Postage Totals PD Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Novak Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4000 - Telephone/Internet Acct. 00114799 Acct. 00114799 Acct. 1211165 Acct. 1211165 Kastrantas Division 56 - Police Support Services Totals Division 91 - Capital Account 9120 - Machinery and Equipment Chaplain Seminar-Roach Chaplain Seminar-Beagle Annual Membership Zigterman Account 8266 - Chaplaincy Program Totals 01/07/24 - 02/06/24 Account 8035 - Maintenance Contracts/Lease Totals Account 8266 - Chaplaincy Program Chaplain Seminar-Wisdom Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 17 of 41 28 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11661 - CDS OFFICE TECHNOLOGIES INV1594303 Edit 02/19/2024 03/04/2024 626.97 10297 - DELL MARKETING L.P.10725144810 Edit 01/17/2024 03/04/2024 19,630.60 13122 - INSIGHT PUBLIC SECTOR 1101134302 Edit 02/04/2024 03/04/2024 7,638.00 12668 - SECOND CHANCE CARDIAC SOLUTIONS 24-001-3756 Edit 02/06/2024 03/04/2024 1,498.25 Invoice Transactions 5 $32,193.11 Invoice Transactions 5 $32,193.11 10924 - PETTY CASH - PD 8641 Paid by Check # 133582 02/06/2024 02/09/2024 02/09/2024 7.00 13173 - TODD'S TOWING & RECOVERY LLC 24-19456 Edit 01/18/2024 03/04/2024 175.00 13173 - TODD'S TOWING & RECOVERY LLC 24-19131 Edit 01/08/2024 03/04/2024 225.00 Invoice Transactions 3 $407.00 Invoice Transactions 3 $407.00 Invoice Transactions 179 $128,080.07 10237 - COMCAST 2024-00001335 Paid by EFT # 3293 01/28/2024 02/21/2024 02/21/2024 169.85 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 485.73 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 499.77 10825 - MOTOROLA SOLUTIONS 8168520240102 Edit 02/01/2024 03/04/2024 10.00 Invoice Transactions 4 $1,165.35 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 97.08 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 101.54 Invoice Transactions 2 $198.62 13325 - AMAZON CAPITAL SERVICES 1RL1-YYNJ-9NDV Edit 02/01/2024 03/04/2024 138.69 Invoice Transactions 1 $138.69 12668 - SECOND CHANCE CARDIAC SOLUTIONS 24-001-3802 Edit 02/06/2024 03/04/2024 351.90 Invoice Transactions 1 $351.90 Account 9120 - Machinery and Equipment Totals Division 91 - Capital Totals Division 93 - Contingencies PD Dell Rugged Laptops PD Rugged Brother Printers for Squad Cars Automatic Defibrillator-PD Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Office Supplies February 2024 Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Acct. 485081837-00001 Division 07 - PEMA Program Account 4000 - Telephone/Internet Acct. 8771 01 001 0001526 Acct. 1211165 Acct. 1211165 Division 93 - Contingencies Totals Unit 05 - Police Department Totals Unit 07 - PEMA Account 9300 - Contingencies Golden Radar Plaque 24-353 24-173 Account 9300 - Contingencies Totals Account 5020 - Gas/Oil/Mileage/Carwash Account 5005 - Office Supplies/Postage Totals Account 5010 - Replacement Supplies AED Supplies - PEMA Account 5010 - Replacement Supplies Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 18 of 41 29 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12679 - PLAINFIELD GAS N WASH PLAINFIELD LLC 2024-00001395 Edit 02/07/2024 03/04/2024 30.00 Invoice Transactions 1 $30.00 13017 - HELM SERVICE CHI193927 Edit 11/05/2023 03/04/2024 340.00 Invoice Transactions 1 $340.00 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 Invoice Transactions 1 $59.85 10139 - WEBB CHEVROLET PLAINFIELD 45037814 Edit 01/19/2024 03/04/2024 5.80 Invoice Transactions 1 $5.80 Invoice Transactions 12 $2,290.21 Invoice Transactions 12 $2,290.21 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 1,754.57 13338 - BRAD SHARP 2024-00001400 Edit 02/05/2024 03/04/2024 15.00 11393 - BRIAN FAHNSTROM 2024-00001402 Edit 02/05/2024 03/04/2024 15.00 11534 - CHAD NEWCOMER 2024-00001404 Edit 02/05/2024 03/04/2024 15.00 10460 - JOHN HANNON 2024-00001413 Edit 02/05/2024 03/04/2024 15.00 13277 - JOSE TORRES 2024-00001414 Edit 02/01/2024 03/04/2024 15.00 Invoice Transactions 6 $1,829.57 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 1,174.66 Invoice Transactions 1 $1,174.66 11838 - COMCAST - ACCOUNT #901868063 191960233 Paid by EFT # 3294 01/15/2024 02/21/2024 02/21/2024 1,670.79 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 424.09 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 446.08 Invoice Transactions 3 $2,540.96 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 465.08 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 555.95 Invoice Transactions 2 $1,021.03 Division 07 - PEMA Program Totals Unit 07 - PEMA Totals Unit 08 - Street Department Account 8035 - Maintenance Contracts/Lease Totals Account 8060 - Vehicle Maintenance Vehicle Maintenance Account 8060 - Vehicle Maintenance Totals Check Gas Pressure at PEMA Bldg. Account 8020 - Building Maintenance Totals Account 8035 - Maintenance Contracts/Lease 01/07/24 - 02/06/24 January 2024 Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 8020 - Building Maintenance Acct. 901868063 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Account 3015 - IL Unemployment Insurance 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet I Landscape Show I Landscape Show I Landscape Show Account 3000 - Travel/Training Totals Division 02 - Administration Program Account 3000 - Travel/Training Threewitt I Landscape Show I Landscape Show Account 4005 - Cellular Phones Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 19 of 41 30 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 11.17 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 452.00 12957 - GARVEY'S OFFICE PRODUCTS PINV2534102 Edit 02/15/2024 03/04/2024 34.81 12957 - GARVEY'S OFFICE PRODUCTS PINV2525693 Edit 01/26/2024 03/04/2024 27.39 Invoice Transactions 4 $525.37 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 340.00 Invoice Transactions 1 $340.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 10.00 Invoice Transactions 1 $10.00 10716 - LOWE'S ACCT. #9900 677179 6 2024-00001337 Paid by Check # 133618 02/02/2024 02/23/2024 02/23/2024 75.52 12827 - VARDAL SURVEY SYSTEMS INC.2561 Edit 01/29/2024 03/04/2024 282.00 Invoice Transactions 2 $357.52 12246 - CHEMSTATION CHICAGO LLC 70091450 Edit 01/22/2024 03/04/2024 325.34 10437 - GRAINGER 9949682182 Edit 01/03/2024 03/04/2024 73.12 10585 - INTERSTATE ALL BATTERY CENTER 1915201039276 Edit 01/26/2024 03/04/2024 19.95 10585 - INTERSTATE ALL BATTERY CENTER 1915201039261 Edit 01/25/2024 03/04/2024 161.25 10767 - MENARDS INC. # 3182 35497 Edit 12/19/2023 03/04/2024 14.65 10767 - MENARDS INC. # 3182 36037 Edit 01/04/2024 03/04/2024 22.31 10767 - MENARDS INC. # 3182 36097 Edit 01/05/2024 03/04/2024 2.29 10767 - MENARDS INC. # 3182 35998 Edit 01/03/2024 03/04/2024 11.32 Invoice Transactions 8 $630.23 12300 - SHAW MEDIA 012410084924 Edit 01/31/2024 03/04/2024 264.32 Invoice Transactions 1 $264.32 Invoice Transactions 29 $8,693.66 13013 - AEP ENERGY, INC.2024-00001338 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 14,822.44 13013 - AEP ENERGY, INC.2024-00001339 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 665.55 13013 - AEP ENERGY, INC.2024-00001340 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 40.56 Account 5020 - Gas/Oil/Mileage/Carwash Threewitt Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5040 - Supplies/Hardware Account 5005 - Office Supplies/Postage Totals Account 5015 - Dues & Subscriptions Threewitt Account 5015 - Dues & Subscriptions Totals Account 5005 - Office Supplies/Postage VH Postage Threewitt Office Supplies Office Supplies Account 8050 - Legal Notices Legal Notices Account 8050 - Legal Notices Totals Division 02 - Administration Program Totals Building Maintenance Building Maintenance Building Maintenance Account 8020 - Building Maintenance Totals Building Maintenance Building Maintenance Building Maintenance PW Fire Alarm Building Maintenance Account 9900 677179 6 Supplies Account 5040 - Supplies/Hardware Totals Account 8020 - Building Maintenance Division 60 - Street Maintenance Program Account 4015 - Electricity/Gas Acct. 3013130334 Acct. 3013130211 Acct. 3013130222 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 20 of 41 31 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13013 - AEP ENERGY, INC.2024-00001341 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 292.25 13013 - AEP ENERGY, INC.2024-00001342 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 213.85 13013 - AEP ENERGY, INC.2024-00001343 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 152.87 13013 - AEP ENERGY, INC.2024-00001344 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 120.71 13013 - AEP ENERGY, INC.2024-00001345 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 104.71 13013 - AEP ENERGY, INC.2024-00001346 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 67.33 13013 - AEP ENERGY, INC.2024-00001347 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 155.41 13013 - AEP ENERGY, INC.2024-00001348 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 66.72 13013 - AEP ENERGY, INC.2024-00001349 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 117.26 13013 - AEP ENERGY, INC.2024-00001350 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 272.39 13013 - AEP ENERGY, INC.2024-00001351 Paid by Check # 133616 01/29/2024 02/23/2024 02/23/2024 5,371.77 13013 - AEP ENERGY, INC.2024-00001352 Paid by Check # 133616 01/25/2024 02/23/2024 02/23/2024 149.94 13013 - AEP ENERGY, INC.2024-00001353 Paid by Check # 133616 01/25/2024 02/23/2024 02/23/2024 354.01 13013 - AEP ENERGY, INC.2024-00001354 Paid by Check # 133616 01/25/2024 02/23/2024 02/23/2024 28.47 13013 - AEP ENERGY, INC.2024-00001355 Paid by Check # 133616 12/26/2023 02/23/2024 02/23/2024 351.61 13013 - AEP ENERGY, INC.2024-00001356 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 11.53 13013 - AEP ENERGY, INC.2024-00001357 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 20.52 13013 - AEP ENERGY, INC.2024-00001358 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 108.58 13013 - AEP ENERGY, INC.2024-00001359 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 130.66 13013 - AEP ENERGY, INC.2024-00001360 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 338.75 13013 - AEP ENERGY, INC.2024-00001361 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 317.05 13013 - AEP ENERGY, INC.2024-00001362 Paid by Check # 133616 01/24/2024 02/23/2024 02/23/2024 139.38 13013 - AEP ENERGY, INC.2024-00001363 Paid by Check # 133616 01/24/2024 02/23/2024 02/23/2024 646.65 13013 - AEP ENERGY, INC.2024-00001364 Paid by Check # 133616 01/25/2024 02/23/2024 02/23/2024 733.57 13013 - AEP ENERGY, INC.2024-00001365 Paid by Check # 133616 01/24/2024 02/23/2024 02/23/2024 181.82 13013 - AEP ENERGY, INC.2024-00001366 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 457.55 13013 - AEP ENERGY, INC.2024-00001367 Paid by Check # 133616 01/22/2024 02/23/2024 02/23/2024 62.11 11969 - CONSTELLATION NEW ENERGY, INC 67471780601 Paid by Check # 133617 01/30/2024 02/23/2024 02/23/2024 759.37 10238 - COMED 2024-00001405 Edit 01/23/2024 03/04/2024 2.48 10238 - COMED 2024-00001407 Edit 01/20/2024 03/04/2024 32.91 10238 - COMED 2024-00001408 Edit 01/19/2024 03/04/2024 88.90 10238 - COMED 2024-00001409 Edit 01/19/2024 03/04/2024 47.13 Invoice Transactions 35 $27,426.81 Acct. 3013130255 Acct. 3022648079 Acct. 3022648103 Acct. 3022648080 Acct. 3021356074 Acct. 3013130312 Acct. 3013130356 Acct. 3013130299 Acct. 3013130266 Acct. 30133130277 Acct. 3013130244 Acct. 3013130323 Acct. 3013130301 Acct. 3013130233 Acct. 3013130288 Acct. 2089129057 Acct. 0238143078 Account 4015 - Electricity/Gas Totals Account 5020 - Gas/Oil/Mileage/Carwash Acct. 3022648057 Acct. 3021356007 Acct. 7299263-52952 Acct. 4293072110 Acct. 0721078039 Acct. 3021356029 Acct. 3022648091 Acct. 3022648114 Acct. 3021356074 Acct. 3022648068 Acct. 3021356063 Acct. 3021356041 Acct. 3021356030 Acct. 3021356052 Acct. 3021356018 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 21 of 41 32 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11689 - FMP 50-5013117 Edit 01/10/2024 03/04/2024 72.75 11689 - FMP 53-468767 Edit 01/26/2024 03/04/2024 55.30 11888 - WORLD FUEL SERVICES 5239637-41501 Edit 01/25/2024 03/04/2024 14,270.95 Invoice Transactions 3 $14,399.00 ANTHONY AMERIO 2024-00001330 Paid by Check # 133606 01/31/2024 02/21/2024 02/21/2024 35.00 12763 - BLAIN'S FARM & FLEET 5639 Edit 02/12/2024 03/04/2024 249.00 12763 - BLAIN'S FARM & FLEET 4332 Edit 01/25/2024 03/04/2024 80.58 10185 - CASE LOTS INC.22046 Edit 01/02/2024 03/04/2024 216.95 10437 - GRAINGER 9946743177 Edit 12/28/2023 03/04/2024 52.69 10437 - GRAINGER 9975194706 Edit 01/25/2024 03/04/2024 1,126.58 10767 - MENARDS INC. # 3182 37660 Edit 02/12/2024 03/04/2024 56.43 10767 - MENARDS INC. # 3182 36222 Edit 01/08/2024 03/04/2024 16.22 11058 - SERVICE INDUSTRIAL SUPPLY INC.138079 Edit 01/29/2024 03/04/2024 360.00 13236 - UNIFIRST FIRST AID & SAFETY H851405 Edit 11/16/2023 03/04/2024 28.47 13449 - UNITED RENTALS (NORTH AMERICA), INC. 229534183-001 Edit 01/25/2024 03/04/2024 195.24 13269 - WHITMORE ACE HARDWARE #18556 637856 Edit 02/05/2024 03/04/2024 8.97 Invoice Transactions 12 $2,426.13 10180 - CARGILL INC.-SALT DIVISION 2909058196 Edit 01/23/2024 03/04/2024 1,766.86 10180 - CARGILL INC.-SALT DIVISION 2909141292 Edit 02/06/2024 03/04/2024 7,032.16 10180 - CARGILL INC.-SALT DIVISION 2909119399 Edit 02/02/2024 03/04/2024 28,799.65 10180 - CARGILL INC.-SALT DIVISION 2909133771 Edit 02/05/2024 03/04/2024 24,207.46 10180 - CARGILL INC.-SALT DIVISION 2909112864 Edit 02/01/2024 03/04/2024 8,850.89 12411 - K-TECH SPECIALTY COATINGS INC.202401-K0195 Edit 01/31/2024 03/04/2024 7,722.96 Invoice Transactions 6 $78,379.98 Mechanic's Bay First Aid Supplies Supplies Account 5040 - Supplies/Hardware Totals Supplies Supplies Supplies Supplies Supplies Account 5040 - Supplies/Hardware Mailbox Damage Uniforms & Supplies Supplies Supplies Motor Oil Gas/Oil/Mileage/Carwash Unleaded Fuel Account 5020 - Gas/Oil/Mileage/Carwash Totals Apprvd @ 11/20/23 BM. 23- 24 Cargill Salt Purchase. Beet Heet - 4,569.8 gal @ $1.69/gal Account 5040.003 - Supplies/Hardware-Salt Purchase Totals Account 5040.003 - Supplies/Hardware-Salt Purchase Apprvd @ 11/20/23 BM. 23- 24 Cargill Salt Purchase. Apprvd @ 11/20/23 BM. 23- 24 Cargill Salt Purchase. Apprvd @ 11/20/23 BM. 23- 24 Cargill Salt Purchase. Apprvd @ 11/20/23 BM. 23- 24 Cargill Salt Purchase. Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 22 of 41 33 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13451 - HIGHSTAR TRAFFIC 118068 Edit 02/13/2024 03/04/2024 1,770.70 Invoice Transactions 1 $1,770.70 12826 - ARLAN SCHATTKE 2024-00001399 Edit 02/21/2024 03/04/2024 192.59 12763 - BLAIN'S FARM & FLEET 5639 Edit 02/12/2024 03/04/2024 259.95 11393 - BRIAN FAHNSTROM 2024-00001403 Edit 01/29/2024 03/04/2024 200.00 10218 - CINTAS CORPORATION #344 4183569354 Edit 02/15/2024 03/04/2024 130.52 10218 - CINTAS CORPORATION #344 4182138457 Edit 02/01/2024 03/04/2024 130.52 10218 - CINTAS CORPORATION #344 4181408241 Edit 01/25/2024 03/04/2024 130.52 10218 - CINTAS CORPORATION #344 4182847949 Edit 02/08/2024 03/04/2024 130.52 12728 - GBJ SALES, LLC 5188 Edit 01/12/2024 03/04/2024 129.63 10338 - JACK ECKHORN 2024-00001412 Edit 02/05/2024 03/04/2024 200.00 12479 - MATT RAYMOND 2024-00001416 Edit 02/26/2024 03/04/2024 168.56 Invoice Transactions 10 $1,672.81 10421 - GENUINE PARTS COMPANY 1236-110438 Edit 02/08/2024 03/04/2024 22.19 10421 - GENUINE PARTS COMPANY 1236-109567 Edit 02/01/2024 03/04/2024 4.49 10437 - GRAINGER 9001607929 Edit 01/29/2024 03/04/2024 44.94 10820 - MONROE TRUCK EQUIPMENT, INC.35075 Edit 02/01/2024 03/04/2024 983.16 10953 - PLAINFIELD SIGNS, INC.19400 Edit 01/17/2024 03/04/2024 280.00 12064 - POMP'S TIRE SERVICE, INC.2120018461 Edit 01/24/2024 03/04/2024 719.38 11020 - ROD BAKER FORD SALES, INC 41627 Edit 01/31/2024 03/04/2024 108.38 12229 - RON TIRAPELLI FORD INC 646177 Edit 02/07/2024 03/04/2024 402.96 13269 - WHITMORE ACE HARDWARE #18556 637843 Edit 02/01/2024 03/04/2024 13.15 Invoice Transactions 9 $2,578.65 10441 - GRAYBAR 9335664417 Edit 01/23/2024 03/04/2024 2,211.56 10441 - GRAYBAR 9335664416 Edit 01/23/2024 03/04/2024 4,471.10 13121 - HAPCO POLE PRODUCTS IN0000126491 Edit 10/04/2023 03/04/2024 4,575.00 10760 - MEADE ELECTRIC COMPANY 707599 Edit 02/06/2024 03/04/2024 1,424.82 Uniforms & Supplies Boot Reimbursement Uniforms Uniforms Uniforms Street Sign Maintenance Account 5055 - Street Sign Maintenance Totals Account 5095 - Uniforms/Clothing Boot Reimbursement Account 5055 - Street Sign Maintenance Fuel Island Account 8060 - Vehicle Maintenance Totals Account 8130 - Street/Traffic Light Maintenance Street Light Maintenance 1034 Black/White Vehicle Numbers 1034 3013 Vehicle Maintenance Account 8060 - Vehicle Maintenance Vehicle Maintenance Vehicle Maintenance Vehicle Maintenance Uniforms Uniforms Boot Reimbursement Boot Reimbursement Account 5095 - Uniforms/Clothing Totals Wallin Dr. Replacement Light Fixtures. Blk aluminum lt pole w/ twin foot arms. Orig PO Apprvd FY 22/23. 12918 RIDGE WOOD Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 23 of 41 34 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10760 - MEADE ELECTRIC COMPANY 707600 Edit 02/06/2024 03/04/2024 788.54 10760 - MEADE ELECTRIC COMPANY 707236 Edit 01/31/2024 03/04/2024 1,437.36 11128 - STATE TREASURER 64845 Edit 01/31/2024 03/04/2024 15,179.85 Invoice Transactions 7 $30,088.23 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 10252 - CONTINENTAL WEATHER SERVICE 195619 Edit 02/01/2024 03/04/2024 150.00 12090 - PHYSICIANS IMMEDIATE CARE 2024-00001369 Edit 01/09/2024 03/04/2024 285.00 Invoice Transactions 3 $494.85 10079 - ANTREX, INC.4237 Edit 01/08/2024 03/04/2024 2,478.00 10079 - ANTREX, INC.4232 Edit 12/18/2023 03/04/2024 483.00 13265 - BULLFROG ENTERPRISES 1230 Edit 01/26/2024 03/04/2024 7,104.00 13265 - BULLFROG ENTERPRISES 1231 Edit 01/26/2024 03/04/2024 512.00 13427 - DRY COUNTY ENTERPRISES INC.5976 Edit 01/23/2024 03/04/2024 2,860.50 12683 - I.A.P. CONSTRUCTION SR24-2 Edit 01/26/2024 03/04/2024 30,723.00 12683 - I.A.P. CONSTRUCTION SR24-3 Edit 01/26/2024 03/04/2024 11,711.00 12602 - WINNINGER EXCAVATING INC 24-210 Edit 01/31/2024 03/04/2024 13,943.50 Invoice Transactions 8 $69,815.00 10038 - ALEXANDER EQUIPMENT COMPANY, INC. 203959 Edit 12/29/2023 03/04/2024 807.80 11689 - FMP 53-469436 Edit 02/06/2024 03/04/2024 70.80 10397 - FORCE AMERICA INC.IN001-1792066 Edit 01/10/2024 03/04/2024 200.00 10421 - GENUINE PARTS COMPANY 1236-110159 Edit 02/06/2024 03/04/2024 151.46 10421 - GENUINE PARTS COMPANY 1236-110163 Edit 02/01/2024 03/04/2024 70.08 10585 - INTERSTATE ALL BATTERY CENTER 30904328 Edit 02/08/2024 03/04/2024 139.95 10613 - JIM'S TRUCK INSPECTION & REPAIR 201837 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201828 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201819 Edit 02/09/2024 03/04/2024 65.00 01/06/2024 12/18/2023 01/22/2024 01/24/2024 01/22/24 & 01/23/24 February 2024 06/2023 - 12/2023 Acct. 43155 Account 8135 - Contractual Services Totals Account 8135.004 - Snow Removal 4th Qtr. 2023 Account 8130 - Street/Traffic Light Maintenance Totals Account 8135 - Contractual Services 01/07/24 - 02/06/24 143rd St. Traffic Signal Maintenance Equipment Maintenance 1052 1020 1082 1054 Account 8160 - Equipment Maintenance 1050 Mowers 1074 Equipment Maintenance 01/06, 01/09, 01/12, 01/13 & 01/14/2024 01/18, 01/19, 01/22, & 01/24/2024 01/22, 01/23 & 01/24/2024 Account 8135.004 - Snow Removal Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 24 of 41 35 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10613 - JIM'S TRUCK INSPECTION & REPAIR 201823 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201814 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201816 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201815 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201853 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201835 Edit 02/09/2024 03/04/2024 43.00 10613 - JIM'S TRUCK INSPECTION & REPAIR 201840 Edit 02/09/2024 03/04/2024 43.00 12393 - JX ENTERPRISES, INC.2542885S Edit 02/05/2024 03/04/2024 3,248.25 12393 - JX ENTERPRISES, INC.22280773P Edit 01/31/2024 03/04/2024 115.98 12393 - JX ENTERPRISES, INC.25284485P Edit 01/24/2024 03/04/2024 425.92 12393 - JX ENTERPRISES, INC.2542449S Edit 12/28/2023 03/04/2024 955.96 13222 - MCCULLOUGH IMPLEMENT COMPANY P06472 Edit 02/12/2024 03/04/2024 2,453.81 13222 - MCCULLOUGH IMPLEMENT COMPANY P06333 Edit 01/24/2024 03/04/2024 711.16 12064 - POMP'S TIRE SERVICE, INC.2120018621 Edit 01/29/2024 03/04/2024 579.45 11028 - RUSSO POWER EQUIPMENT SPI20501998 Edit 02/01/2024 03/04/2024 297.98 11075 - SHOREWOOD HOME & AUTO, INC.01-400128 Edit 02/09/2024 03/04/2024 123.72 11118 - STANDARD EQUIPMENT CO.P47959 Edit 02/06/2024 03/04/2024 1,071.85 11118 - STANDARD EQUIPMENT CO.P47124 Edit 12/05/2023 03/04/2024 113.84 13173 - TODD'S TOWING & RECOVERY LLC 24-19590 Edit 01/25/2024 03/04/2024 175.00 12010 - TRANSCHICAGO TRUCK GROUP X102204985:01 Edit 11/15/2023 03/04/2024 344.86 12010 - TRANSCHICAGO TRUCK GROUP X102205863:01 Edit 11/16/2023 03/04/2024 (344.86) 12010 - TRANSCHICAGO TRUCK GROUP X101436207:01 Edit 12/22/2023 03/04/2024 451.39 12010 - TRANSCHICAGO TRUCK GROUP X101416923:01 Edit 11/13/2023 03/04/2024 70.00 12010 - TRANSCHICAGO TRUCK GROUP X101232999:01 Edit 11/16/2022 03/04/2024 (585.00) 12010 - TRANSCHICAGO TRUCK GROUP X101433785:01 Edit 12/18/2023 03/04/2024 92.98 12010 - TRANSCHICAGO TRUCK GROUP X102214079:01 Edit 12/20/2023 03/04/2024 51.92 12010 - TRANSCHICAGO TRUCK GROUP X102210275:01 Edit 12/06/2023 03/04/2024 7.84 11298 - WEST SIDE TRACTOR SALES J11641 Edit 02/13/2024 03/04/2024 818.26 11298 - WEST SIDE TRACTOR SALES J11244 Edit 01/29/2024 03/04/2024 917.62 13269 - WHITMORE ACE HARDWARE #18556 637869 Edit 02/08/2024 03/04/2024 10.76 1074 1084 1067 1034 1073 1067 1022 1067 Equipment Maintenance 1067 Equipment Maintenance 1052 1052 1068 1067 1015 Mowers 1068 1065 Snow Equipment 1079 1007 1075 1074 1074 1067 1033 1043 1065 1052 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 25 of 41 36 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11323 - WINTER EQUIPMENT CO., INC.IV58493 Edit 01/29/2024 03/04/2024 8,775.50 Invoice Transactions 40 $22,776.28 Invoice Transactions 134 $251,828.44 10767 - MENARDS INC. # 3182 37131 Edit 01/30/2024 03/04/2024 2.99 Invoice Transactions 1 $2.99 Invoice Transactions 1 $2.99 12763 - BLAIN'S FARM & FLEET 4361 Edit 01/26/2024 03/04/2024 52.97 11028 - RUSSO POWER EQUIPMENT SPI20507613 Edit 02/12/2024 03/04/2024 480.82 Invoice Transactions 2 $533.79 Invoice Transactions 2 $533.79 Invoice Transactions 166 $261,058.88 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 227.69 Invoice Transactions 1 $227.69 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 57.60 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 58.21 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 46.19 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 48.36 Invoice Transactions 4 $210.36 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 84.56 Invoice Transactions 1 $84.56 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 11.17 11278 - WAREHOUSE DIRECT IN524111 Edit 01/31/2024 03/04/2024 46.05 Invoice Transactions 2 $57.22 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 Invoice Transactions 1 $59.85 Supplies Account 5040 - Supplies/Hardware Totals Division 62 - Forestry Program Totals Division 61 - Snow and Ice Removal Program Totals Division 62 - Forestry Program Account 5040 - Supplies/Hardware Supplies Division 61 - Snow and Ice Removal Program Account 5040 - Supplies/Hardware Supplies Account 5040 - Supplies/Hardware Totals 5 Cutting Edge Kits and 2 Curb Shoes for PW Plow Trucks. Account 8160 - Equipment Maintenance Totals Division 60 - Street Maintenance Program Totals VH Postage Office Supplies Account 5005 - Office Supplies/Postage Totals Account 8035 - Maintenance Contracts/Lease Account 4005 - Cellular Phones Acct. 485081837-00001 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Acct. 00114799 Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Acct. 00114799 Unit 08 - Street Department Totals Unit 09 - Community Development Division 20 - Planning Program Account 3015 - IL Unemployment Insurance 01/07/24 - 02/06/24 Account 8035 - Maintenance Contracts/Lease Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 26 of 41 37 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10953 - PLAINFIELD SIGNS, INC.19235 Edit 09/29/2023 03/04/2024 470.00 10953 - PLAINFIELD SIGNS, INC.19438 Edit 02/14/2024 03/04/2024 705.00 12300 - SHAW MEDIA 012410084924 Edit 01/31/2024 03/04/2024 264.16 Invoice Transactions 3 $1,439.16 13346 - RYAN, LLC 810442 Edit 11/07/2023 03/04/2024 1,015.00 13315 - WGI, INC.14949 Edit 12/11/2023 03/04/2024 6,684.75 13315 - WGI, INC.15834 Edit 01/11/2024 03/04/2024 336.47 Invoice Transactions 3 $8,036.22 12090 - PHYSICIANS IMMEDIATE CARE 2024-00001369 Edit 01/09/2024 03/04/2024 180.00 Invoice Transactions 1 $180.00 10131 - BAXTER & WOODMAN 0255080 Edit 01/24/2024 03/04/2024 57.50 Invoice Transactions 1 $57.50 Invoice Transactions 17 $10,352.56 12949 - ROBERT STERIOTI 2024-00001289 Paid by Check # 133583 01/31/2024 02/09/2024 02/09/2024 263.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001323 Paid by EFT # 3286 01/29/2024 02/16/2024 02/16/2024 671.80 13445 - IAN BURGIN 2024-00001411 Edit 02/17/2024 03/04/2024 240.00 10580 - INTERNATIONAL CODE COUNCIL, INC. 1001826943 Edit 02/05/2024 03/04/2024 168.50 Invoice Transactions 4 $1,343.30 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 408.37 Invoice Transactions 1 $408.37 12983 - FIRST COMMUNICATIONS LLC 126212449 Paid by EFT # 3295 01/06/2024 02/21/2024 02/21/2024 19.22 12983 - FIRST COMMUNICATIONS LLC 126317498 Paid by EFT # 3295 02/06/2024 02/21/2024 02/21/2024 19.42 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 15.40 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 16.12 NEC 135th & Rte. 30 Account 8225 - Engineering Fees Totals Division 20 - Planning Program Totals Account 8135 - Contractual Services 06/2023 - 12/2023 Acct. 43155 Account 8135 - Contractual Services Totals Account 8225 - Engineering Fees Des Plaines St. Project Parking Study Board Approved 06/05/2023 Parking Study Board Approved 06/05/2023 Account 8097 - Special Projects and Programs Totals Public Notice Signs Legal Notices Account 8050 - Legal Notices Totals Account 8097 - Special Projects and Programs Account 8050 - Legal Notices Public Notice Signs Acct. 1211165 Acct. 1211165 Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Acct. 00114799 Acct. 00114799 Training Account 3000 - Travel/Training Totals Account 3015 - IL Unemployment Insurance 1st Qtr. 2024 Unemployment Insurance Division 21 - Building Program Account 3000 - Travel/Training ICC Study Guide & Exam Spires Training Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 27 of 41 38 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 4 $70.16 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 253.68 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 133.00 Invoice Transactions 2 $386.68 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 11.17 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001323 Paid by EFT # 3286 01/29/2024 02/16/2024 02/16/2024 39.23 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 135.01 12957 - GARVEY'S OFFICE PRODUCTS PINV2526918 Edit 01/30/2024 03/04/2024 35.93 12957 - GARVEY'S OFFICE PRODUCTS PINV2534102 Edit 02/15/2024 03/04/2024 34.82 12957 - GARVEY'S OFFICE PRODUCTS PINV2525693 Edit 01/26/2024 03/04/2024 27.38 Invoice Transactions 6 $283.54 13209 - RODOLFO RAMIREZ 2024-00001422 Edit 02/18/2024 03/04/2024 124.76 Invoice Transactions 1 $124.76 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 12090 - PHYSICIANS IMMEDIATE CARE 2024-00001369 Edit 01/09/2024 03/04/2024 221.00 Invoice Transactions 2 $280.85 Invoice Transactions 20 $2,897.66 Invoice Transactions 37 $13,250.22 Invoice Transactions 526 $1,338,199.04 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 5,237.63 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 5,179.57 Invoice Transactions 2 $10,417.20 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 3,471.97 Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Account 8135 - Contractual Services Totals Division 21 - Building Program Totals Unit 09 - Community Development Totals Account 5095 - Uniforms/Clothing Totals Account 8135 - Contractual Services 01/07/24 - 02/06/24 06/2023 - 12/2023 Acct. 43155 Office Supplies Account 5005 - Office Supplies/Postage Totals Account 5095 - Uniforms/Clothing Boot Reimbursement VH Postage Spires Threewitt Building Office Supplies Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage FED INCOME TAX - Federal Income Tax* Account 0210.220 - Federal W/H Payable Totals Account 0210.222 - FICA Payable FED INCOME TAX - Federal Income Tax* Fund 01 - General Fund Totals Fund 02 - Water and Sewer Fund Account 0210.220 - Federal W/H Payable FED INCOME TAX - Federal Income Tax* Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 28 of 41 39 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 3,474.18 Invoice Transactions 2 $6,946.15 10578 - INTERNAL REVENUE SERVICE 2024-00001305 Paid by Check # 133590 02/16/2024 02/16/2024 02/16/2024 811.99 10578 - INTERNAL REVENUE SERVICE 2024-00001383 Paid by Check # 133623 03/01/2024 03/01/2024 03/01/2024 812.52 Invoice Transactions 2 $1,624.51 10527 - ILL MUNICIPAL RETIREMENT REGULAR 2024-00001303 Paid by Check # 133588 02/16/2024 02/16/2024 02/16/2024 17,123.39 Invoice Transactions 1 $17,123.39 10774 - METLIFE 2024-00001306 Paid by Check # 133591 02/16/2024 02/16/2024 02/16/2024 409.95 10315 - DIVERSIFIED INVESTMENT ADVISORS 2024-00001301 Paid by Check # 133586 02/16/2024 02/16/2024 02/16/2024 1,622.22 13243 - MISSION SQUARE 2024-00001308 Paid by Check # 133593 02/16/2024 02/16/2024 02/16/2024 757.55 13243 - MISSION SQUARE 2024-00001385 Paid by Check # 133625 03/01/2024 03/01/2024 03/01/2024 749.96 10315 - DIVERSIFIED INVESTMENT ADVISORS 2024-00001380 Paid by Check # 133620 03/01/2024 03/01/2024 03/01/2024 1,551.20 10774 - METLIFE 2024-00001384 Paid by Check # 133624 03/01/2024 03/01/2024 03/01/2024 434.07 Invoice Transactions 6 $5,524.95 11244 - UNITED WAY OF WILL COUNTY 2024-00001312 Paid by Check # 133597 02/16/2024 02/16/2024 02/16/2024 1.34 11244 - UNITED WAY OF WILL COUNTY 2024-00001389 Paid by Check # 133629 03/01/2024 03/01/2024 03/01/2024 1.34 Invoice Transactions 2 $2.68 10030 - AFLAC 2024-00001300 Paid by Check # 133585 02/16/2024 02/16/2024 02/16/2024 30.49 Account 0210.237 - IMRF Payable Totals Account 0210.241 - Deferred Comp. Plan 457-METLIFE-PCT - Deferred Comp Metlife 457-IPPFA-PCT - Deferred Comp IPPFA* FED INCOME TAX - Federal Income Tax* Account 0210.223 - Medicare W/H Payable Totals Account 0210.237 - IMRF Payable IMRF - Illinois Municipal Retirement * FED INCOME TAX - Federal Income Tax* Account 0210.222 - FICA Payable Totals Account 0210.223 - Medicare W/H Payable FED INCOME TAX - Federal Income Tax* Account 0210.244 - AFLAC Pre-Tax AFLAC - PRETAX - AFLAC Pretax* Account 0210.243 - United Way Donations UNITED WAY - United Way of Will County UNITED WAY - United Way of Will County Account 0210.243 - United Way Donations Totals 457-ICMA-FLAT - Deferred Comp ICMA* 457-ICMA-FLAT - Deferred Comp ICMA* 457-IPPFA-PCT - Deferred Comp IPPFA* 457-METLIFE-PCT - Deferred Comp Metlife Account 0210.241 - Deferred Comp. Plan Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 29 of 41 40 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10030 - AFLAC 2024-00001379 Paid by Check # 133619 03/01/2024 03/01/2024 03/01/2024 30.49 Invoice Transactions 2 $60.98 10030 - AFLAC 2024-00001300 Paid by Check # 133585 02/16/2024 02/16/2024 02/16/2024 21.85 10030 - AFLAC 2024-00001379 Paid by Check # 133619 03/01/2024 03/01/2024 03/01/2024 21.85 Invoice Transactions 2 $43.70 11124 - STATE DISBURSEMENT UNIT 2024-00001311 Paid by Check # 133596 02/16/2024 02/16/2024 02/16/2024 336.46 11124 - STATE DISBURSEMENT UNIT 2024-00001388 Paid by Check # 133628 03/01/2024 03/01/2024 03/01/2024 336.46 Invoice Transactions 2 $672.92 11266 - VILLAGE OF PLAINFIELD 2024-00001313 Paid by Check # 133598 02/16/2024 02/16/2024 02/16/2024 229.26 11266 - VILLAGE OF PLAINFIELD 2024-00001390 Paid by Check # 133630 03/01/2024 03/01/2024 03/01/2024 229.26 Invoice Transactions 2 $458.52 10854 - NCPERS GROUP LIFE INS.2024-00001309 Paid by Check # 133594 02/16/2024 02/16/2024 02/16/2024 16.00 10854 - NCPERS GROUP LIFE INS.2024-00001386 Paid by Check # 133626 03/01/2024 03/01/2024 03/01/2024 16.00 Invoice Transactions 2 $32.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 1,050.00 Invoice Transactions 1 $1,050.00 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 298.31 Invoice Transactions 1 $298.31 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 50.89 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 53.53 Account 0210.245 - AFLAC Post-Tax AFLAC - PRETAX - AFLAC Pretax* AFLAC - PRETAX - AFLAC Pretax* Account 0210.245 - AFLAC Post-Tax Totals AFLAC - PRETAX - AFLAC Pretax* Account 0210.244 - AFLAC Pre-Tax Totals Unit 10 - Water Department Division 02 - Administration Program Account 3000 - Travel/Training Threewitt Account 3000 - Travel/Training Totals Account 0210.301 - Employee Life Insurance SUP LIFE INS - NCPERS SUP LIFE INS - NCPERS Account 0210.301 - Employee Life Insurance Totals Account 0210.249 - Flex 125-FSA FSA MED PT - Flex Spending - WEX* FSA MED PT - Flex Spending - WEX* Account 0210.249 - Flex 125-FSA Totals Account 0210.246 - Child Support/Maintenance Assignment CHILD SUPPORT - Child Support Wage Assignment* CHILD SUPPORT - Child Support Wage Assignment* Account 0210.246 - Child Support/Maintenance Assignment Totals Acct. 1211165 Acct. 1211165 Account 3015 - IL Unemployment Insurance 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 30 of 41 41 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 2 $104.42 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 255.66 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 308.98 Invoice Transactions 2 $564.64 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 222.08 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 135.01 12957 - GARVEY'S OFFICE PRODUCTS PINV2534102 Edit 02/15/2024 03/04/2024 34.82 12957 - GARVEY'S OFFICE PRODUCTS PINV2525693 Edit 01/26/2024 03/04/2024 27.38 11318 - WILL COUNTY RECORDER 2024-00001372 Edit 02/01/2024 03/04/2024 156.00 13325 - AMAZON CAPITAL SERVICES 1QP4-7DHL-799W Edit 02/01/2024 03/04/2024 5.45 Invoice Transactions 6 $580.74 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 255.00 Invoice Transactions 1 $255.00 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 10.00 Invoice Transactions 1 $10.00 13128 - 119TH STREET MATERIALS LLC 108385 Edit 01/27/2024 03/04/2024 183.85 Invoice Transactions 1 $183.85 12682 - CORE & MAIN LP U291620 Edit 01/31/2024 03/04/2024 26,910.00 12682 - CORE & MAIN LP U273983 Edit 01/26/2024 03/04/2024 3,116.00 Invoice Transactions 2 $30,026.00 12246 - CHEMSTATION CHICAGO LLC 70091450 Edit 01/22/2024 03/04/2024 325.35 10437 - GRAINGER 9949682182 Edit 01/03/2024 03/04/2024 73.11 10767 - MENARDS INC. # 3182 35998 Edit 01/03/2024 03/04/2024 11.33 Invoice Transactions 3 $409.79 12648 - QUICK LANE TIRE & AUTO CENTER F2CB90405 Edit 01/31/2024 03/04/2024 67.94 Invoice Transactions 1 $67.94 VH Postage Threewitt Office Supplies Office Supplies 01/08/24 - 01/18/24 Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Building Maintenance Building Maintenance Building Maintenance Account 8020 - Building Maintenance Totals Water Meters Water Meters Account 5080 - Water Meters Totals Account 8020 - Building Maintenance Account 5075 - Sand & Gravel Stone Account 5075 - Sand & Gravel Totals Account 5080 - Water Meters Account 5015 - Dues & Subscriptions Totals Account 5020 - Gas/Oil/Mileage/Carwash Threewitt Account 5020 - Gas/Oil/Mileage/Carwash Totals VH Account 5005 - Office Supplies/Postage Totals Account 5015 - Dues & Subscriptions Threewitt Account 8060 - Vehicle Maintenance 1010 Account 8060 - Vehicle Maintenance Totals Account 8135 - Contractual Services Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 31 of 41 42 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13237 - OLD NATIONAL BANK - LOCKBOX 2024-00001374 Paid by EFT # 126 01/31/2024 02/14/2024 02/14/2024 146.70 12201 - VANCO SERVICES 00014161441 Paid by EFT # 3277 02/01/2024 02/15/2024 02/15/2024 236.53 11838 - COMCAST - ACCOUNT #901868063 191960233 Paid by EFT # 3294 01/15/2024 02/21/2024 02/21/2024 1,670.79 12922 - M.E. SIMPSON CO., INC.41182 Edit 10/05/2023 03/04/2024 175.00 12922 - M.E. SIMPSON CO., INC.41169 Edit 10/04/2023 03/04/2024 175.00 11192 - THIRD MILLENNIUM ASSOCIATES, INC. 30978 Edit 01/31/2024 03/04/2024 1,111.13 Invoice Transactions 6 $3,515.15 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001319 Paid by EFT # 3282 01/31/2024 02/07/2024 02/07/2024 109.62 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001320 Paid by EFT # 3283 01/31/2024 02/07/2024 02/07/2024 2,806.12 Invoice Transactions 2 $2,915.74 10131 - BAXTER & WOODMAN 0253762 Edit 12/18/2023 03/04/2024 527.50 10131 - BAXTER & WOODMAN 0254102 Edit 12/21/2023 03/04/2024 437.50 10131 - BAXTER & WOODMAN 0253761 Edit 12/18/2023 03/04/2024 100.00 Invoice Transactions 3 $1,065.00 Invoice Transactions 32 $41,046.58 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 84.82 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 89.22 Invoice Transactions 2 $174.04 11969 - CONSTELLATION NEW ENERGY, INC 67471780601 Paid by Check # 133617 01/30/2024 02/23/2024 02/23/2024 23,787.61 10868 - NICOR 2024-00001419 Edit 01/24/2024 03/04/2024 150.07 10868 - NICOR 2024-00001421 Edit 01/24/2024 03/04/2024 277.51 Invoice Transactions 3 $24,215.19 11190 - UPS STORE 2024-00001377 Edit 02/06/2024 03/04/2024 102.84 11190 - UPS STORE 2024-00001378 Edit 02/05/2024 03/04/2024 107.61 Invoice Transactions 2 $210.45 Utilities Web January 2024 Account 8135.008 - Settlement Charges Totals Account 8225 - Engineering Fees Mill St. Water Tower February 2024 Account 8135 - Contractual Services Totals Account 8135.008 - Settlement Charges Utilities January 2024 January 2024 Lock Box Fees January 2024 Acct. 901868063 Sensus Water Meter Test Sensus Water Meter Test Account 5005 - Office Supplies/Postage Illinois EPA Shipment Illinois EPA Shipment Account 5005 - Office Supplies/Postage Totals Account 4015 - Electricity/Gas Acct. 7299263-52952 Acct. 84403020005 Acct. 20521933950 Account 4015 - Electricity/Gas Totals Division 30 - Water Distribution Program Account 4000 - Telephone/Internet Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Water & Sanitary Assistance 2022 IDNR LMO2 Assistance Account 8225 - Engineering Fees Totals Division 02 - Administration Program Totals Account 5010 - Replacement Supplies Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 32 of 41 43 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10756 - MCMASTER-CARR 21071241 Edit 01/26/2024 03/04/2024 472.30 Invoice Transactions 1 $472.30 11689 - FMP 50-5013117 Edit 01/10/2024 03/04/2024 72.75 11689 - FMP 53-468767 Edit 01/26/2024 03/04/2024 55.29 Invoice Transactions 2 $128.04 10185 - CASE LOTS INC.22046 Edit 01/02/2024 03/04/2024 216.94 10437 - GRAINGER 9946743177 Edit 12/28/2023 03/04/2024 52.68 10767 - MENARDS INC. # 3182 36909 Edit 01/24/2024 03/04/2024 7.97 Invoice Transactions 3 $277.59 12728 - GBJ SALES, LLC 5188 Edit 01/12/2024 03/04/2024 129.64 Invoice Transactions 1 $129.64 10437 - GRAINGER 9012352291 Edit 02/07/2024 03/04/2024 42.81 Invoice Transactions 1 $42.81 10421 - GENUINE PARTS COMPANY 1236-110438 Edit 02/08/2024 03/04/2024 22.19 10666 - K & M TIRE 14753544 Edit 01/27/2024 03/04/2024 473.36 12229 - RON TIRAPELLI FORD INC 646177 Edit 02/07/2024 03/04/2024 402.97 Invoice Transactions 3 $898.52 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 10760 - MEADE ELECTRIC COMPANY 707598 Edit 02/06/2024 03/04/2024 360.35 Invoice Transactions 2 $420.20 10063 - AMERICAN WATER 4000276447 Edit 02/02/2024 03/04/2024 852,325.38 10063 - AMERICAN WATER 4000276426 Edit 02/02/2024 03/04/2024 32,409.17 Invoice Transactions 2 $884,734.55 10767 - MENARDS INC. # 3182 36653 Edit 01/18/2024 03/04/2024 88.47 13449 - UNITED RENTALS (NORTH AMERICA), INC. 229702946-001 Edit 02/01/2024 03/04/2024 782.00 11253 - USABLUEBOOK INV00270252 Edit 02/07/2024 03/04/2024 441.56 Invoice Transactions 3 $1,312.03 11772 - POLLARDWATER 0254618 Edit 01/26/2024 03/04/2024 1,153.13 Building Maintenance Account 8020 - Building Maintenance Totals Account 8060 - Vehicle Maintenance Vehicle Maintenance Account 5095 - Uniforms/Clothing Uniforms Account 5095 - Uniforms/Clothing Totals Account 8020 - Building Maintenance Supplies Supplies Supplies Account 5040 - Supplies/Hardware Totals Motor Oil Gas/Oil/Mileage/Carwash Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5040 - Supplies/Hardware Replacement Supplies Account 5010 - Replacement Supplies Totals Account 5020 - Gas/Oil/Mileage/Carwash Account 8185 - System Maintenance System Maintenance Equipment Maintenance Equipment Maintenance Equipment Maintenance Account 8160 - Equipment Maintenance Totals January 2024 Lake Michigan Water Account 8135.003 - Lake Michigan Water Purchase Totals Account 8160 - Equipment Maintenance 01/07/24 - 02/06/24 Ridge & Plainfield Roads Account 8135 - Contractual Services Totals Account 8135.003 - Lake Michigan Water Purchase 1087 Vehicle Maintenance Account 8060 - Vehicle Maintenance Totals Account 8135 - Contractual Services Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 33 of 41 44 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 1 $1,153.13 11240 - UNDERGROUND PIPE & VALVE CO 064980 Edit 01/31/2024 03/04/2024 120.00 11240 - UNDERGROUND PIPE & VALVE CO 065036 Edit 02/08/2024 03/04/2024 975.00 Invoice Transactions 2 $1,095.00 11864 - ETP LABS INC 24-137105 Edit 01/25/2024 03/04/2024 240.00 13140 - MICROBAC LABORATORIES INC.C24001008 Edit 02/12/2024 03/04/2024 679.50 13140 - MICROBAC LABORATORIES INC.C24000167 Edit 01/08/2024 03/04/2024 709.25 13140 - MICROBAC LABORATORIES INC.C24000393 Edit 01/19/2024 03/04/2024 671.50 Invoice Transactions 4 $2,300.25 Invoice Transactions 32 $917,563.74 Invoice Transactions 64 $958,610.32 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 600.00 Invoice Transactions 1 $600.00 10391 - FIRST NONPROFIT UNEMPLOYMENT PROGRAM 2024-00001286 Paid by Check # 133574 01/01/2024 02/07/2024 02/08/2024 263.79 Invoice Transactions 1 $263.79 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 50.89 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 53.53 Invoice Transactions 2 $104.42 11262 - VERIZON WIRELESS 9954787634 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 255.65 11262 - VERIZON WIRELESS 9954787635 Paid by EFT # 3297 01/21/2024 02/21/2024 02/21/2024 46.89 Invoice Transactions 2 $302.54 13340 - PITNEY BOWES - POSTAGE 2024-00001299 Paid by EFT # 3276 02/09/2024 02/09/2024 02/09/2024 222.08 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 135.00 12957 - GARVEY'S OFFICE PRODUCTS PINV2534102 Edit 02/15/2024 03/04/2024 34.82 12957 - GARVEY'S OFFICE PRODUCTS PINV2525693 Edit 01/26/2024 03/04/2024 27.38 Account 8185 - System Maintenance Totals Account 8194 - Water/Fire Hydrant Account 3015 - IL Unemployment Insurance 1st Qtr. 2024 Unemployment Insurance Account 3015 - IL Unemployment Insurance Totals Account 4000 - Telephone/Internet Unit 11 - Sewer Department Division 02 - Administration Program Account 3000 - Travel/Training Threewitt Account 3000 - Travel/Training Totals Division 30 - Water Distribution Program Totals Unit 10 - Water Department Totals New Construction Coliform Totals EPA Analytical EPA Analytical EPA Analytical Account 8200 - EPA Analytical Totals Mallard Drive Water/Fire Hydrant Account 8194 - Water/Fire Hydrant Totals Account 8200 - EPA Analytical VH Postage Threewitt Office Supplies Office Supplies Acct. 485081837-00001 Acct. 485081837-00002 Account 4005 - Cellular Phones Totals Account 5005 - Office Supplies/Postage Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Account 4005 - Cellular Phones Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 34 of 41 45 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 12957 - GARVEY'S OFFICE PRODUCTS PINV2524981 Edit 01/25/2024 03/04/2024 75.91 13325 - AMAZON CAPITAL SERVICES 1QP4-7DHL-799W Edit 02/01/2024 03/04/2024 5.45 Invoice Transactions 6 $500.64 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 85.00 11845 - ILLINOIS CENTRAL RAILROAD COMPANY 91725343 Edit 02/07/2024 03/04/2024 433.41 Invoice Transactions 2 $518.41 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 10.00 Invoice Transactions 1 $10.00 12246 - CHEMSTATION CHICAGO LLC 70091450 Edit 01/22/2024 03/04/2024 325.45 10437 - GRAINGER 9949682182 Edit 01/03/2024 03/04/2024 73.13 13017 - HELM SERVICE CHI194490 Edit 12/10/2023 03/04/2024 1,760.00 10767 - MENARDS INC. # 3182 35998 Edit 01/03/2024 03/04/2024 11.33 12585 - NEUCO INC 7388802 Edit 12/27/2023 03/04/2024 318.72 12585 - NEUCO INC 7359682 Edit 12/15/2023 03/04/2024 473.55 Invoice Transactions 6 $2,962.18 13237 - OLD NATIONAL BANK - LOCKBOX 2024-00001374 Paid by EFT # 126 01/31/2024 02/14/2024 02/14/2024 146.66 12201 - VANCO SERVICES 00014161441 Paid by EFT # 3277 02/01/2024 02/15/2024 02/15/2024 236.60 11838 - COMCAST - ACCOUNT #901868063 191960233 Paid by EFT # 3294 01/15/2024 02/21/2024 02/21/2024 1,670.79 11192 - THIRD MILLENNIUM ASSOCIATES, INC. 30978 Edit 01/31/2024 03/04/2024 1,111.46 Invoice Transactions 4 $3,165.51 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001319 Paid by EFT # 3282 01/31/2024 02/07/2024 02/07/2024 109.65 12725 - AUTOMATED MERCHANT SYSTEMS INC 2024-00001320 Paid by EFT # 3283 01/31/2024 02/07/2024 02/07/2024 2,806.96 Invoice Transactions 2 $2,916.61 10131 - BAXTER & WOODMAN 0253773 Edit 12/18/2023 03/04/2024 671.25 Invoice Transactions 1 $671.25 Invoice Transactions 28 $12,015.35 VH Account 5005 - Office Supplies/Postage Totals Account 5015 - Dues & Subscriptions Threewitt Office Supplies Account 8135 - Contractual Services January 2024 Lock Box Fees January 2024 Acct. 901868063 Wastewater Building Maintenance Wastewater Wastewater Heaters Account 8020 - Building Maintenance Totals Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 8020 - Building Maintenance Building Maintenance Building Maintenance Dues Account 5015 - Dues & Subscriptions Totals Account 5020 - Gas/Oil/Mileage/Carwash Threewitt Account 8225 - Engineering Fees Totals Division 02 - Administration Program Totals Division 40 - Sewer Treatment Program Utilities Web January 2024 Account 8135.008 - Settlement Charges Totals Account 8225 - Engineering Fees Sludge Permit Renewal February 2024 Account 8135 - Contractual Services Totals Account 8135.008 - Settlement Charges Utilities January 2024 Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 35 of 41 46 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 13154 - PEERLESS NETWORK, INC.42082 Paid by EFT # 3296 01/15/2024 02/21/2024 02/21/2024 84.82 13154 - PEERLESS NETWORK, INC.44350 Paid by EFT # 3296 02/15/2024 02/21/2024 02/21/2024 89.20 Invoice Transactions 2 $174.02 11969 - CONSTELLATION NEW ENERGY, INC 67471780601 Paid by Check # 133617 01/30/2024 02/23/2024 02/23/2024 53,830.38 10868 - NICOR 2024-00001417 Edit 01/23/2024 03/04/2024 149.55 10868 - NICOR 2024-00001420 Edit 01/24/2024 03/04/2024 3,376.34 Invoice Transactions 3 $57,356.27 13269 - WHITMORE ACE HARDWARE #18556 637878 Edit 02/08/2024 03/04/2024 51.17 Invoice Transactions 1 $51.17 11689 - FMP 50-5013117 Edit 01/10/2024 03/04/2024 72.75 11689 - FMP 53-468767 Edit 01/26/2024 03/04/2024 55.31 Invoice Transactions 2 $128.06 10185 - CASE LOTS INC.22046 Edit 01/02/2024 03/04/2024 217.01 10392 - FISHER SCIENTIFIC 9560746 Edit 02/01/2024 03/04/2024 339.45 10437 - GRAINGER 9946743177 Edit 12/28/2023 03/04/2024 52.70 10437 - GRAINGER 9009696643 Edit 02/05/2024 03/04/2024 204.14 10767 - MENARDS INC. # 3182 37163 Edit 01/31/2024 03/04/2024 117.39 10767 - MENARDS INC. # 3182 37458 Edit 02/07/2024 03/04/2024 58.70 10767 - MENARDS INC. # 3182 37098 Edit 01/29/2024 03/04/2024 56.94 Invoice Transactions 7 $1,046.33 10037 - ALEXANDER CHEMICAL CORPORATION 76892 Edit 01/23/2024 03/04/2024 4,991.18 12642 - NCL OF WISCONSIN INC.499199 Edit 02/05/2024 03/04/2024 666.31 11253 - USABLUEBOOK INV00264267 Edit 02/01/2024 03/04/2024 333.20 11253 - USABLUEBOOK INV00270826 Edit 02/08/2024 03/04/2024 110.80 Invoice Transactions 4 $6,101.49 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 180826 Edit 01/16/2024 03/04/2024 78.00 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 180949 Edit 01/23/2024 03/04/2024 78.00 Account 4015 - Electricity/Gas Acct. 7299263-52952 Acct. 05663020005 Acct. 39188020000 Account 4015 - Electricity/Gas Totals Account 4000 - Telephone/Internet Acct. 1211165 Acct. 1211165 Account 4000 - Telephone/Internet Totals Supplies Supplies Account 5040 - Supplies/Hardware Totals Account 5070 - Chemicals Supplies Supplies Supplies Supplies Supplies Motor Oil Gas/Oil/Mileage/Carwash Account 5020 - Gas/Oil/Mileage/Carwash Totals Account 5040 - Supplies/Hardware Account 5010 - Replacement Supplies Replacement Supplies Account 5010 - Replacement Supplies Totals Account 5020 - Gas/Oil/Mileage/Carwash Account 5085 - Industrial Flow Monitor Industrials Industrials Board Approved 08/21/2023 Chemicals Chemicals Chemicals Account 5070 - Chemicals Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 36 of 41 47 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 2 $156.00 12728 - GBJ SALES, LLC 5188 Edit 01/12/2024 03/04/2024 129.68 11253 - USABLUEBOOK INV00268647 Edit 02/06/2024 03/04/2024 569.06 Invoice Transactions 2 $698.74 10421 - GENUINE PARTS COMPANY 1236-110438 Edit 02/08/2024 03/04/2024 22.20 11020 - ROD BAKER FORD SALES, INC 41336 Edit 01/22/2024 03/04/2024 43.98 12229 - RON TIRAPELLI FORD INC 646177 Edit 02/07/2024 03/04/2024 403.09 Invoice Transactions 3 $469.27 12910 - XEROX FINANCIAL SERVICES 5329561 Paid by EFT # 3298 01/18/2024 02/21/2024 02/21/2024 59.85 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 181275 Edit 02/12/2024 03/04/2024 117.00 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 181254 Edit 02/09/2024 03/04/2024 24.00 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 181239 Edit 02/08/2024 03/04/2024 150.00 10386 - FIRST ENVIRONMENTAL LABORATORIES, INC. 181233 Edit 02/08/2024 03/04/2024 45.00 Invoice Transactions 5 $395.85 10387 - BANKCARD PROCESSING CENTER- OLD NAT'L BANK 2024-00001329 Paid by EFT # 3292 01/29/2024 02/16/2024 02/16/2024 62.34 13223 - GSM ENGINEERED FABRICS INVGSM6378 Edit 01/22/2024 03/04/2024 2,822.86 10585 - INTERSTATE ALL BATTERY CENTER 1915201039395 Edit 02/08/2024 03/04/2024 171.80 11846 - APEX INDUSTRIAL AUTOMATION, LLC 1252865 Edit 02/08/2024 03/04/2024 106.10 Invoice Transactions 4 $3,163.10 13174 - APGN INC.19112 Edit 01/29/2024 03/04/2024 1,235.92 10437 - GRAINGER 9019082057 Edit 02/13/2024 03/04/2024 74.74 11240 - UNDERGROUND PIPE & VALVE CO 064928 Edit 01/31/2024 03/04/2024 600.00 11240 - UNDERGROUND PIPE & VALVE CO 064866 Edit 01/25/2024 03/04/2024 2,650.00 12326 - XYLEM WATER SOLUTIONS, INC.3556D08657 Edit 01/24/2024 03/04/2024 42.28 12326 - XYLEM WATER SOLUTIONS, INC.3556D08656 Edit 01/24/2024 03/04/2024 289.00 Invoice Transactions 6 $4,891.94 Invoice Transactions 41 $74,632.24 Account 8060 - Vehicle Maintenance Vehicle Maintenance Wastewater Vehicle Maintenance Account 8060 - Vehicle Maintenance Totals Account 5095 - Uniforms/Clothing Uniforms Uniforms Account 5095 - Uniforms/Clothing Totals Account 5085 - Industrial Flow Monitor Totals Account 8185 - System Maintenance Blower Filters System Maintenance System Maintenance Wastewater Equipment Maintenance Equipment Maintenance Equipment Maintenance Account 8160 - Equipment Maintenance Totals Chloride Account 8135 - Contractual Services Totals Account 8160 - Equipment Maintenance Threewitt Account 8135 - Contractual Services 01/07/24 - 02/06/24 Total Nitrogen Dissolved Phosphorus Low Level Hg System Maintenance System Maintenance Account 8185 - System Maintenance Totals Division 40 - Sewer Treatment Program Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 37 of 41 48 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description Invoice Transactions 69 $86,647.59 10131 - BAXTER & WOODMAN 0253750 Edit 12/18/2023 03/04/2024 8,265.00 10131 - BAXTER & WOODMAN 0253752 Edit 12/18/2023 03/04/2024 5,677.03 10131 - BAXTER & WOODMAN 0253757 Edit 12/18/2023 03/04/2024 60.92 10131 - BAXTER & WOODMAN 0253754 Edit 12/18/2023 03/04/2024 15,715.10 10904 - PT FERRO CONSTRUCTION CO.2024-00001375 Edit 02/07/2024 03/04/2024 536,706.33 Invoice Transactions 5 $566,424.38 10131 - BAXTER & WOODMAN 0254085 Edit 12/21/2023 03/04/2024 19,806.47 Invoice Transactions 1 $19,806.47 10131 - BAXTER & WOODMAN 0253748 Edit 12/18/2023 03/04/2024 4,029.63 Invoice Transactions 1 $4,029.63 10131 - BAXTER & WOODMAN 0254095 Edit 12/21/2023 03/04/2024 1,516.25 Invoice Transactions 1 $1,516.25 Invoice Transactions 8 $591,776.73 12076 - ILLINOIS ENVIRONMENTAL PROTECTION AGENCY 2024-00001397 Edit 02/14/2024 03/04/2024 82,303.07 Invoice Transactions 1 $82,303.07 12076 - ILLINOIS ENVIRONMENTAL PROTECTION AGENCY 2024-00001397 Edit 02/14/2024 03/04/2024 23,261.13 Invoice Transactions 1 $23,261.13 Invoice Transactions 2 $105,564.20 Invoice Transactions 10 $697,340.93 Invoice Transactions 168 $1,785,505.84 Account 8133.008 - Old Town Reconstruction Totals Account 8133.009 - 143rd St. West Extension-Watermain 143rd St. West Account 8133.009 - 143rd St. West Extension-Watermain Totals Old Town Phase II Utility Improvements Old Town Improvements Phase III Old Town/Illinois/Rte. 59 Public Meeting Old Town Phase II Utilities CS Old Town Phase II Utility Improvements Pmt. 4 Unit 11 - Sewer Department Totals Unit 12 - Utility Expansion Division 91 - Capital Account 8133.008 - Old Town Reconstruction Unit 12 - Utility Expansion Totals Fund 02 - Water and Sewer Fund Totals Fund 11 - Capital Improvement Fund Account 9201.004 - IEPA Loan L174666 (Interest) Project L17-4666 Account 9201.004 - IEPA Loan L174666 (Interest) Totals Division 92 - Bonds Totals Division 92 - Bonds Account 9201.003 - IEPA Loan L174666 (Principal) Project L17-4666 Account 9201.003 - IEPA Loan L174666 (Principal) Totals Pump Station Design-Hawk Auto Account 8225 - Engineering Fees Totals Division 91 - Capital Totals Account 8134.001 - Lift Station Improvements James Street PS-CS Account 8134.001 - Lift Station Improvements Totals Account 8225 - Engineering Fees Unit 00 - Non-Departmental Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 38 of 41 49 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11969 - CONSTELLATION NEW ENERGY, INC 67471780601 Paid by Check # 133617 01/30/2024 02/23/2024 02/23/2024 48.06 12415 - AMERICAN TRAFFIC SOLUTIONS INV0069924 Edit 01/31/2024 03/04/2024 9,190.00 Invoice Transactions 2 $9,238.06 Invoice Transactions 2 $9,238.06 10131 - BAXTER & WOODMAN 0254096 Edit 12/21/2023 03/04/2024 618.75 10131 - BAXTER & WOODMAN 0253772 Edit 12/18/2023 03/04/2024 6,116.25 10131 - BAXTER & WOODMAN 0254101 Edit 12/21/2023 03/04/2024 3,269.11 Invoice Transactions 3 $10,004.11 13356 - CORDOGAN CLARK AND ASSOCIATES, INC. 26888 Edit 11/15/2023 03/04/2024 18,636.55 10777 - METRO TANK AND PUMP CO.19563 Edit 02/01/2024 03/04/2024 38,630.00 Invoice Transactions 2 $57,266.55 13309 - TOWER WORKS, INC 68457 Edit 01/29/2024 03/04/2024 9,500.00 Invoice Transactions 1 $9,500.00 10452 - H.W. LOCHNER, INC.2544-57 Edit 02/14/2024 03/04/2024 5,137.67 Invoice Transactions 1 $5,137.67 10131 - BAXTER & WOODMAN 0253747 Edit 12/18/2023 03/04/2024 1,185.00 Invoice Transactions 1 $1,185.00 13219 - EVT Tech 6817 Edit 01/29/2024 03/04/2024 4,959.60 Invoice Transactions 1 $4,959.60 Account 9105 - Building Improvements Apprvd 5/15/23. Prof Svc Agrmt-Public Facility Assessment (FCA). Apprvd 5/1/23 BM. NTE=$99,630. Fuel Island System Equip Updates Account 9105 - Building Improvements Totals Account 8225 - Engineering Fees Traffic Impact Study - Woodman's 143rd. St. Corridor Mgmt. STP Applications Account 8225 - Engineering Fees Totals Account 8135 - Contractual Services Totals Division 00 - Non-Divisional Totals Division 91 - Capital Division 00 - Non-Divisional Account 8135 - Contractual Services Acct. 7299263-52952 January 2024 Account 9165.009 - 143rd St. East Extension Account 9112 - Sidewalk Curb & Bikepath Replace Totals Account 9120.005 - Machinery and Equipment-Police Install ~ M-15 Account 9120.005 - Machinery and Equipment-Police Totals 127th & Plainfield-Naperville Rd. Phase II 01/2024 Account 9107.002 - 127th St-Plfd/Naperville Rd Totals Account 9112 - Sidewalk Curb & Bikepath Replace Fort Beggs Bike Path Account 9105.007 - Building Improvements-PEMA Fencing & Gate PEMA Tower Account 9105.007 - Building Improvements-PEMA Totals Account 9107.002 - 127th St-Plfd/Naperville Rd Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 39 of 41 50 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 11666 - COMED 2024-00001288 Paid by Check # 133572 01/31/2024 02/07/2024 02/08/2024 64,000.00 13323 - DUNN, MARTIN & MILLER, LTD.2024-00001287 Paid by Check # 133573 01/17/2024 02/07/2024 02/08/2024 12,840.00 13456 - ERIC G WYLIE II 633 Edit 02/09/2024 03/04/2024 1,150.00 10868 - NICOR 2024-00001418 Edit 01/24/2024 03/04/2024 269.79 13454 - STEPHEN SOLUM 117 Edit 02/09/2024 03/04/2024 340.00 13114 - WHEATLAND TITLE COMPANY 679064 Edit 02/08/2024 03/04/2024 1,122.00 10238 - COMED 2024-00001406 Edit 01/20/2024 03/04/2024 85.33 10262 - CRAWFORD, MURPHY & TILLY, INC.0233114 Edit 01/18/2024 03/04/2024 75,771.57 13455 - DARIO ROVITO 114 Edit 02/09/2024 03/04/2024 1,150.00 13455 - DARIO ROVITO 603 Edit 02/09/2024 03/04/2024 1,150.00 13455 - DARIO ROVITO 618 Edit 02/09/2024 03/04/2024 1,600.00 Invoice Transactions 11 $159,478.69 10131 - BAXTER & WOODMAN 0253744 Edit 12/18/2023 03/04/2024 4,180.00 Invoice Transactions 1 $4,180.00 Invoice Transactions 21 $251,711.62 Invoice Transactions 23 $260,949.68 Invoice Transactions 23 $260,949.68 10263 - CREATIVE PRODUCT SOURCING, INC 156344 Edit 01/19/2024 03/04/2024 693.00 12792 - NICK BOWRON 2024-00001398 Edit 02/05/2024 03/04/2024 150.00 Invoice Transactions 2 $843.00 Invoice Transactions 2 $843.00 Invoice Transactions 2 $843.00 Invoice Transactions 2 $843.00 143rd St. East Easement and Const. License Plfld. Corners, U-Store-It, Chgo. Bridge & Iron CubeSmart Relocation Acct. 41188785798 143rd St. East Unit 00 - Non-Departmental Division 00 - Non-Divisional Account 8245 - D.A.R.E. Program D.A.R.E. DARE Pool Party DJ Unit 00 - Non-Departmental Totals Fund 11 - Capital Improvement Fund Totals Fund 14 - D.A.R.E. Fund Renwick Road Phase II Account 9165.028 - Renwick Corridor Totals Division 91 - Capital Totals CubeSmart Relocation CubeSmart Relocation Account 9165.009 - 143rd St. East Extension Totals Account 9165.028 - Renwick Corridor CubeSmart Relocation 143rd Street East Acct. 9201595010 143rd St. East 143rd St. Extension Rte 59 to 126 Phase II Dec. 2023 CubeSmart Relocation Fund 14 - D.A.R.E. Fund Totals Fund 17 - Tax Increment Financing-Downtown Unit 00 - Non-Departmental Division 91 - Capital Account 8245 - D.A.R.E. Program Totals Division 00 - Non-Divisional Totals Unit 00 - Non-Departmental Totals Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 40 of 41 51 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice AmountInvoice Description 10211 - CHRISTOPHER B. BURKE ENGINEERING, LTD. 189881 Edit 02/08/2024 03/04/2024 1,050.00 12945 - HANSON LANDSCAPE DESIGN INC.34666 Edit 01/25/2024 03/04/2024 3,836.00 13258 - MARTENSON TURF PRODUCTS, INC.93420 Edit 01/24/2024 03/04/2024 4,314.50 10767 - MENARDS INC. # 3182 37087-1 Edit 01/29/2024 03/04/2024 259.80 10767 - MENARDS INC. # 3182 36456 Edit 01/12/2024 03/04/2024 143.96 Invoice Transactions 5 $9,604.26 Invoice Transactions 5 $9,604.26 Invoice Transactions 5 $9,604.26 Invoice Transactions 5 $9,604.26 Invoice Transactions 724 $3,395,101.82 Unit 00 - Non-Departmental Totals Fund 17 - Tax Increment Financing-Downtown Totals Grand Totals Snow Shovels for Downtown Account 8135 - Contractual Services Totals Division 91 - Capital Totals Account 8135 - Contractual Services Downtown Streetscape Refresh 01/01/24 - 01/27/24 Downtown Shoveling 01/12/24 & 01/13/24 Sidewalk Salt for Downtown Streetscape. Downtown Streetscape Run by Kristin Partyka on 02/29/2024 12:55:49 PM Page 41 of 41 52 General Ledger Current Maturity Account #Account Name Bank or Savings & Loan Yield Balance Type Date General Fund 01-0100.000 Operating Account Harris 0.000%681,510.31 CK N/A 01-0100.002 Public Checking Old National Bank 0.000%2,781.96 CK N/A 01-0100.005 Drug Forfeiture Harris 2.029%925,920.26 CK N/A 01-0102.001 IPRIME PMA 5.272%469,168.95 OT N/A 01-0102.003 Money Market Account Fifth Third 5.210%115,547.64 OT N/A 01-0103.022 IL Funds Illinois Funds 5.392%6,625,668.71 OT N/A 01-0103.024 IMET-Convenience Fund IMET 5.020%2,376,609.37 OT N/A 01-0103.025 IMET-1-3 Year Fund IMET Various 1,702,941.35 OT N/A 01-0104.009 General Fund-PMA CDs Amarillo National Bank 5.400%241,325.49 CD 3/28/2024 BOKF, National Association 5.400%241,325.49 CD 3/28/2024 Blue Ridge Bank, N.A.5.400%241,325.49 CD 3/28/2024 Cornerstone Bank 5.400%241,325.49 CD 3/28/2024 EagleBank 5.400%241,325.49 CD 3/28/2024 River City Bank 5.400%189,277.39 CD 3/28/2024 Forbright Bank 5.400%101,731.18 CD 3/28/2024 First National bank 5.400%2,363.98 CD 3/28/2024 First Bank of the Lake, MO 5.452%241,595.84 CD 4/18/2024 First Fed Community Bank 5.452%241,595.84 CD 4/18/2024 Live Oak Banking Company, NC 5.452%241,595.84 CD 4/18/2024 West Gate Bank, NE 5.452%241,595.83 CD 4/18/2024 Pinnacle Bank, TN 5.452%33,616.65 CD 4/18/2024 Morgan Stanley PVT Bank 4.205%243,026.08 CD 10/7/2024 Vibrant Credit Union, IL 5.529%236,700.00 CD 10/15/2024 Baxter Credit Union, IL 5.484%236,850.00 CD 10/15/2024 01-0104.015 General Fund-Fifth Third CDs DMB Community Bank 5.000%54,647.92 CD 3/28/2024 State Bank India NY 5.400%250,225.00 CD 6/4/2024 Everbank NA 4.950%124,956.25 CD 7/19/2024 Origin Bank 5.500%200,458.00 CD 8/8/2024 01-0106.003 General Fund-Fifth Third Securities JPMorgan Chase 4.150%493,175.00 BD 8/30/2024 Hawaii State 0.802%559,452.00 BD 10/1/2024 Bank of America Corp 4.000%533,126.34 BD 1/22/2025 North Miami Beach FLA Water 2.071%245,154.45 BD 8/1/2025 Goldman Sachs Group Inc.6.100%500,275.00 BD 10/31/2025 Goldman Sachs Group Inc.5.650%387,216.20 BD 9/29/2026 Federal Home Loan BA 3.500%372,960.00 TR 5/24/2024 Total General Fund 19,838,370.79 Village Of Plainfield Cash & Investment List As of January 31, 2024 Page 1 53 General Ledger Current Maturity Account #Account Name Bank or Savings & Loan Yield Balance Type Date Village Of Plainfield Cash & Investment List As of January 31, 2024 Water & Sewer Fund 02-0100.000 Operating Account Harris 0.000%3,022,321.34 CK N/A 02-0100.002 Public Checking Old National Bank 0.000%2,221.71 CK N/A 02-0102.001 IPRIME PMA 5.272%1,041,199.29 OT N/A 02-0102.003 Money Market Account Fifth Third 5.210%15,793.30 OT N/A 02-0102.006 IPRIME-ARPA PMA 5.272%3,632,008.07 OT N/A 02-0103.022 IL Funds Illinois Funds 5.392%3,316,008.67 OT N/A 02-0103.024 IMET-Convenience Fund IMET 5.020%619,302.48 OT N/A 02-0103.026 Water & Sewer Series 2008-1-3 Year Fund IMET Various 1,546,511.19 OT N/A 02-0104.009 Water Sewer Fund-PMA CDs Bank of America, N.A.5.400%241,325.49 CD 3/28/2024 Bank of China 5.400%241,325.49 CD 3/28/2024 Cross River Bank 5.400%241,325.49 CD 3/28/2024 First-Citizens Bank & Trust Company 5.400%241,325.49 CD 3/28/2024 OMB Bank 5.400%241,325.49 CD 3/28/2024 Washington Federal bank 5.400%241,325.47 CD 3/28/2024 River City Bank 5.400%52,048.08 CD 3/28/2024 Consumers Credit Union 5.605%236,600.00 CD 9/23/2024 02-0104.015 Water Sewer Fund-Fifth Third CDs DMB Community Bank 5.000%18,245.84 CD 3/28/2024 Capital One Bank 3.350%61,973.13 CD 8/5/2024 Southern First Bank 4.650%251,440.00 CD 5/26/2026 02-0106.003 Water Sewer Fund-Fifth Third Securities Citigroup Global Markets 4.000%494,687.74 BD 8/30/2024 Bank of America Corp 4.000%93,232.76 BD 1/22/2025 KeyBank National Assoc.4.700%490,065.00 BD 1/26/2026 Federal Home Loan BA 3.500%124,320.00 TR 5/24/2024 Total Water & Sewer Fund 16,465,931.52 Capital Replacement Fund 03-0100.000 Operating Account Harris 0.000%786,214.98 CK N/A 03-0102.001 IPRIME PMA 5.272%42,626.51 OT N/A 03-0102.003 Money Market Account Fifth Third 5.210%24,801.67 OT N/A 03-0103.022 IL Funds Illinois Funds 5.392%21,710,573.27 OT N/A 03-0103.025 IMET-1-3 Year Fund IMET Various 2,618,726.76 OT N/A 03-0104.005 Capital Replacement-PMA CDs Synovus Bank GA 4.200%243,482.86 CD 4/11/2024 AVB Bank, OK 5.450%241,598.18 CD 4/18/2024 Alerus Financial, N.A.5.450%241,598.18 CD 4/18/2024 Belmont Bank & Trust Company 5.450%241,598.18 CD 4/18/2024 Carrollton Bank, IL 5.450%241,598.18 CD 4/18/2024 First Vision Bank of Tennessee 5.450%241,598.18 CD 4/18/2024 Guaranty Bank, MO 5.450%241,598.18 CD 4/18/2024 Page 2 54 General Ledger Current Maturity Account #Account Name Bank or Savings & Loan Yield Balance Type Date Village Of Plainfield Cash & Investment List As of January 31, 2024 Capital Replacement Fund Continued Independent Bank, TX 5.450%241,598.18 CD 4/18/2024 Mainstreet Bank, VA 5.450%241,598.18 CD 4/18/2024 Modern Bank, National Association 5.450%241,598.18 CD 4/18/2024 SpiritBank, OK 5.450%241,598.18 CD 4/18/2024 The First National Bank of Hutchison, KS 5.450%241,598.15 CD 4/18/2024 Pinnacle Bank, TN 5.450%207,981.20 CD 4/18/2024 Open Bank, CA 5.450%134,438.85 CD 4/18/2024 03-0104.015 Capital Replacement-Fifth Third CDs DMB Community Bank 5.000%105,210.94 CD 3/28/2024 Capital One Bank 3.350%185,919.38 CD 8/5/2024 Beal Bank 5.500%250,567.50 CD 8/7/2024 03-0106.003 Capital Replacement-Fifth Third Securities Bank of America Corp 4.000%413,795.75 BD 1/22/2025 South Milwaukee 3.300%293,586.00 BD 10/1/2025 Goldman Sachs Group Inc.6.100%500,275.00 BD 10/31/2025 Federal Home Loan MTG Corp 5.500%999,870.00 TR 3/20/2026 Total Capital Replacement Fund 31,175,650.62 Motor Fuel Tax Fund 04-0100.000 Operating Account Harris 0.000%(103,650.62)CK N/A 04-0103.002 Motor Fuel Tax Fund Illinois Funds 5.392%5,233,932.71 OT N/A Total Motor Fuel Tax Fund 5,130,282.09 Bond And Interest Fund 05-0100.000 Operating Account Harris 0.000%1,276.70 CK N/A 05-0103.022 IL Funds Illinois Funds 5.392%-OT N/A Total Bond And Interest Fund 1,276.70 Tort Immunity Fund 07-0100.000 Operating Account Harris 0.000%358,544.55 CK N/A Audit Fund 08-0100.000 Operating Account Harris 0.000%21,084.00 CK N/A Capital Improvement Fund 11-0100.000 Operating Account Harris 0.000%3,719,196.12 CK N/A 11-0102.003 Money Market Account Fifth Third 5.210%6,700.90 OT N/A 11-0102.015 Public Checking US Bank 0.000%4,700.00 CK N/A 11-0103.022 IL Funds Illinois Funds 5.392%19,290,155.06 OT N/A Page 3 55 General Ledger Current Maturity Account #Account Name Bank or Savings & Loan Yield Balance Type Date Village Of Plainfield Cash & Investment List As of January 31, 2024 Capital Improvement Fund Continued 11-0103.030 Illinois Trust Illinois Trust 5.400%4,381,254.11 OT N/A 11-0104.015 Capital Improvement-Fifth Third CDs DMB Community Bank 5.000%21,799.29 CD 3/28/2024 Everbank NA 4.950%124,956.25 CD 7/19/2024 Eclipse Bancorp 5.600%200,046.00 CD 5/16/2025 11-0106.003 Capital Improvement-Fifth Third Securities JPMorgan Chase 4.150%493,175.00 BD 8/30/2024 Bank of America Corp 4.000%291,373.91 BD 1/22/2025 Goldman Sachs Group Inc.6.100%1,000,550.00 BD 10/31/2025 Total Capital Improvement Fund 29,533,906.64 D.A.R.E. Fund 14-0100.004 D.A.R.E. Account Harris 2.029%8,977.29 CK N/A Downtown TIF Fund 17-0100.000 Operating Account Harris 0.000%20,281.02 CK N/A Rt 30 TIF Fund 18-0100.000 Operating Account Harris 0.000%142,909.97 CK N/A Sex Offenders Registration Fund 26-0100.000 Operating Account Harris 0.000%3,824.01 CK N/A Alcohol Enforcement Fund 27-0100.000 Operating Account Harris 0.000%36,583.99 CK N/A Drug Enforcement Fund 28-0100.000 Operating Account Harris 0.000%52,424.93 CK N/A Police Vehicle Replacement Fund 29-0100.000 Operating Account Harris 0.000%75,875.29 CK N/A PEMA Fund 40-0100.000 Operating Account Harris 0.000%28,915.13 CK N/A Total Cash & Investments 102,894,838.54 Page 4 56 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund REVENUE 0400.401 Property Tax Revenue 4,408,040.00 .00 4,408,040.00 .00 .00 4,769,979.41 (361,939.41)108 4,501,224.62 0400.402 Property Tax Rev-Road & Bridge 400,000.00 .00 400,000.00 .00 .00 439,619.94 (39,619.94)110 412,355.12 0400.403 Property Tax Rev-Police Pension 1,950,000.00 .00 1,950,000.00 .00 .00 1,940,408.46 9,591.54 100 1,698,688.88 0400.404 Property Tax Revenue-IMRF 575,000.00 .00 575,000.00 .00 .00 572,897.66 2,102.34 100 574,250.66 0450.451 Municipal Sales Tax 8,500,000.00 .00 8,500,000.00 759,277.33 .00 7,074,749.00 1,425,251.00 83 9,510,059.55 0450.452 Illinois Income Tax 6,600,000.00 .00 6,600,000.00 713,930.07 .00 5,520,373.05 1,079,626.95 84 7,232,573.69 0450.453 Replacement Tax 90,000.00 .00 90,000.00 14,605.61 .00 104,069.19 (14,069.19)116 185,442.57 0450.455 Local Use Tax 1,675,000.00 .00 1,675,000.00 158,699.67 .00 1,303,395.60 371,604.40 78 1,919,498.93 0500.500 Hotel/Motel Tax 1,000.00 .00 1,000.00 .00 .00 3,477.22 (2,477.22)348 2,835.07 0500.501 Amusement Tax 5,000.00 .00 5,000.00 135.61 .00 9,882.38 (4,882.38)198 12,392.66 0500.503 Local Motor Fuel Tax 1,400,000.00 .00 1,400,000.00 131,224.69 .00 1,066,217.81 333,782.19 76 1,433,357.22 0550.551 Liquor License 100,000.00 .00 100,000.00 (550.00).00 107,097.70 (7,097.70)107 119,234.29 0550.552 Contractors License 45,000.00 .00 45,000.00 3,650.00 .00 37,350.00 7,650.00 83 50,900.00 0550.553 Cigarette License 6,000.00 .00 6,000.00 .00 .00 6,000.00 .00 100 6,000.00 0550.554 Scavenger License 200.00 .00 200.00 .00 .00 50.00 150.00 25 100.00 0550.558 Business License 50,000.00 .00 50,000.00 8,700.00 .00 47,037.50 2,962.50 94 73,237.50 0570.555 Building Permit 1,500,000.00 .00 1,500,000.00 235,850.03 .00 1,537,159.85 (37,159.85)102 1,905,558.31 0570.556 Sign Permit 5,000.00 .00 5,000.00 544.49 .00 4,369.68 630.32 87 4,406.00 0570.557 Special Movement Permit 20,000.00 .00 20,000.00 4,125.00 .00 34,075.00 (14,075.00)170 55,800.00 0570.560 Solicitors Permit 2,000.00 .00 2,000.00 120.00 .00 1,765.00 235.00 88 2,710.00 0600.601 County Court Fines 325,000.00 .00 325,000.00 17,943.62 .00 248,835.21 76,164.79 77 374,284.00 0600.602 Administrative Fines(P-Tickets)100,000.00 .00 100,000.00 6,210.00 .00 70,594.50 29,405.50 71 112,565.00 0600.603 Asset Seizure-Non Federal 100,000.00 .00 100,000.00 .00 .00 143,769.45 (43,769.45)144 26,527.80 0600.604 Alarm Fees 1,000.00 .00 1,000.00 1,000.00 .00 5,350.00 (4,350.00)535 1,850.00 0600.605 Kendall County Court Fines 3,000.00 .00 3,000.00 1,025.00 .00 5,633.07 (2,633.07)188 5,348.70 0600.607 Administrative Fines- Late Fee 5,000.00 .00 5,000.00 755.00 .00 5,355.00 (355.00)107 6,200.00 0600.630 Asset Seizure-Federal (Dept of Justice Equitable Share) .00 .00 .00 16,897.61 .00 68,689.13 (68,689.13)+++130,177.80 0600.632 Asset Seizure-Federal (U.S. Treasury Equitable Share) .00 .00 .00 .00 .00 8,259.98 (8,259.98)+++.00 0620.655 Garbage Fee 5,264,845.00 .00 5,264,845.00 475,517.98 .00 4,581,667.77 683,177.23 87 5,180,505.02 0620.656 Garbage Penalty 40,000.00 .00 40,000.00 6,023.01 .00 51,380.24 (11,380.24)128 61,153.05 0650.651 Zoning Applications 15,000.00 .00 15,000.00 5,289.00 .00 34,286.66 (19,286.66)229 29,627.19 0650.652 Planning Fees .00 .00 .00 100.00 .00 20,850.00 (20,850.00)+++2,325.00 0650.653 Accident Report Fees 5,000.00 .00 5,000.00 1,025.00 .00 8,150.00 (3,150.00)163 8,610.00 0650.654 Copies-Maps & Ordinances 1,500.00 .00 1,500.00 88.50 .00 1,201.30 298.70 80 1,972.58 0650.670 Impound Fee 25,000.00 .00 25,000.00 750.00 .00 14,500.00 10,500.00 58 31,250.00 0650.815 Parking Lot Revenue 2,000.00 .00 2,000.00 .00 .00 1,200.00 800.00 60 5,550.00 0650.818 Tower Rent 46,450.00 .00 46,450.00 4,761.00 .00 38,340.53 8,109.47 83 47,502.58 0650.825 Rental Income 49,200.00 .00 49,200.00 4,100.00 .00 36,900.00 12,300.00 75 49,200.00 0650.830 Rental-Community/Multi Room 1,000.00 .00 1,000.00 250.00 .00 610.00 390.00 61 770.00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 1 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 57 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund REVENUE 0650.904 Special Detail/OT Reimbursement 85,000.00 .00 85,000.00 13,900.00 .00 60,207.50 24,792.50 71 99,909.65 0690.902 Water & Sewer Service Charge 350,000.00 .00 350,000.00 .00 .00 175,000.00 175,000.00 50 350,000.00 0700.650 Grant Revenue .00 .00 .00 .00 .00 .00 .00 +++500.00 0700.704 Bulletproof Vest Grant 3,000.00 .00 3,000.00 1,950.00 .00 6,827.50 (3,827.50)228 4,860.00 0700.710 Tobacco Grant 2,750.00 .00 2,750.00 .00 .00 3,134.00 (384.00)114 4,503.00 0700.717 Traffic Grant 40,000.00 .00 40,000.00 8,883.00 .00 65,066.71 (25,066.71)163 80,376.17 0750.750 AT&T Franchise Fees 80,000.00 .00 80,000.00 15,311.33 .00 68,401.06 11,598.94 86 81,021.49 0750.751 Cable TV-Franchise Fees 480,000.00 .00 480,000.00 .00 .00 365,113.77 114,886.23 76 519,258.45 0800.800 Interest Income 150,000.00 .00 150,000.00 60,938.44 .00 588,801.58 (438,801.58)393 442,635.20 0800.826 Realized Gain/Loss On Investment .00 .00 .00 1,360.97 .00 1,360.97 (1,360.97)+++.00 0800.827 Unrealized Gain/Loss .00 .00 .00 (126.11).00 57,125.89 (57,125.89)+++(17,914.67) 0800.830 Unrealized Gain/Loss IMET .00 .00 .00 16,122.55 .00 154,551.95 (154,551.95)+++17,733.75 0801.200 Event Sponsorship Program 2,000.00 .00 2,000.00 2,000.00 .00 4,519.25 (2,519.25)226 3,470.00 0801.801 Reimbursement Police Training .00 .00 .00 .00 .00 1,193.00 (1,193.00)+++225.00 0801.802 Amphitheater Rent 500.00 .00 500.00 550.00 .00 800.00 (300.00)160 250.00 0801.822 Donation/Contribution 5,000.00 .00 5,000.00 .00 .00 17,689.50 (12,689.50)354 37,538.09 0803.000 Sales-Fixed Assets 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 2,346.94 0805.000 Other Reimbursements 90,000.00 .00 90,000.00 600.00 .00 27,010.55 62,989.45 30 147,644.04 0806.000 Other Receipts 25,000.00 .00 25,000.00 2,691.04 .00 19,603.80 5,396.20 78 49,228.51 0860.804 School Liaison Reimbursement 550,000.00 .00 550,000.00 125,152.79 .00 381,617.29 168,382.71 69 488,740.77 0860.819 HIDTA/Organized Crime Reimb 10,000.00 .00 10,000.00 .00 .00 15,622.32 (5,622.32)156 15,350.97 0999.891 Contra Revenue Account-Leases .00 .00 .00 .00 .00 .00 .00 +++24,688.00 0999.927 Transfer From Alcohol Enforc.20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 20,000.00 REVENUE TOTALS $35,210,485.00 $0.00 $35,210,485.00 $2,821,382.23 $0.00 $31,939,193.93 $3,271,291.07 91%$38,148,409.15 EXPENSE Unit 00 - Non-Departmental Division 94 - Contra 2020.001 Contra Insurance Account .00 .00 .00 .00 .00 .00 .00 +++170,788.80 Division 94 - Contra Totals $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 +++$170,788.80 Unit 00 - Non-Departmental Totals $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 +++$170,788.80 Unit 04 - Administration/Finance Division 00 - Non-Divisional 8100 Fees to Refuse Hauler 5,116,915.00 .00 5,116,915.00 849,245.04 .00 3,363,900.08 1,753,014.92 66 4,836,554.98 Division 00 - Non-Divisional Totals $5,116,915.00 $0.00 $5,116,915.00 $849,245.04 $0.00 $3,363,900.08 $1,753,014.92 66%$4,836,554.98 Division 01 - Legislative Program 1000 Salaries-President 24,000.00 .00 24,000.00 2,000.00 .00 18,000.00 6,000.00 75 24,000.00 1002 Salaries-Elected Officials 26,000.00 .00 26,000.00 1,400.00 .00 16,800.00 9,200.00 65 19,600.00 1003 Salaries-Liquor Commissioner 1,500.00 .00 1,500.00 125.00 .00 1,125.00 375.00 75 1,500.00 1004 Salaries-Treasurer 2,500.00 .00 2,500.00 208.33 .00 1,874.97 625.03 75 2,499.96 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 2 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 58 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 04 - Administration/Finance Division 01 - Legislative Program 2000 FICA 3,400.00 .00 3,400.00 231.47 .00 2,343.60 1,056.40 69 2,951.20 2001 Medicare 800.00 .00 800.00 54.13 .00 548.10 251.90 69 690.20 2020 Employee Insurance 100.00 .00 100.00 .00 .00 .00 100.00 0 .00 3000 Travel/Training 10,000.00 .00 10,000.00 .00 .00 336.94 9,663.06 3 .00 5010 Replacement Supplies 10,000.00 .00 10,000.00 .00 .00 82.72 9,917.28 1 .00 5015 Dues & Subscriptions 55,000.00 .00 55,000.00 29,618.94 .00 52,233.08 2,766.92 95 51,229.23 8070 Public Relations 120,000.00 .00 120,000.00 8,848.23 .00 83,180.95 36,819.05 69 126,182.92 8074 Cable TV 10,000.00 .00 10,000.00 .00 .00 .00 10,000.00 0 14.49 8078 Economic Incentive Rebate 150,000.00 .00 150,000.00 13,793.57 .00 41,054.96 108,945.04 27 357,140.54 Division 01 - Legislative Program Totals $413,300.00 $0.00 $413,300.00 $56,279.67 $0.00 $217,580.32 $195,719.68 53%$585,808.54 Division 02 - Administration Program 1005 Salaries-Full Time 770,000.00 .00 770,000.00 58,882.33 .00 556,273.84 213,726.16 72 713,806.34 1015 Salaries-Part Time 60,000.00 .00 60,000.00 2,214.65 .00 26,842.79 33,157.21 45 49,454.66 1800 Salaries-Overtime 2,000.00 .00 2,000.00 18.10 .00 1,037.34 962.66 52 1,299.72 2000 FICA 51,590.00 .00 51,590.00 3,748.16 .00 33,451.94 18,138.06 65 43,845.98 2001 Medicare 12,065.00 .00 12,065.00 876.62 .00 8,385.88 3,679.12 70 11,003.72 2010 IMRF 91,520.00 .00 91,520.00 5,068.13 .00 48,471.35 43,048.65 53 68,068.42 2020 Employee Insurance 115,000.00 .00 115,000.00 7,616.72 .00 79,389.76 35,610.24 69 117,890.37 2025 Deferred Comp. Contribution 25,000.00 .00 25,000.00 .00 .00 .00 25,000.00 0 17,052.32 3000 Travel/Training 12,000.00 .00 12,000.00 129.00 .00 3,165.47 8,834.53 26 3,849.50 3015 IL Unemployment Insurance 6,000.00 .00 6,000.00 .00 .00 2,121.24 3,878.76 35 4,676.56 4000 Telephone/Internet 8,000.00 .00 8,000.00 123.17 .00 3,413.38 4,586.62 43 5,274.56 4005 Cellular Phones 5,000.00 .00 5,000.00 99.14 .00 784.25 4,215.75 16 1,051.69 5005 Office Supplies/Postage 35,000.00 .00 35,000.00 2,827.26 .00 33,341.70 1,658.30 95 36,496.95 5015 Dues & Subscriptions 5,000.00 .00 5,000.00 .00 .00 1,828.89 3,171.11 37 2,359.00 5020 Gas/Oil/Mileage/Carwash 9,500.00 .00 9,500.00 500.00 .00 4,821.17 4,678.83 51 6,530.32 8035 Maintenance Contracts/Lease 5,000.00 .00 5,000.00 59.80 .00 715.73 4,284.27 14 1,401.03 8045 Recording Fees 1,000.00 .00 1,000.00 470.00 .00 734.00 266.00 73 695.01 8050 Legal Notices 2,500.00 .00 2,500.00 382.50 .00 2,541.90 (41.90)102 2,608.59 8065 Legal Fees 95,000.00 .00 95,000.00 10,200.41 .00 34,490.28 60,509.72 36 83,019.33 8135 Contractual Services 100,000.00 .00 100,000.00 3,589.33 .00 44,585.25 55,414.75 45 69,787.50 8135.008 Settlement Charges .00 .00 .00 2,897.63 .00 25,403.23 (25,403.23)+++30,340.46 9115 Office Furniture & Equipment 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 3,247.71 9300 Contingencies 200,000.00 .00 200,000.00 953.94 .00 1,328.44 198,671.56 1 528.55 Division 02 - Administration Program Totals $1,616,175.00 $0.00 $1,616,175.00 $100,656.89 $0.00 $913,127.83 $703,047.17 56%$1,274,288.29 Division 03 - Community Relations Program 1005 Salaries-Full Time 118,000.00 .00 118,000.00 9,010.88 .00 85,527.17 32,472.83 72 113,475.92 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 3 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 59 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 04 - Administration/Finance Division 03 - Community Relations Program 2000 FICA 7,315.00 .00 7,315.00 534.80 .00 5,075.40 2,239.60 69 6,851.89 2001 Medicare 1,715.00 .00 1,715.00 125.08 .00 1,187.00 528.00 69 1,602.46 2010 IMRF 12,980.00 .00 12,980.00 748.80 .00 7,145.49 5,834.51 55 10,212.52 2020 Employee Insurance 29,725.00 .00 29,725.00 1,911.98 .00 20,160.14 9,564.86 68 26,374.82 2025 Deferred Comp. Contribution 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 3,876.54 3000 Travel/Training 1,500.00 .00 1,500.00 .00 .00 33.00 1,467.00 2 35.00 4000 Telephone/Internet 750.00 .00 750.00 11.55 .00 238.22 511.78 32 309.98 5005 Office Supplies/Postage 400.00 .00 400.00 .00 .00 .00 400.00 0 282.54 5015 Dues & Subscriptions 900.00 .00 900.00 149.90 .00 413.90 486.10 46 738.95 5020 Gas/Oil/Mileage/Carwash 100.00 .00 100.00 .00 .00 .00 100.00 0 .00 8070 Public Relations 32,000.00 .00 32,000.00 .00 .00 11,974.12 20,025.88 37 28,721.14 8071 Marketing and Promotions 7,000.00 .00 7,000.00 .00 .00 .00 7,000.00 0 .00 8072 Settler's Park 8,500.00 .00 8,500.00 .00 .00 7,607.38 892.62 89 3,552.06 8135 Contractual Services 7,000.00 .00 7,000.00 .00 .00 3,600.00 3,400.00 51 .00 Division 03 - Community Relations Program Totals $232,885.00 $0.00 $232,885.00 $12,492.99 $0.00 $142,961.82 $89,923.18 61%$196,033.82 Division 04 - Facility Management Program 1005 Salaries-Full Time 60,000.00 .00 60,000.00 4,443.58 .00 42,897.52 17,102.48 71 56,830.59 1800 Salaries-Overtime 7,500.00 .00 7,500.00 1,293.30 .00 4,146.63 3,353.37 55 5,087.44 2000 FICA 4,185.00 .00 4,185.00 346.05 .00 2,824.66 1,360.34 67 3,707.33 2001 Medicare 1,000.00 .00 1,000.00 80.93 .00 660.63 339.37 66 867.07 2010 IMRF 7,425.00 .00 7,425.00 476.73 .00 3,930.03 3,494.97 53 5,484.00 2020 Employee Insurance 18,500.00 .00 18,500.00 1,061.74 .00 11,128.60 7,371.40 60 14,371.80 2025 Deferred Comp. Contribution 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 1,247.91 5000 Building Supplies 20,000.00 .00 20,000.00 223.43 .00 5,113.37 14,886.63 26 10,795.40 8135 Contractual Services 70,000.00 .00 70,000.00 2,555.00 .00 30,638.45 39,361.55 44 49,817.42 9105 Building Improvements 30,000.00 .00 30,000.00 .00 .00 .00 30,000.00 0 549.85 Division 04 - Facility Management Program Totals $220,610.00 $0.00 $220,610.00 $10,480.76 $0.00 $101,339.89 $119,270.11 46%$148,758.81 Division 06 - Human Resources Program 1005 Salaries-Full Time 215,000.00 .00 215,000.00 16,262.34 .00 156,799.91 58,200.09 73 200,057.94 1800 Salaries-Overtime 500.00 .00 500.00 .00 .00 .00 500.00 0 54.08 2000 FICA 13,360.00 .00 13,360.00 990.54 .00 9,560.09 3,799.91 72 12,269.93 2001 Medicare 3,125.00 .00 3,125.00 231.65 .00 2,235.81 889.19 72 2,869.58 2010 IMRF 23,705.00 .00 23,705.00 1,351.40 .00 12,260.97 11,444.03 52 17,389.82 2020 Employee Insurance 35,000.00 .00 35,000.00 2,135.70 .00 22,774.46 12,225.54 65 31,544.62 2025 Deferred Comp. Contribution 8,000.00 .00 8,000.00 .00 .00 .00 8,000.00 0 5,823.08 3000 Travel/Training 10,000.00 .00 10,000.00 .00 .00 .00 10,000.00 0 598.00 4000 Telephone/Internet 1,000.00 .00 1,000.00 15.40 .00 317.65 682.35 32 413.35 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 4 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 60 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 04 - Administration/Finance Division 06 - Human Resources Program 4005 Cellular Phones 600.00 .00 600.00 42.27 .00 337.59 262.41 56 506.83 5005 Office Supplies/Postage 2,000.00 .00 2,000.00 189.47 .00 1,413.60 586.40 71 2,113.58 5015 Dues & Subscriptions 5,000.00 .00 5,000.00 620.00 .00 620.00 4,380.00 12 1,200.00 5020 Gas/Oil/Mileage/Carwash 1,000.00 .00 1,000.00 .00 .00 50.56 949.44 5 .00 8070 Public Relations 12,000.00 .00 12,000.00 556.68 .00 6,453.88 5,546.12 54 9,694.55 8135 Contractual Services 10,000.00 .00 10,000.00 .00 .00 .00 10,000.00 0 2,036.50 Division 06 - Human Resources Program Totals $340,290.00 $0.00 $340,290.00 $22,395.45 $0.00 $212,824.52 $127,465.48 63%$286,571.86 Division 08 - IT Program 1005 Salaries-Full Time 537,500.00 .00 537,500.00 42,594.41 .00 381,731.57 155,768.43 71 378,941.84 2000 FICA 33,325.00 .00 33,325.00 2,504.74 .00 22,508.54 10,816.46 68 22,080.90 2001 Medicare 7,795.00 .00 7,795.00 585.80 .00 5,264.13 2,530.87 68 5,164.07 2010 IMRF 59,125.00 .00 59,125.00 3,539.60 .00 31,384.55 27,740.45 53 33,322.96 2020 Employee Insurance 120,000.00 .00 120,000.00 8,599.66 .00 88,106.24 31,893.76 73 109,833.16 2025 Deferred Comp. Contribution 7,500.00 .00 7,500.00 .00 .00 .00 7,500.00 0 8,396.16 3000 Travel/Training 15,000.00 .00 15,000.00 1,790.00 .00 5,522.61 9,477.39 37 3,254.07 4000 Telephone/Internet 500.00 .00 500.00 7.70 .00 158.81 341.19 32 206.64 4005 Cellular Phones 4,200.00 .00 4,200.00 317.96 .00 2,464.59 1,735.41 59 2,523.29 5005 Office Supplies/Postage 1,800.00 .00 1,800.00 .00 .00 459.90 1,340.10 26 1,183.24 5015 Dues & Subscriptions 1,100.00 .00 1,100.00 .00 .00 884.00 216.00 80 1,167.35 5020 Gas/Oil/Mileage/Carwash 400.00 .00 400.00 .00 .00 .00 400.00 0 330.17 5095 Uniforms/Clothing 800.00 .00 800.00 .00 .00 562.00 238.00 70 285.00 8030 Server/Network Supplies 78,500.00 .00 78,500.00 6,037.97 4,833.16 76,628.97 (2,962.13)104 32,881.58 8031 Software Licensing/Renewals 585,000.00 .00 585,000.00 107,458.63 26,970.00 453,753.99 104,276.01 82 478,246.64 8135 Contractual Services 60,000.00 .00 60,000.00 92.25 .00 13,899.09 46,100.91 23 13,188.55 9111 Computers 40,000.00 .00 40,000.00 .00 .00 11,450.43 28,549.57 29 39,496.48 9115 Office Furniture & Equipment .00 .00 .00 .00 .00 854.11 (854.11)+++.00 Division 08 - IT Program Totals $1,552,545.00 $0.00 $1,552,545.00 $173,528.72 $31,803.16 $1,095,633.53 $425,108.31 73%$1,130,502.10 Division 09 - Legal Program 1005 Salaries-Full Time 320,000.00 .00 320,000.00 16,083.94 .00 183,508.67 136,491.33 57 309,904.29 1015 Salaries-Part Time 30,000.00 .00 30,000.00 .00 .00 18,186.24 11,813.76 61 25,941.12 1800 Salaries-Overtime 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 .00 2000 FICA 21,760.00 .00 21,760.00 967.44 .00 12,235.66 9,524.34 56 20,495.17 2001 Medicare 5,090.00 .00 5,090.00 226.25 .00 2,861.54 2,228.46 56 4,795.60 2010 IMRF 38,600.00 .00 38,600.00 1,336.57 .00 16,939.60 21,660.40 44 30,435.11 2020 Employee Insurance 74,000.00 .00 74,000.00 3,799.68 .00 40,455.77 33,544.23 55 65,897.23 2025 Deferred Comp. Contribution 11,000.00 .00 11,000.00 .00 .00 .00 11,000.00 0 9,805.39 3000 Travel/Training 3,000.00 .00 3,000.00 .00 .00 .00 3,000.00 0 831.50 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 5 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 61 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 04 - Administration/Finance Division 09 - Legal Program 4000 Telephone/Internet 1,000.00 .00 1,000.00 15.40 .00 317.65 682.35 32 413.35 4005 Cellular Phones 1,000.00 .00 1,000.00 89.16 .00 743.30 256.70 74 1,101.60 5005 Office Supplies/Postage 10,000.00 .00 10,000.00 436.43 .00 6,534.73 3,465.27 65 6,555.18 5015 Dues & Subscriptions 12,000.00 .00 12,000.00 670.00 .00 7,473.94 4,526.06 62 11,063.71 5020 Gas/Oil/Mileage/Carwash 2,200.00 .00 2,200.00 60.00 .00 1,172.73 1,027.27 53 1,762.01 5095 Uniforms/Clothing 600.00 .00 600.00 .00 .00 368.13 231.87 61 312.50 8035 Maintenance Contracts/Lease 3,000.00 .00 3,000.00 59.85 .00 520.14 2,479.86 17 1,005.16 8060 Vehicle Maintenance 3,000.00 .00 3,000.00 .00 .00 972.81 2,027.19 32 339.23 8065 Legal Fees 15,000.00 .00 15,000.00 1,056.50 .00 5,098.40 9,901.60 34 8,766.00 Division 09 - Legal Program Totals $552,250.00 $0.00 $552,250.00 $24,801.22 $0.00 $297,389.31 $254,860.69 54%$499,424.15 Division 99 - Transfers 9907 Transfer to Tort .00 .00 .00 .00 .00 .00 .00 +++300,000.00 9911 Transfer to Capital Improvements 1,400,000.00 .00 1,400,000.00 .00 .00 .00 1,400,000.00 0 9,285,537.00 Division 99 - Transfers Totals $1,400,000.00 $0.00 $1,400,000.00 $0.00 $0.00 $0.00 $1,400,000.00 0%$9,585,537.00 Unit 04 - Administration/Finance Totals $11,444,970.00 $0.00 $11,444,970.00 $1,249,880.74 $31,803.16 $6,344,757.30 $5,068,409.54 56%$18,543,479.55 Unit 05 - Police Department Division 02 - Administration Program 1005 Salaries-Full Time 293,751.00 .00 293,751.00 (23,194.90).00 207,153.77 86,597.23 71 331,523.52 1015 Salaries-Part Time 35,000.00 .00 35,000.00 1,221.70 .00 11,436.46 23,563.54 33 10,811.43 1800 Salaries-Overtime 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 613.17 2000 FICA 20,445.00 .00 20,445.00 (1,349.53).00 13,252.57 7,192.43 65 17,947.13 2001 Medicare 4,781.00 .00 4,781.00 (315.61).00 3,099.39 1,681.61 65 4,197.32 2010 IMRF 11,690.00 .00 11,690.00 (2,929.55).00 8,138.60 3,551.40 70 13,447.55 2020 Employee Insurance 49,624.00 .00 49,624.00 (5,000.75).00 39,714.70 9,909.30 80 47,272.13 2025 Deferred Comp. Contribution 8,000.00 .00 8,000.00 764.30 .00 7,254.39 745.61 91 3,823.08 3000 Travel/Training 8,500.00 .00 8,500.00 325.00 .00 4,215.51 4,284.49 50 2,314.97 3001 Education/School 3,000.00 .00 3,000.00 .00 .00 .00 3,000.00 0 .00 3015 IL Unemployment Insurance 20,000.00 .00 20,000.00 .00 .00 9,575.24 10,424.76 48 21,862.25 4000 Telephone/Internet 1,100.00 .00 1,100.00 4.32 .00 304.90 795.10 28 431.08 4005 Cellular Phones 1,200.00 .00 1,200.00 84.54 .00 505.32 694.68 42 1,469.56 5005 Office Supplies/Postage 8,000.00 .00 8,000.00 89.39 .00 4,208.35 3,791.65 53 8,180.15 5010 Replacement Supplies 3,500.00 .00 3,500.00 .00 .00 .00 3,500.00 0 762.98 5015 Dues & Subscriptions 6,465.00 .00 6,465.00 914.00 .00 3,895.99 2,569.01 60 4,386.04 5020 Gas/Oil/Mileage/Carwash 3,700.00 .00 3,700.00 128.10 .00 1,374.34 2,325.66 37 2,121.50 5095 Uniforms/Clothing 1,800.00 .00 1,800.00 (199.68).00 765.01 1,034.99 43 6,079.30 8035 Maintenance Contracts/Lease 6,709.00 .00 6,709.00 492.45 .00 2,379.33 4,329.67 35 6,613.68 8040 Custodial Supplies/Building Maintenance 82,500.00 .00 82,500.00 2,275.86 .00 41,513.61 40,986.39 50 78,179.12 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 6 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 62 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 05 - Police Department Division 02 - Administration Program 8060 Vehicle Maintenance 2,500.00 .00 2,500.00 .00 .00 4,465.03 (1,965.03)179 458.09 8135 Contractual Services 8,000.00 .00 8,000.00 .00 .00 2,020.20 5,979.80 25 2,538.00 Division 02 - Administration Program Totals $581,265.00 $0.00 $581,265.00 ($26,690.36)$0.00 $365,272.71 $215,992.29 63%$565,032.05 Division 51 - Police Patrol 1005 Salaries-Full Time 5,264,785.00 .00 5,264,785.00 373,145.48 .00 3,504,880.60 1,759,904.40 67 4,207,687.59 1015 Salaries-Part Time 303,000.00 .00 303,000.00 17,833.01 .00 165,422.48 137,577.52 55 .00 1800 Salaries-Overtime 300,000.00 .00 300,000.00 28,091.50 .00 209,166.38 90,833.62 70 214,372.59 2000 FICA 316,266.00 .00 316,266.00 25,421.71 .00 235,244.68 81,021.32 74 267,790.57 2001 Medicare 73,966.00 .00 73,966.00 5,945.46 .00 55,074.89 18,891.11 74 62,698.26 2010 IMRF 7,549.00 .00 7,549.00 2,685.20 .00 25,639.70 (18,090.70)340 11,690.96 2011 Employer Pension Contributions 1,950,000.00 .00 1,950,000.00 .00 .00 1,940,408.46 9,591.54 100 1,698,688.88 2020 Employee Insurance 779,536.00 .00 779,536.00 51,412.63 .00 562,545.45 216,990.55 72 709,699.14 2025 Deferred Comp. Contribution 140,000.00 .00 140,000.00 .00 .00 .00 140,000.00 0 123,020.47 3000 Travel/Training 50,000.00 .00 50,000.00 10,067.00 .00 38,922.54 11,077.46 78 35,509.35 4000 Telephone/Internet 40,000.00 .00 40,000.00 3,854.51 .00 34,571.52 5,428.48 86 47,936.75 4005 Cellular Phones 7,000.00 .00 7,000.00 632.54 .00 4,677.66 2,322.34 67 5,684.36 5005 Office Supplies/Postage 13,500.00 .00 13,500.00 3,063.80 .00 7,897.01 5,602.99 58 13,217.05 5010 Replacement Supplies 22,500.00 .00 22,500.00 1,558.46 .00 6,702.97 15,797.03 30 19,685.24 5015 Dues & Subscriptions 8,100.00 .00 8,100.00 .00 .00 3,254.00 4,846.00 40 4,192.66 5020 Gas/Oil/Mileage/Carwash 112,250.00 .00 112,250.00 6,264.64 .00 88,272.26 23,977.74 79 113,457.23 5095 Uniforms/Clothing 55,900.00 .00 55,900.00 9,147.67 .00 41,470.76 14,429.24 74 29,198.13 5100 Ammunition/Weapons 32,000.00 .00 32,000.00 .00 15,229.46 3,916.51 12,854.03 60 23,535.05 5115.001 Traffic Program 27,000.00 .00 27,000.00 22.76 .00 16,949.18 10,050.82 63 .00 5115.004 Community Programs-Explorer Program 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 203.92 8003 Radio Maintenance 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 .00 8035 Maintenance Contracts/Lease 11,920.00 .00 11,920.00 59.85 .00 5,214.44 6,705.56 44 8,192.98 8060 Vehicle Maintenance 70,200.00 .00 70,200.00 3,184.93 .00 38,236.82 31,963.18 54 59,977.38 8069 Bike Unit 6,000.00 .00 6,000.00 663.05 .00 5,790.22 209.78 97 .00 8135 Contractual Services 55,000.00 .00 55,000.00 .00 .00 49,223.26 5,776.74 89 49,084.26 8265 Contractual Services-Wescom 640,779.00 .00 640,779.00 52,415.58 .00 524,155.80 116,623.20 82 619,812.48 8267 Animal Control 9,000.00 .00 9,000.00 .00 .00 .00 9,000.00 0 .00 Division 51 - Police Patrol Totals $10,303,251.00 $0.00 $10,303,251.00 $595,469.78 $15,229.46 $7,567,637.59 $2,720,383.95 74%$8,325,335.30 Division 52 - Police Administration 1005 Salaries-Full Time 2,372,648.00 .00 2,372,648.00 226,087.50 .00 1,628,630.36 744,017.64 69 2,027,541.77 1800 Salaries-Overtime 179,000.00 .00 179,000.00 6,848.23 .00 108,512.74 70,487.26 61 188,563.88 2000 FICA 158,202.00 .00 158,202.00 14,107.95 .00 104,812.69 53,389.31 66 136,781.21 2001 Medicare 36,999.00 .00 36,999.00 3,299.40 .00 24,672.53 12,326.47 67 32,156.58 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 7 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 63 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 05 - Police Department Division 52 - Police Administration 2010 IMRF 16,987.00 .00 16,987.00 5,148.63 .00 12,907.23 4,079.77 76 16,252.24 2020 Employee Insurance 391,245.00 .00 391,245.00 37,814.09 .00 291,375.12 99,869.88 74 352,937.12 2025 Deferred Comp. Contribution 65,000.00 .00 65,000.00 .00 .00 .00 65,000.00 0 62,112.93 3000 Travel/Training 31,800.00 .00 31,800.00 1,260.00 .00 14,872.96 16,927.04 47 16,871.22 4000 Telephone/Internet 1,100.00 .00 1,100.00 4.32 .00 306.95 793.05 28 433.00 4005 Cellular Phones 15,000.00 .00 15,000.00 1,044.82 .00 9,219.94 5,780.06 61 14,832.27 5005 Office Supplies/Postage 5,500.00 .00 5,500.00 133.07 .00 3,351.27 2,148.73 61 5,020.84 5010 Replacement Supplies 14,500.00 .00 14,500.00 400.70 .00 2,183.49 12,316.51 15 5,226.59 5015 Dues & Subscriptions 6,700.00 .00 6,700.00 50.00 .00 2,633.98 4,066.02 39 4,128.00 5020 Gas/Oil/Mileage/Carwash 45,000.00 .00 45,000.00 2,656.56 .00 25,575.38 19,424.62 57 41,976.29 5040.002 Crime Scene/Evidence Tech Supply 10,000.00 .00 10,000.00 .00 .00 2,491.88 7,508.12 25 7,640.36 5095 Uniforms/Clothing 19,560.00 .00 19,560.00 415.71 .00 15,149.26 4,410.74 77 17,898.82 5115.002 Community Programs 10,500.00 .00 10,500.00 .00 .00 7,516.43 2,983.57 72 3,582.26 5115.003 Community Prog.-Alcohol/Tobacco 2,500.00 .00 2,500.00 .00 .00 99.22 2,400.78 4 111.77 8003 Radio Maintenance 33,000.00 .00 33,000.00 1,627.26 .00 12,742.78 20,257.22 39 19,535.83 8035 Maintenance Contracts/Lease 4,920.00 .00 4,920.00 59.85 .00 615.59 4,304.41 13 1,887.62 8060 Vehicle Maintenance 30,000.00 .00 30,000.00 2,016.34 .00 10,771.82 19,228.18 36 20,339.95 8135 Contractual Services 92,500.00 .00 92,500.00 .00 .00 .00 92,500.00 0 .00 8245 D.A.R.E. Program 5,000.00 .00 5,000.00 .00 .00 1,283.82 3,716.18 26 5,321.40 8246 Shop with a Cop 10,000.00 .00 10,000.00 .00 .00 15,024.00 (5,024.00)150 12,913.00 8250 Background Check Services 2,500.00 .00 2,500.00 117.00 .00 1,022.50 1,477.50 41 1,670.80 Division 52 - Police Administration Totals $3,560,161.00 $0.00 $3,560,161.00 $303,091.43 $0.00 $2,295,771.94 $1,264,389.06 64%$2,995,735.75 Division 54 - Seizure/Forfeiture 5012 Asset Seizure/Forfeiture Expense 100,000.00 .00 100,000.00 4,194.00 .00 11,778.57 88,221.43 12 12,394.00 5012.030 Asset Seizure/Forfeture-Federal (DOJ Equitable Share).00 .00 .00 .00 .00 7,046.00 (7,046.00)+++10,388.90 Division 54 - Seizure/Forfeiture Totals $100,000.00 $0.00 $100,000.00 $4,194.00 $0.00 $18,824.57 $81,175.43 19%$22,782.90 Division 55 - Police Special Activities 1005.061 Salaries-Special Activities 32,513.00 .00 32,513.00 3,104.78 .00 63,835.57 (31,322.57)196 60,670.16 2000 FICA 2,016.00 .00 2,016.00 188.17 .00 3,807.43 (1,791.43)189 3,549.73 2001 Medicare 471.00 .00 471.00 44.01 .00 903.99 (432.99)192 842.67 Division 55 - Police Special Activities Totals $35,000.00 $0.00 $35,000.00 $3,336.96 $0.00 $68,546.99 ($33,546.99)196%$65,062.56 Division 56 - Police Support Services 1005 Salaries-Full Time 595,261.00 .00 595,261.00 45,291.11 .00 451,021.98 144,239.02 76 909,378.44 1015 Salaries-Part Time 75,880.00 .00 75,880.00 284.54 .00 40,970.08 34,909.92 54 289,964.46 1800 Salaries-Overtime 6,000.00 .00 6,000.00 180.85 .00 3,659.98 2,340.02 61 53,391.80 2000 FICA 41,983.00 .00 41,983.00 2,777.17 .00 30,276.33 11,706.67 72 76,754.88 2001 Medicare 9,819.00 .00 9,819.00 649.52 .00 7,080.79 2,738.21 72 18,046.25 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 8 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 64 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 05 - Police Department Division 56 - Police Support Services 2010 IMRF 40,230.00 .00 40,230.00 2,025.26 .00 22,153.42 18,076.58 55 51,846.37 2020 Employee Insurance 65,418.00 .00 65,418.00 6,823.71 .00 75,331.81 (9,913.81)115 124,839.67 2025 Deferred Comp. Contribution 30,000.00 .00 30,000.00 .00 .00 .00 30,000.00 0 22,397.90 3000 Travel/Training 10,220.00 .00 10,220.00 325.00 .00 2,548.07 7,671.93 25 8,332.68 4000 Telephone/Internet 2,200.00 .00 2,200.00 8.63 .00 609.83 1,590.17 28 1,014.43 4005 Cellular Phones 7,220.00 .00 7,220.00 255.74 .00 1,727.02 5,492.98 24 2,504.11 5005 Office Supplies/Postage 13,750.00 .00 13,750.00 407.30 .00 7,078.95 6,671.05 51 10,870.37 5010 Replacement Supplies 6,500.00 .00 6,500.00 .00 .00 2,651.76 3,848.24 41 1,240.50 5015 Dues & Subscriptions 650.00 .00 650.00 .00 .00 476.50 173.50 73 744.96 5020 Gas/Oil/Mileage/Carwash 5,000.00 .00 5,000.00 326.13 .00 2,320.94 2,679.06 46 36,184.01 5095 Uniforms/Clothing 5,065.00 .00 5,065.00 273.49 .00 1,625.97 3,439.03 32 7,797.29 5115.001 Traffic Program .00 .00 .00 .00 .00 .00 .00 +++22,641.79 8003 Radio Maintenance 500.00 .00 500.00 .00 .00 .00 500.00 0 .00 8035 Maintenance Contracts/Lease 7,660.00 .00 7,660.00 119.70 .00 2,746.03 4,913.97 36 3,982.37 8060 Vehicle Maintenance 4,300.00 .00 4,300.00 .00 .00 719.41 3,580.59 17 26,338.10 8266 Chaplaincy Program 3,000.00 .00 3,000.00 .00 .00 1,433.56 1,566.44 48 1,752.39 8267 Animal Control .00 .00 .00 .00 .00 .00 .00 +++3,300.00 8268 Accreditation 8,000.00 .00 8,000.00 .00 .00 4,595.00 3,405.00 57 7,575.00 Division 56 - Police Support Services Totals $938,656.00 $0.00 $938,656.00 $59,748.15 $0.00 $659,027.43 $279,628.57 70%$1,680,897.77 Division 91 - Capital 9115 Office Furniture & Equipment 10,000.00 .00 10,000.00 1,893.57 .00 6,724.10 3,275.90 67 12,049.30 9120 Machinery and Equipment 181,000.00 .00 181,000.00 .00 19,630.60 45,189.93 116,179.47 36 36,873.02 Division 91 - Capital Totals $191,000.00 $0.00 $191,000.00 $1,893.57 $19,630.60 $51,914.03 $119,455.37 37%$48,922.32 Division 93 - Contingencies 9300 Contingencies 15,000.00 .00 15,000.00 1,317.70 .00 17,945.69 (2,945.69)120 17,620.78 Division 93 - Contingencies Totals $15,000.00 $0.00 $15,000.00 $1,317.70 $0.00 $17,945.69 ($2,945.69)120%$17,620.78 Unit 05 - Police Department Totals $15,724,333.00 $0.00 $15,724,333.00 $942,361.23 $34,860.06 $11,044,940.95 $4,644,531.99 70%$13,721,389.43 Unit 07 - PEMA Division 07 - PEMA Program 3000 Travel/Training 4,000.00 .00 4,000.00 1,199.25 .00 1,407.80 2,592.20 35 1,619.25 4000 Telephone/Internet 16,000.00 .00 16,000.00 657.75 .00 5,107.31 10,892.69 32 7,943.94 4005 Cellular Phones 3,000.00 .00 3,000.00 198.50 .00 1,524.28 1,475.72 51 2,040.34 5005 Office Supplies/Postage 1,000.00 .00 1,000.00 1,235.48 .00 1,294.39 (294.39)129 475.36 5010 Replacement Supplies 6,000.00 .00 6,000.00 752.73 .00 4,507.50 1,492.50 75 944.67 5015 Dues & Subscriptions 4,000.00 .00 4,000.00 29.99 .00 2,267.41 1,732.59 57 5,454.20 5020 Gas/Oil/Mileage/Carwash 8,000.00 .00 8,000.00 180.48 .00 1,432.18 6,567.82 18 3,109.50 5040 Supplies/Hardware 2,000.00 .00 2,000.00 .00 .00 123.05 1,876.95 6 160.00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 9 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 65 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 07 - PEMA Division 07 - PEMA Program 5040.001 Supplies/Hardware-ESDA 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 104.95 5095 Uniforms/Clothing 6,000.00 .00 6,000.00 .00 .00 .00 6,000.00 0 2,644.09 5110 Emergency Operation Center 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 .00 5115 Police Public Relations 3,000.00 .00 3,000.00 2,310.00 .00 2,310.00 690.00 77 1,254.53 5120 Disaster Plan/Exercises/NIMS 3,000.00 .00 3,000.00 .00 .00 .00 3,000.00 0 302.40 8003 Radio Maintenance 16,000.00 .00 16,000.00 1,261.36 .00 1,858.48 14,141.52 12 28,247.31 8020 Building Maintenance 20,000.00 .00 20,000.00 25.73 .00 5,283.46 14,716.54 26 2,572.19 8035 Maintenance Contracts/Lease 1,200.00 .00 1,200.00 59.85 .00 520.14 679.86 43 878.46 8060 Vehicle Maintenance 20,000.00 .00 20,000.00 1,380.00 .00 25,805.05 (5,805.05)129 8,457.02 8069 Bike Unit 1,500.00 .00 1,500.00 76.00 .00 76.00 1,424.00 5 279.95 8125 Siren Maintenance 13,000.00 .00 13,000.00 .00 .00 7,282.36 5,717.64 56 7,259.04 8135 Contractual Services 5,250.00 .00 5,250.00 .00 .00 99.00 5,151.00 2 198.00 8280 Cadet Program 4,500.00 .00 4,500.00 .00 .00 .00 4,500.00 0 4,917.18 8305 PEMA Search and Rescue 3,000.00 .00 3,000.00 75.00 .00 75.00 2,925.00 2 .00 9115 Office Furniture & Equipment 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 .00 9120 Machinery and Equipment 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 .00 9300 Contingencies 3,000.00 .00 3,000.00 1,058.75 .00 2,728.42 271.58 91 2,388.03 Division 07 - PEMA Program Totals $156,450.00 $0.00 $156,450.00 $10,500.87 $0.00 $63,701.83 $92,748.17 41%$81,250.41 Unit 07 - PEMA Totals $156,450.00 $0.00 $156,450.00 $10,500.87 $0.00 $63,701.83 $92,748.17 41%$81,250.41 Unit 08 - Street Department Division 02 - Administration Program 1005 Salaries-Full Time 495,000.00 .00 495,000.00 37,807.27 .00 331,315.36 163,684.64 67 279,513.98 1015 Salaries-Part Time 13,000.00 .00 13,000.00 1,324.87 .00 14,571.36 (1,571.36)112 8,549.96 2000 FICA 31,495.00 .00 31,495.00 2,385.44 .00 20,873.16 10,621.84 66 15,514.76 2001 Medicare 7,365.00 .00 7,365.00 557.91 .00 4,881.80 2,483.20 66 3,628.48 2010 IMRF 55,880.00 .00 55,880.00 3,297.17 .00 27,872.69 28,007.31 50 22,090.74 2020 Employee Insurance 95,000.00 .00 95,000.00 7,605.00 .00 74,330.86 20,669.14 78 44,949.23 2025 Deferred Comp. Contribution 10,000.00 .00 10,000.00 .00 .00 .00 10,000.00 0 3,455.24 3000 Travel/Training 13,000.00 .00 13,000.00 479.59 .00 11,831.63 1,168.37 91 14,857.06 3001 Education/School .00 .00 .00 .00 .00 3,504.32 (3,504.32)+++.00 3015 IL Unemployment Insurance 5,000.00 .00 5,000.00 .00 .00 2,436.43 2,563.57 49 4,904.96 4000 Telephone/Internet 25,000.00 .00 25,000.00 2,094.06 .00 14,741.59 10,258.41 59 16,849.99 4005 Cellular Phones 8,500.00 .00 8,500.00 1,049.31 .00 7,817.60 682.40 92 7,848.59 5005 Office Supplies/Postage 6,000.00 .00 6,000.00 772.74 .00 4,836.85 1,163.15 81 7,646.00 5015 Dues & Subscriptions 4,000.00 .00 4,000.00 313.68 .00 2,861.51 1,138.49 72 4,254.91 5020 Gas/Oil/Mileage/Carwash 500.00 .00 500.00 3.34 .00 24.98 475.02 5 389.41 5040 Supplies/Hardware 1,000.00 .00 1,000.00 574.89 .00 1,133.15 (133.15)113 623.05 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 10 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 66 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 08 - Street Department Division 02 - Administration Program 5095 Uniforms/Clothing .00 .00 .00 (27.83).00 410.50 (410.50)+++.00 8020 Building Maintenance 25,000.00 .00 25,000.00 759.03 .00 12,804.54 12,195.46 51 18,618.51 8050 Legal Notices 2,000.00 .00 2,000.00 .00 .00 1,889.94 110.06 94 2,159.80 Division 02 - Administration Program Totals $797,740.00 $0.00 $797,740.00 $58,996.47 $0.00 $538,138.27 $259,601.73 67%$455,854.67 Division 60 - Street Maintenance Program 1005 Salaries-Full Time 940,000.00 .00 940,000.00 74,302.34 .00 698,351.98 241,648.02 74 917,284.53 1015 Salaries-Part Time 85,000.00 .00 85,000.00 .00 .00 104,320.50 (19,320.50)123 61,715.28 1800 Salaries-Overtime 95,000.00 .00 95,000.00 17,258.89 .00 67,710.07 27,289.93 71 102,655.75 2000 FICA 69,440.00 .00 69,440.00 5,465.60 .00 51,915.99 17,524.01 75 67,274.65 2001 Medicare 16,250.00 .00 16,250.00 1,278.26 .00 12,141.64 4,108.36 75 15,733.57 2010 IMRF 123,200.00 .00 123,200.00 7,563.47 .00 63,798.58 59,401.42 52 94,278.10 2020 Employee Insurance 225,000.00 .00 225,000.00 18,613.10 .00 188,996.95 36,003.05 84 235,394.89 2025 Deferred Comp. Contribution 25,000.00 .00 25,000.00 .00 .00 .00 25,000.00 0 22,337.35 4015 Electricity/Gas 170,000.00 .00 170,000.00 58,415.61 .00 146,311.32 23,688.68 86 124,105.19 5020 Gas/Oil/Mileage/Carwash 80,000.00 .00 80,000.00 4,780.48 .00 55,100.77 24,899.23 69 80,650.81 5040 Supplies/Hardware 20,000.00 .00 20,000.00 1,645.98 .00 17,570.57 2,429.43 88 22,474.93 5040.003 Supplies/Hardware-Salt Purchase 385,000.00 .00 385,000.00 54,863.23 366,348.67 165,943.89 (147,292.56)138 201,684.87 5055 Street Sign Maintenance 60,000.00 .00 60,000.00 1,425.60 .00 11,012.19 48,987.81 18 28,190.11 5060 Aggregate Materials 5,000.00 .00 5,000.00 .00 .00 9,158.16 (4,158.16)183 9,418.55 5095 Uniforms/Clothing 13,000.00 .00 13,000.00 591.56 .00 16,018.58 (3,018.58)123 14,050.93 8003 Radio Maintenance 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 .00 8060 Vehicle Maintenance 40,000.00 .00 40,000.00 3,139.36 .00 27,978.68 12,021.32 70 44,768.69 8130 Street/Traffic Light Maintenance 140,000.00 .00 140,000.00 1,042.47 4,575.00 85,145.69 50,279.31 64 186,682.51 8131 Street Maintenance 190,000.00 .00 190,000.00 .00 .00 133,468.27 56,531.73 70 143,286.14 8132 Storm Sewer Improvements 30,000.00 .00 30,000.00 220.00 .00 17,849.61 12,150.39 59 19,101.70 8135 Contractual Services 200,000.00 .00 200,000.00 209.85 5,735.40 116,901.09 77,363.51 61 138,130.50 8135.004 Snow Removal 550,000.00 .00 550,000.00 26,600.25 .00 34,129.25 515,870.75 6 186,960.52 8150 Sidewalk Maintenance 5,000.00 .00 5,000.00 229.00 .00 7,302.50 (2,302.50)146 2,112.19 8160 Equipment Maintenance 135,000.00 .00 135,000.00 13,482.67 8,775.50 63,956.82 62,267.68 54 122,139.47 Division 60 - Street Maintenance Program Totals $3,606,890.00 $0.00 $3,606,890.00 $291,127.72 $385,434.57 $2,095,083.10 $1,126,372.33 69%$2,840,431.23 Division 62 - Forestry Program 1005 Salaries-Full Time 93,000.00 .00 93,000.00 6,190.06 .00 63,680.09 29,319.91 68 89,710.21 1800 Salaries-Overtime 12,000.00 .00 12,000.00 2,410.30 .00 6,999.55 5,000.45 58 12,775.10 2000 FICA 6,510.00 .00 6,510.00 526.73 .00 4,206.90 2,303.10 65 6,464.09 2001 Medicare 1,525.00 .00 1,525.00 123.20 .00 983.85 541.15 65 1,511.73 2010 IMRF 11,550.00 .00 11,550.00 714.69 .00 5,918.70 5,631.30 51 9,491.39 2020 Employee Insurance 18,000.00 .00 18,000.00 754.56 .00 9,949.87 8,050.13 55 16,195.60 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 11 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 67 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 08 - Street Department Division 62 - Forestry Program 2025 Deferred Comp. Contribution 4,000.00 .00 4,000.00 .00 .00 .00 4,000.00 0 2,299.74 5040 Supplies/Hardware 15,000.00 .00 15,000.00 207.98 .00 10,726.19 4,273.81 72 15,577.47 5095 Uniforms/Clothing 1,500.00 .00 1,500.00 .00 .00 296.93 1,203.07 20 499.87 8135 Contractual Services 30,000.00 .00 30,000.00 1,186.29 .00 18,303.87 11,696.13 61 24,851.79 8135.002 Tree Removal 45,000.00 .00 45,000.00 750.00 .00 9,550.00 35,450.00 21 40,650.00 Division 62 - Forestry Program Totals $238,085.00 $0.00 $238,085.00 $12,863.81 $0.00 $130,615.95 $107,469.05 55%$220,026.99 Division 63 - Vehicle Maintenance Program 1005 Salaries-Full Time 219,000.00 .00 219,000.00 16,732.04 .00 160,532.93 58,467.07 73 207,842.11 1800 Salaries-Overtime 10,000.00 .00 10,000.00 726.03 .00 2,089.61 7,910.39 21 5,069.09 2000 FICA 14,200.00 .00 14,200.00 1,046.21 .00 9,766.82 4,433.18 69 12,863.53 2001 Medicare 3,320.00 .00 3,320.00 244.68 .00 2,284.18 1,035.82 69 3,008.40 2010 IMRF 25,190.00 .00 25,190.00 1,450.75 .00 13,612.78 11,577.22 54 18,904.15 2020 Employee Insurance 40,000.00 .00 40,000.00 3,938.14 .00 41,572.76 (1,572.76)104 42,304.17 2025 Deferred Comp. Contribution 6,000.00 .00 6,000.00 .00 .00 .00 6,000.00 0 4,274.45 Division 63 - Vehicle Maintenance Program Totals $317,710.00 $0.00 $317,710.00 $24,137.85 $0.00 $229,859.08 $87,850.92 72%$294,265.90 Unit 08 - Street Department Totals $4,960,425.00 $0.00 $4,960,425.00 $387,125.85 $385,434.57 $2,993,696.40 $1,581,294.03 68%$3,810,578.79 Unit 09 - Community Development Division 20 - Planning Program 1005 Salaries-Full Time 455,000.00 .00 455,000.00 35,299.13 .00 313,772.71 141,227.29 69 425,716.57 1045 Salaries-Commissioner 7,000.00 .00 7,000.00 360.00 .00 3,940.00 3,060.00 56 4,860.00 1800 Salaries-Overtime 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 .00 2000 FICA 28,765.00 .00 28,765.00 2,158.13 .00 19,353.93 9,411.07 67 26,311.52 2001 Medicare 6,725.00 .00 6,725.00 504.75 .00 4,526.40 2,198.60 67 6,153.51 2010 IMRF 51,040.00 .00 51,040.00 2,933.38 .00 26,230.57 24,809.43 51 37,734.40 2020 Employee Insurance 70,000.00 .00 70,000.00 6,150.28 .00 54,263.03 15,736.97 78 66,919.11 2025 Deferred Comp. Contribution 9,000.00 .00 9,000.00 .00 .00 .00 9,000.00 0 7,362.89 3000 Travel/Training 10,000.00 .00 10,000.00 1,822.71 .00 2,417.71 7,582.29 24 7,300.67 3015 IL Unemployment Insurance 1,000.00 .00 1,000.00 .00 .00 460.46 539.54 46 1,064.06 4000 Telephone/Internet 3,000.00 .00 3,000.00 46.19 .00 952.93 2,047.07 32 1,239.99 4005 Cellular Phones 2,000.00 .00 2,000.00 84.54 .00 675.18 1,324.82 34 1,013.66 5005 Office Supplies/Postage 12,000.00 .00 12,000.00 162.65 .00 2,568.23 9,431.77 21 5,276.33 5015 Dues & Subscriptions 8,000.00 .00 8,000.00 .00 .00 1,930.16 6,069.84 24 1,732.82 5020 Gas/Oil/Mileage/Carwash 750.00 .00 750.00 .00 .00 298.07 451.93 40 67.38 8035 Maintenance Contracts/Lease 2,500.00 .00 2,500.00 59.85 .00 613.50 1,886.50 25 1,042.09 8050 Legal Notices 10,000.00 .00 10,000.00 88.58 .00 7,514.66 2,485.34 75 14,151.14 8060 Vehicle Maintenance 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 .00 8065 Legal Fees 5,000.00 .00 5,000.00 243.75 .00 1,053.00 3,947.00 21 3,593.25 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 12 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 68 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 09 - Community Development Division 20 - Planning Program 8071 Marketing and Promotions 5,000.00 .00 5,000.00 .00 .00 443.97 4,556.03 9 .00 8097 Special Projects and Programs 135,000.00 .00 135,000.00 2,858.86 .00 51,501.08 83,498.92 38 30,494.22 8135 Contractual Services 15,000.00 .00 15,000.00 .00 .00 6,079.76 8,920.24 41 4,153.03 8225 Engineering Fees 20,000.00 .00 20,000.00 893.40 .00 9,859.70 10,140.30 49 5,275.95 Division 20 - Planning Program Totals $859,780.00 $0.00 $859,780.00 $53,666.20 $0.00 $508,455.05 $351,324.95 59%$651,462.59 Division 21 - Building Program 1005 Salaries-Full Time 845,000.00 .00 845,000.00 63,939.60 .00 567,546.26 277,453.74 67 732,510.53 1800 Salaries-Overtime 3,000.00 .00 3,000.00 184.89 .00 1,856.01 1,143.99 62 806.60 2000 FICA 51,770.00 .00 51,770.00 3,886.23 .00 34,551.42 17,218.58 67 44,547.75 2001 Medicare 12,110.00 .00 12,110.00 908.89 .00 8,080.54 4,029.46 67 10,418.41 2010 IMRF 91,850.00 .00 91,850.00 5,324.47 .00 47,449.14 44,400.86 52 65,207.06 2020 Employee Insurance 150,000.00 .00 150,000.00 11,278.86 .00 113,867.59 36,132.41 76 148,880.22 2025 Deferred Comp. Contribution 15,000.00 .00 15,000.00 .00 .00 .00 15,000.00 0 14,180.77 3000 Travel/Training 15,000.00 .00 15,000.00 35.00 .00 5,206.18 9,793.82 35 3,844.76 3015 IL Unemployment Insurance 1,500.00 .00 1,500.00 .00 .00 841.60 658.40 56 1,793.59 4000 Telephone/Internet 1,000.00 .00 1,000.00 15.39 .00 317.63 682.37 32 413.36 4005 Cellular Phones 4,500.00 .00 4,500.00 408.23 .00 2,850.56 1,649.44 63 3,942.73 5005 Office Supplies/Postage 10,000.00 .00 10,000.00 784.09 .00 4,676.95 5,323.05 47 7,998.20 5015 Dues & Subscriptions 3,000.00 .00 3,000.00 .00 .00 260.00 2,740.00 9 515.00 5020 Gas/Oil/Mileage/Carwash 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 .00 5095 Uniforms/Clothing 1,500.00 .00 1,500.00 523.81 .00 2,616.32 (1,116.32)174 378.33 8045 Recording Fees 3,000.00 .00 3,000.00 156.00 .00 832.00 2,168.00 28 1,558.00 8060 Vehicle Maintenance 1,000.00 .00 1,000.00 .00 .00 .00 1,000.00 0 .00 8135 Contractual Services 15,000.00 .00 15,000.00 140.80 .00 651.98 14,348.02 4 30,349.35 Division 21 - Building Program Totals $1,225,230.00 $0.00 $1,225,230.00 $87,586.26 $0.00 $791,604.18 $433,625.82 65%$1,067,344.66 Unit 09 - Community Development Totals $2,085,010.00 $0.00 $2,085,010.00 $141,252.46 $0.00 $1,300,059.23 $784,950.77 62%$1,718,807.25 Unit 50 - Police Commission Division 02 - Administration Program 1015 Salaries-Part Time 6,500.00 .00 6,500.00 .00 .00 1,227.77 5,272.23 19 3,767.88 2000 FICA 341.00 .00 341.00 .00 .00 76.10 264.90 22 216.13 2001 Medicare 80.00 .00 80.00 .00 .00 17.81 62.19 22 50.56 3000 Travel/Training 1,500.00 .00 1,500.00 .00 .00 .00 1,500.00 0 550.00 5005 Office Supplies/Postage 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 762.00 5015 Dues & Subscriptions 600.00 .00 600.00 400.00 .00 400.00 200.00 67 375.00 8065 Legal Fees 5,000.00 .00 5,000.00 .00 .00 .00 5,000.00 0 .00 8071 Marketing and Promotions 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 .00 8115 Police Testing/Hiring 40,000.00 .00 40,000.00 1,595.00 .00 11,855.04 28,144.96 30 30,748.63 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 13 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 69 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 01 - General Fund EXPENSE Unit 50 - Police Commission Division 02 - Administration Program Totals $58,021.00 $0.00 $58,021.00 $1,995.00 $0.00 $13,576.72 $44,444.28 23%$36,470.20 Unit 50 - Police Commission Totals $58,021.00 $0.00 $58,021.00 $1,995.00 $0.00 $13,576.72 $44,444.28 23%$36,470.20 EXPENSE TOTALS $34,429,209.00 $0.00 $34,429,209.00 $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 65%$38,082,764.43 Fund 01 - General Fund Totals REVENUE TOTALS 35,210,485.00 .00 35,210,485.00 2,821,382.23 .00 31,939,193.93 3,271,291.07 91%38,148,409.15 EXPENSE TOTALS 34,429,209.00 .00 34,429,209.00 2,733,116.15 452,097.79 21,760,732.43 12,216,378.78 65%38,082,764.43 Fund 01 - General Fund Totals $781,276.00 $0.00 $781,276.00 $88,266.08 ($452,097.79)$10,178,461.50 ($8,945,087.71)$65,644.72 Fund 02 - Water and Sewer Fund REVENUE 0450.450 Home Rule Sales Tax 3,000,000.00 .00 3,000,000.00 245,595.33 .00 2,304,592.86 695,407.14 77 3,168,756.24 0570.850 Meter Sales 200,000.00 .00 200,000.00 15,600.00 .00 156,210.00 43,790.00 78 242,445.00 0570.851 Water Connection Fee 950,000.00 .00 950,000.00 120,490.00 .00 1,122,077.50 (172,077.50)118 1,459,648.50 0570.852 Sewer Connection Fee 950,000.00 .00 950,000.00 124,800.00 .00 1,223,010.00 (273,010.00)129 2,413,488.00 0570.859 Sewer By-Pass Fee 5,000.00 .00 5,000.00 .00 .00 2,150.00 2,850.00 43 5,805.00 0570.876 Recapture Fee 50,000.00 .00 50,000.00 5,835.27 .00 67,517.67 (17,517.67)135 257,752.87 0620.672 Water Sales 12,900,000.00 .00 12,900,000.00 892,788.89 .00 10,732,209.30 2,167,790.70 83 12,730,856.09 0620.673 Water Penalty 85,000.00 .00 85,000.00 12,215.94 .00 107,370.66 (22,370.66)126 116,694.80 0620.674 Sewer Sales 6,400,000.00 .00 6,400,000.00 469,416.02 .00 5,448,099.00 951,901.00 85 6,496,572.54 0620.675 Sewer Penalty 50,000.00 .00 50,000.00 5,170.25 .00 56,310.92 (6,310.92)113 62,523.27 0620.676 Capital Charge 1,170,000.00 .00 1,170,000.00 100,203.40 .00 996,666.37 173,333.63 85 1,163,800.97 0620.677 Capital Charge Penalty 10,000.00 .00 10,000.00 1,166.88 .00 10,388.17 (388.17)104 12,492.18 0650.818 Tower Rent 24,000.00 .00 24,000.00 4,000.00 .00 20,000.00 4,000.00 83 24,000.00 0700.650 Grant Revenue 980,000.00 .00 980,000.00 .00 .00 .00 980,000.00 0 2,753,042.53 0800.800 Interest Income 150,000.00 .00 150,000.00 53,484.94 .00 715,306.66 (565,306.66)477 835,249.26 0800.827 Unrealized Gain/Loss .00 .00 .00 3,709.14 .00 38,278.55 (38,278.55)+++1,799.51 0800.830 Unrealized Gain/Loss IMET .00 .00 .00 5,769.46 .00 55,246.55 (55,246.55)+++46,819.59 0801.822 Donation/Contribution .00 .00 .00 .00 .00 .00 .00 +++950,175.54 0803.001 Sale of Scrap 500.00 .00 500.00 .00 .00 2,747.00 (2,247.00)549 3,136.00 0805.000 Other Reimbursements 2,500.00 .00 2,500.00 .00 .00 1,330.00 1,170.00 53 7,235.00 0806.000 Other Receipts 25,000.00 .00 25,000.00 .00 .00 9,450.00 15,550.00 38 34,912.31 0950.952 Loan Proceeds 1,909,000.00 .00 1,909,000.00 .00 .00 868,287.06 1,040,712.94 45 1,233,941.45 0999.890 Contra Revenue Account .00 .00 .00 .00 .00 .00 .00 +++(1,004,381.67) 0999.891 Contra Revenue Account-Leases .00 .00 .00 .00 .00 .00 .00 +++21,932.00 REVENUE TOTALS $28,861,000.00 $0.00 $28,861,000.00 $2,060,245.52 $0.00 $23,937,248.27 $4,923,751.73 83%$33,038,696.98 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 14 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 70 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 02 - Water and Sewer Fund EXPENSE Unit 10 - Water Department Division 02 - Administration Program 1005 Salaries-Full Time 285,000.00 .00 285,000.00 18,438.65 .00 174,351.21 110,648.79 61 225,835.17 1015 Salaries-Part Time 6,500.00 .00 6,500.00 662.44 .00 7,285.67 (785.67)112 4,298.55 2000 FICA 18,075.00 .00 18,075.00 1,183.74 .00 11,225.73 6,849.27 62 13,189.97 2001 Medicare 4,225.00 .00 4,225.00 276.84 .00 2,625.59 1,599.41 62 3,084.94 2010 IMRF 32,065.00 .00 32,065.00 1,629.50 .00 14,691.81 17,373.19 46 19,023.71 2020 Employee Insurance 60,000.00 .00 60,000.00 3,838.22 .00 39,885.26 20,114.74 66 43,080.44 2020.001 Contra Insurance Account .00 .00 .00 .00 .00 .00 .00 +++30,139.20 2025 Deferred Comp. Contribution 12,000.00 .00 12,000.00 .00 .00 .00 12,000.00 0 5,737.13 3000 Travel/Training 5,000.00 .00 5,000.00 805.10 .00 1,355.02 3,644.98 27 2,921.84 3015 IL Unemployment Insurance 2,000.00 .00 2,000.00 .00 .00 513.13 1,486.87 26 1,175.27 4000 Telephone/Internet 3,000.00 .00 3,000.00 50.91 .00 321.79 2,678.21 11 638.12 4005 Cellular Phones 5,000.00 .00 5,000.00 540.42 .00 4,577.36 422.64 92 5,207.34 5005 Office Supplies/Postage 35,000.00 .00 35,000.00 3,207.63 .00 27,984.16 7,015.84 80 38,906.83 5015 Dues & Subscriptions 2,000.00 .00 2,000.00 312.68 .00 1,677.13 322.87 84 2,223.73 5020 Gas/Oil/Mileage/Carwash 500.00 .00 500.00 796.60 .00 799.93 (299.93)160 68.38 5040 Supplies/Hardware 500.00 .00 500.00 25.19 .00 538.18 (38.18)108 539.66 5065 Software 2,000.00 .00 2,000.00 .00 .00 179.99 1,820.01 9 .00 5075 Sand & Gravel 2,000.00 .00 2,000.00 3,483.86 .00 3,943.52 (1,943.52)197 1,666.10 5080 Water Meters 325,000.00 .00 325,000.00 5,850.00 .00 224,011.23 100,988.77 69 403,634.62 8020 Building Maintenance 20,000.00 .00 20,000.00 759.01 .00 10,438.66 9,561.34 52 14,959.08 8065 Legal Fees 1,500.00 .00 1,500.00 .00 .00 .00 1,500.00 0 .00 8135 Contractual Services 90,000.00 .00 90,000.00 3,498.89 .00 35,858.66 54,141.34 40 59,713.19 8135.008 Settlement Charges .00 .00 .00 2,731.22 .00 23,367.76 (23,367.76)+++23,601.97 8160 Equipment Maintenance 500.00 .00 500.00 319.00 .00 319.00 181.00 64 18.67 8225 Engineering Fees 40,000.00 .00 40,000.00 3,205.00 .00 12,433.75 27,566.25 31 16,872.53 9330 Change in IMRF Net Pension Liability GASB 68 .00 .00 .00 .00 .00 .00 .00 +++27,137.00 9350 Change in Net OBEB .00 .00 .00 .00 .00 .00 .00 +++(10,740.00) 9401 Administrative Service Charge 175,000.00 .00 175,000.00 .00 .00 87,500.00 87,500.00 50 175,000.00 9903 Transfer to Capital Replacement Fund .00 .00 .00 .00 .00 .00 .00 +++13,599,483.50 9905 Transfer to Debt Service 238,022.00 .00 238,022.00 .00 .00 238,022.00 .00 100 237,275.00 Division 02 - Administration Program Totals $1,364,887.00 $0.00 $1,364,887.00 $51,614.90 $0.00 $923,906.54 $440,980.46 68%$14,944,691.94 Division 30 - Water Distribution Program 1005 Salaries-Full Time 495,000.00 .00 495,000.00 36,524.96 .00 320,796.11 174,203.89 65 375,882.50 1015 Salaries-Part Time 20,000.00 .00 20,000.00 .00 .00 14,322.50 5,677.50 72 5,681.07 1800 Salaries-Overtime 35,000.00 .00 35,000.00 5,019.04 .00 37,538.38 (2,538.38)107 38,558.94 2000 FICA 34,100.00 .00 34,100.00 2,504.78 .00 22,532.13 11,567.87 66 26,152.70 2001 Medicare 7,975.00 .00 7,975.00 585.84 .00 5,269.64 2,705.36 66 6,116.47 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 15 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 71 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 02 - Water and Sewer Fund EXPENSE Unit 10 - Water Department Division 30 - Water Distribution Program 2010 IMRF 60,500.00 .00 60,500.00 3,410.26 .00 29,264.41 31,235.59 48 37,986.37 2020 Employee Insurance 85,000.00 .00 85,000.00 5,291.26 .00 48,630.58 36,369.42 57 64,771.55 2025 Deferred Comp. Contribution 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 11,075.39 4000 Telephone/Internet 5,000.00 .00 5,000.00 84.85 .00 682.09 4,317.91 14 1,531.46 4015 Electricity/Gas 150,000.00 .00 150,000.00 35,128.23 .00 145,996.38 4,003.62 97 124,454.63 5005 Office Supplies/Postage 2,000.00 .00 2,000.00 .00 .00 733.47 1,266.53 37 1,047.33 5010 Replacement Supplies 10,000.00 .00 10,000.00 .00 .00 10,015.83 (15.83)100 11,715.51 5020 Gas/Oil/Mileage/Carwash 20,000.00 .00 20,000.00 522.22 .00 9,350.58 10,649.42 47 14,554.57 5040 Supplies/Hardware 10,000.00 .00 10,000.00 504.55 .00 15,344.00 (5,344.00)153 10,706.92 5070 Chemicals 10,000.00 .00 10,000.00 .00 .00 2,660.30 7,339.70 27 10,039.56 5095 Uniforms/Clothing 5,000.00 .00 5,000.00 .00 .00 3,852.70 1,147.30 77 2,914.21 8020 Building Maintenance 20,000.00 .00 20,000.00 .00 .00 3,295.17 16,704.83 16 1,671.71 8060 Vehicle Maintenance 10,000.00 .00 10,000.00 .00 .00 6,301.63 3,698.37 63 13,270.31 8135 Contractual Services 60,000.00 .00 60,000.00 12,621.85 .00 15,279.88 44,720.12 25 6,832.71 8135.003 Lake Michigan Water Purchase 11,200,000.00 .00 11,200,000.00 904,599.41 .00 8,048,868.23 3,151,131.77 72 11,385,077.26 8160 Equipment Maintenance 10,000.00 .00 10,000.00 191.98 .00 672.79 9,327.21 7 8,605.13 8185 System Maintenance 90,000.00 .00 90,000.00 530.55 .00 68,250.75 21,749.25 76 105,089.06 8194 Water/Fire Hydrant 50,000.00 .00 50,000.00 .00 .00 41,943.27 8,056.73 84 35,550.00 8200 EPA Analytical 30,000.00 .00 30,000.00 1,260.50 .00 22,268.00 7,732.00 74 24,039.51 9305 Capitalized Assets-Cap Outlay .00 .00 .00 .00 .00 .00 .00 +++(5,693,972.27) 9905 Transfer to Debt Service 238,022.00 .00 238,022.00 .00 .00 238,022.00 .00 100 237,275.00 Division 30 - Water Distribution Program Totals $12,677,597.00 $0.00 $12,677,597.00 $1,008,780.28 $0.00 $9,111,890.82 $3,565,706.18 72%$6,866,627.60 Division 93 - Contingencies 9303 Depreciation .00 .00 .00 .00 .00 .00 .00 +++3,596,604.98 9307 Amortization Expense .00 .00 .00 .00 .00 .00 .00 +++56,393.47 9307.002 Amortization Expense-Asset Retirement Obligation (ARO) .00 .00 .00 .00 .00 .00 .00 +++14,323.00 Division 93 - Contingencies Totals $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 +++$3,667,321.45 Unit 10 - Water Department Totals $14,042,484.00 $0.00 $14,042,484.00 $1,060,395.18 $0.00 $10,035,797.36 $4,006,686.64 71%$25,478,640.99 Unit 11 - Sewer Department Division 02 - Administration Program 1005 Salaries-Full Time 285,000.00 .00 285,000.00 18,555.27 .00 174,911.95 110,088.05 61 227,052.38 1015 Salaries-Part Time 6,500.00 .00 6,500.00 662.43 .00 7,285.61 (785.61)112 4,298.49 2000 FICA 18,075.00 .00 18,075.00 1,165.51 .00 11,091.46 6,983.54 61 13,099.63 2001 Medicare 4,225.00 .00 4,225.00 272.53 .00 2,593.80 1,631.20 61 3,063.48 2010 IMRF 32,065.00 .00 32,065.00 1,613.72 .00 14,616.46 17,448.54 46 18,917.63 2020 Employee Insurance 59,000.00 .00 59,000.00 3,867.10 .00 40,962.46 18,037.54 69 43,100.69 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 16 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 72 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 02 - Water and Sewer Fund EXPENSE Unit 11 - Sewer Department Division 02 - Administration Program 2025 Deferred Comp. Contribution 12,000.00 .00 12,000.00 .00 .00 .00 12,000.00 0 5,690.27 3000 Travel/Training 12,000.00 .00 12,000.00 .00 .00 8,051.47 3,948.53 67 12,182.67 3015 IL Unemployment Insurance 2,000.00 .00 2,000.00 .00 .00 572.40 1,427.60 29 1,143.81 4000 Telephone/Internet 3,000.00 .00 3,000.00 50.91 .00 467.55 2,532.45 16 1,106.04 4005 Cellular Phones 3,500.00 .00 3,500.00 302.49 .00 2,408.38 1,091.62 69 2,762.85 5005 Office Supplies/Postage 35,000.00 .00 35,000.00 3,206.82 .00 28,775.69 6,224.31 82 38,571.33 5015 Dues & Subscriptions 70,000.00 .00 70,000.00 .00 .00 64,525.20 5,474.80 92 67,460.11 5020 Gas/Oil/Mileage/Carwash 2,500.00 .00 2,500.00 27.75 .00 31.08 2,468.92 1 207.97 5040 Supplies/Hardware 3,000.00 .00 3,000.00 180.72 .00 700.68 2,299.32 23 1,719.63 8020 Building Maintenance 20,000.00 .00 20,000.00 861.33 .00 11,347.82 8,652.18 57 22,233.85 8065 Legal Fees 1,500.00 .00 1,500.00 .00 .00 .00 1,500.00 0 .00 8135 Contractual Services 65,000.00 .00 65,000.00 3,154.75 .00 27,108.68 37,891.32 42 41,369.24 8135.008 Settlement Charges .00 .00 .00 2,732.03 .00 23,374.75 (23,374.75)+++23,608.39 8160 Equipment Maintenance 2,000.00 .00 2,000.00 .00 .00 .00 2,000.00 0 .00 8225 Engineering Fees 15,000.00 .00 15,000.00 4,931.25 .00 4,966.25 10,033.75 33 15,408.75 9330 Change in IMRF Net Pension Liability GASB 68 .00 .00 .00 .00 .00 .00 .00 +++27,140.00 9350 Change in Net OBEB .00 .00 .00 .00 .00 .00 .00 +++(10,740.00) 9401 Administrative Service Charge 175,000.00 .00 175,000.00 .00 .00 87,500.00 87,500.00 50 175,000.00 9903 Transfer to Capital Replacement Fund .00 .00 .00 .00 .00 .00 .00 +++13,599,483.50 9905 Transfer to Debt Service 238,022.00 .00 238,022.00 .00 .00 238,022.00 .00 100 237,275.00 Division 02 - Administration Program Totals $1,064,387.00 $0.00 $1,064,387.00 $41,584.61 $0.00 $749,313.69 $315,073.31 70%$14,571,155.71 Division 40 - Sewer Treatment Program 1005 Salaries-Full Time 489,000.00 .00 489,000.00 39,229.61 .00 342,095.50 146,904.50 70 398,858.05 1015 Salaries-Part Time 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 5,681.01 1800 Salaries-Overtime 30,000.00 .00 30,000.00 1,357.43 .00 15,145.19 14,854.81 50 20,601.88 2000 FICA 33,420.00 .00 33,420.00 2,439.57 .00 21,411.41 12,008.59 64 26,055.96 2001 Medicare 7,815.00 .00 7,815.00 570.55 .00 5,007.30 2,807.70 64 6,093.64 2010 IMRF 59,290.00 .00 59,290.00 3,361.10 .00 29,363.59 29,926.41 50 38,094.68 2020 Employee Insurance 90,000.00 .00 90,000.00 5,760.38 .00 60,527.44 29,472.56 67 67,241.20 2025 Deferred Comp. Contribution 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 11,033.29 4000 Telephone/Internet 5,000.00 .00 5,000.00 84.86 .00 1,132.64 3,867.36 23 2,977.81 4015 Electricity/Gas 575,000.00 .00 575,000.00 81,361.07 .00 329,663.83 245,336.17 57 415,065.68 5005 Office Supplies/Postage 3,000.00 .00 3,000.00 .00 .00 4,068.15 (1,068.15)136 1,936.52 5010 Replacement Supplies 5,000.00 .00 5,000.00 933.04 .00 4,856.20 143.80 97 4,496.62 5020 Gas/Oil/Mileage/Carwash 15,000.00 .00 15,000.00 35.00 .00 3,803.63 11,196.37 25 15,016.27 5040 Supplies/Hardware 15,000.00 .00 15,000.00 358.96 .00 6,524.53 8,475.47 43 12,391.85 5070 Chemicals 180,000.00 .00 180,000.00 6,470.60 .00 105,969.22 74,030.78 59 126,717.27 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 17 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 73 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 02 - Water and Sewer Fund EXPENSE Unit 11 - Sewer Department Division 40 - Sewer Treatment Program 5075 Sand & Gravel 500.00 .00 500.00 .00 .00 .00 500.00 0 .00 5085 Industrial Flow Monitor 7,000.00 .00 7,000.00 312.00 .00 2,574.00 4,426.00 37 3,807.00 5095 Uniforms/Clothing 8,000.00 .00 8,000.00 118.37 .00 3,428.44 4,571.56 43 7,085.36 8060 Vehicle Maintenance 10,000.00 .00 10,000.00 .00 .00 3,311.23 6,688.77 33 5,828.10 8135 Contractual Services 300,000.00 .00 300,000.00 1,840.26 .00 194,601.73 105,398.27 65 184,599.69 8160 Equipment Maintenance 30,000.00 .00 30,000.00 4,072.10 .00 16,579.58 13,420.42 55 8,163.41 8185 System Maintenance 120,000.00 .00 120,000.00 1,894.02 .00 18,017.30 101,982.70 15 43,181.29 9905 Transfer to Debt Service 238,022.00 .00 238,022.00 .00 .00 238,022.00 .00 100 237,275.00 Division 40 - Sewer Treatment Program Totals $2,261,047.00 $0.00 $2,261,047.00 $150,198.92 $0.00 $1,406,102.91 $854,944.09 62%$1,642,201.58 Unit 11 - Sewer Department Totals $3,325,434.00 $0.00 $3,325,434.00 $191,783.53 $0.00 $2,155,416.60 $1,170,017.40 65%$16,213,357.29 Unit 12 - Utility Expansion Division 91 - Capital 8133.008 Old Town Reconstruction 3,000,000.00 .00 3,000,000.00 66,230.33 .00 1,450,809.74 1,549,190.26 48 2,121,841.06 8133.009 143rd St. West Extension-Watermain 3,200,000.00 .00 3,200,000.00 .00 .00 6,635.76 3,193,364.24 0 3,363.75 8134.001 Lift Station Improvements 500,000.00 .00 500,000.00 1,710.00 .00 620,565.22 (120,565.22)124 237,099.26 8134.003 Tower Improvements 2,300,000.00 .00 2,300,000.00 .00 .00 .00 2,300,000.00 0 35,738.00 8135 Contractual Services 200,000.00 .00 200,000.00 .00 .00 360.00 199,640.00 0 56,632.02 8225 Engineering Fees 175,000.00 .00 175,000.00 .00 .00 11,784.00 163,216.00 7 55,932.50 9120 Machinery and Equipment 500,000.00 .00 500,000.00 .00 .00 50,685.00 449,315.00 10 513,364.46 9120.200 Machinery and Equipment-ARPA Project-Aeration Blower .00 .00 .00 .00 .00 .00 .00 +++2,753,042.53 9125 Vehicles 100,000.00 .00 100,000.00 .00 .00 70,268.74 29,731.26 70 58,963.50 Division 91 - Capital Totals $9,975,000.00 $0.00 $9,975,000.00 $67,940.33 $0.00 $2,211,108.46 $7,763,891.54 22%$5,835,977.08 Division 92 - Bonds 9200.032 2015 Refunding-2008 Bond (Principal)725,000.00 .00 725,000.00 .00 .00 .00 725,000.00 0 700,000.00 9200.033 2015 Refunding-2008 Bond (Interest)393,750.00 .00 393,750.00 .00 .00 196,875.00 196,875.00 50 422,750.00 9201.001 IEPA Loan (Principal)169,640.00 .00 169,640.00 .00 .00 169,640.34 (.34)100 167,539.55 9201.002 IEPA Loan (Interest)18,367.00 .00 18,367.00 .00 .00 18,366.76 .24 100 19,682.20 9201.003 IEPA Loan L174666 (Principal)146,096.00 .00 146,096.00 .00 .00 81,751.25 64,344.75 56 89,265.69 9201.004 IEPA Loan L174666 (Interest)41,921.00 .00 41,921.00 .00 .00 23,812.95 18,108.05 57 28,695.79 9299 Contra Debt Expense .00 .00 .00 .00 .00 .00 .00 +++(956,805.24) Division 92 - Bonds Totals $1,494,774.00 $0.00 $1,494,774.00 $0.00 $0.00 $490,446.30 $1,004,327.70 33%$471,127.99 Unit 12 - Utility Expansion Totals $11,469,774.00 $0.00 $11,469,774.00 $67,940.33 $0.00 $2,701,554.76 $8,768,219.24 24%$6,307,105.07 EXPENSE TOTALS $28,837,692.00 $0.00 $28,837,692.00 $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 52%$47,999,103.35 Fund 02 - Water and Sewer Fund Totals REVENUE TOTALS 28,861,000.00 .00 28,861,000.00 2,060,245.52 .00 23,937,248.27 4,923,751.73 83%33,038,696.98 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 18 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 74 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total EXPENSE TOTALS 28,837,692.00 .00 28,837,692.00 1,320,119.04 .00 14,892,768.72 13,944,923.28 52%47,999,103.35 Fund 02 - Water and Sewer Fund Totals $23,308.00 $0.00 $23,308.00 $740,126.48 $0.00 $9,044,479.55 ($9,021,171.55)($14,960,406.37) Fund 03 - Capital Replacement Fund REVENUE 0800.800 Interest Income .00 .00 .00 110,287.61 .00 496,700.31 (496,700.31)+++53,990.93 0800.827 Unrealized Gain/Loss .00 .00 .00 (2,671.24).00 16,757.56 (16,757.56)+++(10,071.35) 0800.830 Unrealized Gain/Loss IMET .00 .00 .00 .00 .00 (14,454.48)14,454.48 +++.00 0999.902 Transfer From Water and Sewer .00 .00 .00 .00 .00 .00 .00 +++27,198,967.00 REVENUE TOTALS $0.00 $0.00 $0.00 $107,616.37 $0.00 $499,003.39 ($499,003.39)+++$27,242,886.58 Fund 03 - Capital Replacement Fund Totals REVENUE TOTALS .00 .00 .00 107,616.37 .00 499,003.39 (499,003.39)+++27,242,886.58 EXPENSE TOTALS .00 .00 .00 .00 .00 .00 .00 +++.00 Fund 03 - Capital Replacement Fund Totals $0.00 $0.00 $0.00 $107,616.37 $0.00 $499,003.39 ($499,003.39)$27,242,886.58 Fund 04 - Motor Fuel Tax REVENUE 0450.457 MFT Entitlements 1,775,000.00 .00 1,775,000.00 174,704.56 .00 1,668,450.62 106,549.38 94 1,756,981.00 0700.650 Grant Revenue .00 .00 .00 .00 .00 .00 .00 +++434,757.27 0800.800 Interest Income 75,000.00 .00 75,000.00 23,789.83 .00 212,947.36 (137,947.36)284 156,475.74 REVENUE TOTALS $1,850,000.00 $0.00 $1,850,000.00 $198,494.39 $0.00 $1,881,397.98 ($31,397.98)102%$2,348,214.01 EXPENSE Unit 00 - Non-Departmental Division 91 - Capital 9150 Street Improvements 2,500,000.00 .00 2,500,000.00 .00 .00 1,911,291.56 588,708.44 76 2,287,108.05 9150.001 127th St & Plfd-Naper Rd 2,000,000.00 .00 2,000,000.00 .00 .00 312,650.62 1,687,349.38 16 .00 Division 91 - Capital Totals $4,500,000.00 $0.00 $4,500,000.00 $0.00 $0.00 $2,223,942.18 $2,276,057.82 49%$2,287,108.05 Unit 00 - Non-Departmental Totals $4,500,000.00 $0.00 $4,500,000.00 $0.00 $0.00 $2,223,942.18 $2,276,057.82 49%$2,287,108.05 EXPENSE TOTALS $4,500,000.00 $0.00 $4,500,000.00 $0.00 $0.00 $2,223,942.18 $2,276,057.82 49%$2,287,108.05 Fund 04 - Motor Fuel Tax Totals REVENUE TOTALS 1,850,000.00 .00 1,850,000.00 198,494.39 .00 1,881,397.98 (31,397.98)102%2,348,214.01 EXPENSE TOTALS 4,500,000.00 .00 4,500,000.00 .00 .00 2,223,942.18 2,276,057.82 49%2,287,108.05 Fund 04 - Motor Fuel Tax Totals ($2,650,000.00)$0.00 ($2,650,000.00)$198,494.39 $0.00 ($342,544.20)($2,307,455.80)$61,105.96 Fund 05 - Bond and Interest Fund REVENUE 0999.902 Transfer From Water and Sewer 952,088.00 .00 952,088.00 .00 .00 952,088.00 .00 100 949,100.00 0999.911 Transfer From Capital 2,045,399.00 .00 2,045,399.00 .00 .00 2,045,399.00 .00 100 2,045,191.00 REVENUE TOTALS $2,997,487.00 $0.00 $2,997,487.00 $0.00 $0.00 $2,997,487.00 $0.00 100%$2,994,291.00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 19 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 75 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 05 - Bond and Interest Fund EXPENSE Unit 00 - Non-Departmental Division 92 - Bonds 9200.030 2014 Refunding- 2007 Bond (Principal)1,095,000.00 .00 1,095,000.00 .00 .00 1,095,000.00 .00 100 1,060,000.00 9200.031 2014 Refunding- 2007 Bond (Interest)145,350.00 .00 145,350.00 .00 .00 145,350.00 .00 100 177,150.00 9200.034 2020 Refunding-2010 Bond (Principal)945,000.00 .00 945,000.00 .00 .00 945,000.00 .00 100 935,000.00 9200.035 2020 Refunding-2010 Bond (Interest)7,088.00 .00 7,088.00 (669.38).00 5,814.27 1,273.73 82 13,607.08 9200.036 2021 Refunding-2012 Bond (Principal)795,000.00 .00 795,000.00 .00 .00 795,000.00 .00 100 790,000.00 9200.037 2021 Refunding-2012 Bond (Interest)10,049.00 .00 10,049.00 .00 .00 10,048.50 .50 100 18,531.45 Division 92 - Bonds Totals $2,997,487.00 $0.00 $2,997,487.00 ($669.38)$0.00 $2,996,212.77 $1,274.23 100%$2,994,288.53 Unit 00 - Non-Departmental Totals $2,997,487.00 $0.00 $2,997,487.00 ($669.38)$0.00 $2,996,212.77 $1,274.23 100%$2,994,288.53 EXPENSE TOTALS $2,997,487.00 $0.00 $2,997,487.00 ($669.38)$0.00 $2,996,212.77 $1,274.23 100%$2,994,288.53 Fund 05 - Bond and Interest Fund Totals REVENUE TOTALS 2,997,487.00 .00 2,997,487.00 .00 .00 2,997,487.00 .00 100%2,994,291.00 EXPENSE TOTALS 2,997,487.00 .00 2,997,487.00 (669.38).00 2,996,212.77 1,274.23 100%2,994,288.53 Fund 05 - Bond and Interest Fund Totals $0.00 $0.00 $0.00 $669.38 $0.00 $1,274.23 ($1,274.23)$2.47 Fund 07 - Tort Immunity Fund REVENUE 0400.401 Property Tax Revenue 825,000.00 .00 825,000.00 .00 .00 820,908.98 4,091.02 100 685,178.51 0805.000 Other Reimbursements .00 .00 .00 .00 .00 13,719.62 (13,719.62)+++.00 0999.901 Transfer From General .00 .00 .00 .00 .00 .00 .00 +++300,000.00 REVENUE TOTALS $825,000.00 $0.00 $825,000.00 $0.00 $0.00 $834,628.60 ($9,628.60)101%$985,178.51 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8275 Bond-Treasurer 336.00 .00 336.00 .00 .00 .00 336.00 0 .00 8300 Commercial Umbrella Liability 525,000.00 .00 525,000.00 .00 .00 399,328.00 125,672.00 76 437,163.00 8310 Workman's Compensation Ins.360,000.00 .00 360,000.00 .00 .00 313,374.00 46,626.00 87 310,637.00 Division 00 - Non-Divisional Totals $885,336.00 $0.00 $885,336.00 $0.00 $0.00 $712,702.00 $172,634.00 81%$747,800.00 Unit 00 - Non-Departmental Totals $885,336.00 $0.00 $885,336.00 $0.00 $0.00 $712,702.00 $172,634.00 81%$747,800.00 EXPENSE TOTALS $885,336.00 $0.00 $885,336.00 $0.00 $0.00 $712,702.00 $172,634.00 81%$747,800.00 Fund 07 - Tort Immunity Fund Totals REVENUE TOTALS 825,000.00 .00 825,000.00 .00 .00 834,628.60 (9,628.60)101%985,178.51 EXPENSE TOTALS 885,336.00 .00 885,336.00 .00 .00 712,702.00 172,634.00 81%747,800.00 Fund 07 - Tort Immunity Fund Totals ($60,336.00)$0.00 ($60,336.00)$0.00 $0.00 $121,926.60 ($182,262.60)$237,378.51 Fund 08 - Audit Fund REVENUE 0400.401 Property Tax Revenue 50,000.00 .00 50,000.00 .00 .00 50,866.83 (866.83)102 51,599.80 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 20 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 76 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 08 - Audit Fund REVENUE TOTALS $50,000.00 $0.00 $50,000.00 $0.00 $0.00 $50,866.83 ($866.83)102%$51,599.80 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8315 Audit Village 47,000.00 .00 47,000.00 .00 .00 45,140.00 1,860.00 96 43,825.00 Division 00 - Non-Divisional Totals $47,000.00 $0.00 $47,000.00 $0.00 $0.00 $45,140.00 $1,860.00 96%$43,825.00 Unit 00 - Non-Departmental Totals $47,000.00 $0.00 $47,000.00 $0.00 $0.00 $45,140.00 $1,860.00 96%$43,825.00 EXPENSE TOTALS $47,000.00 $0.00 $47,000.00 $0.00 $0.00 $45,140.00 $1,860.00 96%$43,825.00 Fund 08 - Audit Fund Totals REVENUE TOTALS 50,000.00 .00 50,000.00 .00 .00 50,866.83 (866.83)102%51,599.80 EXPENSE TOTALS 47,000.00 .00 47,000.00 .00 .00 45,140.00 1,860.00 96%43,825.00 Fund 08 - Audit Fund Totals $3,000.00 $0.00 $3,000.00 $0.00 $0.00 $5,726.83 ($2,726.83)$7,774.80 Fund 10 - Police Pension Fund REVENUE 0800.800 Interest Income 650,000.00 .00 650,000.00 12,951.89 .00 248,906.39 401,093.61 38 1,237,626.80 0800.824 Realized Gain/Loss-SawyerFalduto 300,000.00 .00 300,000.00 .00 .00 .00 300,000.00 0 (41,654.43) 0800.829 Unrealized Gain/Loss Sawyer/Fald 200,000.00 .00 200,000.00 .00 .00 .00 200,000.00 0 (2,890,480.46) 0800.835 Realized Gain/Loss-State Street-IPPIF Consolidated Pool .00 .00 .00 37,907.68 .00 61,078.89 (61,078.89)+++1,295,376.11 0800.837 Unrealized Gain/Loss-State Street-IPPIF Consolidated Pool .00 .00 .00 (258,540.14).00 3,248,004.09 (3,248,004.09)+++426,378.53 0806.000 Other Receipts .00 .00 .00 50.00 .00 100.00 (100.00)+++100.00 0818.000 Employee Contributions 695,000.00 .00 695,000.00 50,750.38 .00 640,429.43 54,570.57 92 865,975.35 0819.000 Employer Contributions 1,950,000.00 .00 1,950,000.00 .00 .00 1,940,408.46 9,591.54 100 1,698,688.88 REVENUE TOTALS $3,795,000.00 $0.00 $3,795,000.00 ($156,880.19)$0.00 $6,138,927.26 ($2,343,927.26)162%$2,592,010.78 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 3000 Travel/Training 5,000.00 .00 5,000.00 .00 .00 3,010.73 1,989.27 60 3,856.52 5005 Office Supplies/Postage 500.00 .00 500.00 .00 .00 .00 500.00 0 .00 5015 Dues & Subscriptions 8,500.00 .00 8,500.00 .00 .00 795.00 7,705.00 9 795.00 8135 Contractual Services 40,000.00 .00 40,000.00 5,979.12 .00 37,898.47 2,101.53 95 56,514.13 8137 Investment Expense 150,000.00 .00 150,000.00 1,580.46 .00 24,474.66 125,525.34 16 130,459.12 8320 IDOI Filing Fee .00 .00 .00 .00 .00 .00 .00 +++8,000.00 8330 Pension Payments 1,250,000.00 .00 1,250,000.00 127,745.20 .00 1,106,684.97 143,315.03 89 1,180,295.18 Division 00 - Non-Divisional Totals $1,454,000.00 $0.00 $1,454,000.00 $135,304.78 $0.00 $1,172,863.83 $281,136.17 81%$1,379,919.95 Unit 00 - Non-Departmental Totals $1,454,000.00 $0.00 $1,454,000.00 $135,304.78 $0.00 $1,172,863.83 $281,136.17 81%$1,379,919.95 EXPENSE TOTALS $1,454,000.00 $0.00 $1,454,000.00 $135,304.78 $0.00 $1,172,863.83 $281,136.17 81%$1,379,919.95 Fund 10 - Police Pension Fund Totals Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 21 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 77 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total REVENUE TOTALS 3,795,000.00 .00 3,795,000.00 (156,880.19).00 6,138,927.26 (2,343,927.26)162%2,592,010.78 EXPENSE TOTALS 1,454,000.00 .00 1,454,000.00 135,304.78 .00 1,172,863.83 281,136.17 81%1,379,919.95 Fund 10 - Police Pension Fund Totals $2,341,000.00 $0.00 $2,341,000.00 ($292,184.97)$0.00 $4,966,063.43 ($2,625,063.43)$1,212,090.83 Fund 11 - Capital Improvement Fund REVENUE 0450.450 Home Rule Sales Tax 6,150,000.00 .00 6,150,000.00 491,264.36 .00 4,609,877.20 1,540,122.80 75 6,338,463.18 0500.502 Utility Tax 3,225,000.00 .00 3,225,000.00 286,241.53 .00 2,043,312.78 1,181,687.22 63 3,295,634.57 0500.503 Local Motor Fuel Tax 700,000.00 .00 700,000.00 65,602.49 .00 533,029.01 166,970.99 76 716,571.09 0570.853 Annexation/Impact Fee 30,000.00 .00 30,000.00 20,258.06 .00 107,252.76 (77,252.76)358 105,275.17 0570.855 Traffic Signal Impact Fee .00 .00 .00 127,030.00 .00 127,030.00 (127,030.00)+++.00 0570.860 Traffic Impact Fee 75,000.00 .00 75,000.00 21,287.50 .00 854,556.25 (779,556.25)1139 133,174.50 0570.861 Municipal Facilities Fee 25,000.00 .00 25,000.00 13,500.00 .00 78,000.00 (53,000.00)312 78,000.00 0570.863 Greenbelt Contribution .00 .00 .00 25,390.00 .00 25,390.00 (25,390.00)+++.00 0570.876 Recapture Fee 10,000.00 .00 10,000.00 .00 .00 310.84 9,689.16 3 315,991.75 0650.670 Impound Fee 25,000.00 .00 25,000.00 750.00 .00 14,500.00 10,500.00 58 31,250.00 0650.673 Daily Storage Fee for Impound 3,000.00 .00 3,000.00 .00 .00 1,350.00 1,650.00 45 7,975.00 0650.675 Red Light Fines 375,000.00 .00 375,000.00 30,200.00 .00 321,006.00 53,994.00 86 370,105.00 0700.100 143rd St Grant(IDOT Reimbursement)8,800,000.00 .00 8,800,000.00 .00 .00 .00 8,800,000.00 0 815,198.80 0700.650 Grant Revenue 1,665,000.00 .00 1,665,000.00 174,004.18 .00 392,791.78 1,272,208.22 24 302,282.92 0700.736 STP Grant 1,500,000.00 .00 1,500,000.00 .00 .00 .00 1,500,000.00 0 .00 0800.800 Interest Income 250,000.00 .00 250,000.00 114,461.04 .00 999,505.62 (749,505.62)400 536,550.58 0800.826 Realized Gain/Loss On Investment .00 .00 .00 1,360.98 .00 1,360.98 (1,360.98)+++.00 0800.827 Unrealized Gain/Loss .00 .00 .00 (8,810.75).00 10,038.63 (10,038.63)+++(8,650.33) 0803.000 Sales-Fixed Assets 5,000.00 .00 5,000.00 .00 .00 53,336.03 (48,336.03)1067 1,500.00 0805.000 Other Reimbursements 1,050,000.00 .00 1,050,000.00 .00 .00 1,000,000.00 50,000.00 95 114,020.38 0806.000 Other Receipts 95,000.00 .00 95,000.00 .00 .00 625,544.44 (530,544.44)658 775.00 0999.901 Transfer From General 1,400,000.00 .00 1,400,000.00 .00 .00 .00 1,400,000.00 0 9,285,537.00 REVENUE TOTALS $25,383,000.00 $0.00 $25,383,000.00 $1,362,539.39 $0.00 $11,798,192.32 $13,584,807.68 46%$22,439,654.61 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8135 Contractual Services 110,000.00 .00 110,000.00 9,264.65 .00 64,600.85 45,399.15 59 110,651.27 Division 00 - Non-Divisional Totals $110,000.00 $0.00 $110,000.00 $9,264.65 $0.00 $64,600.85 $45,399.15 59%$110,651.27 Division 91 - Capital 8078 Economic Incentive Rebate .00 .00 .00 .00 .00 .00 .00 +++138,423.92 8140.001 Transportation Plan-Capital .00 .00 .00 .00 .00 .00 .00 +++139,226.45 8225 Engineering Fees 100,000.00 .00 100,000.00 1,382.50 .00 56,685.74 43,314.26 57 82,473.04 9105 Building Improvements 750,000.00 .00 750,000.00 35,740.92 180,231.00 356,169.82 213,599.18 72 393,633.85 9105.005 Building Improvements-Police .00 .00 .00 .00 .00 .00 .00 +++46,970.38 9105.007 Building Improvements-PEMA 350,000.00 .00 350,000.00 .00 .00 237,104.26 112,895.74 68 .00 9107.002 127th St-Plfd/Naperville Rd .00 .00 .00 .00 .00 .00 .00 +++136,471.67 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 22 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 78 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 11 - Capital Improvement Fund EXPENSE Unit 00 - Non-Departmental Division 91 - Capital 9107.007 119th Street/Rt. 30 .00 .00 .00 .00 .00 .00 .00 +++1,749.79 9112 Sidewalk Curb & Bikepath Replace 700,000.00 .00 700,000.00 178,425.10 .00 485,854.22 214,145.78 69 429,707.66 9120.005 Machinery and Equipment-Police 350,000.00 .00 350,000.00 4,574.65 .00 433,449.53 (83,449.53)124 202,557.79 9120.008 Machinery and Equipment-PW/Community Development 450,000.00 .00 450,000.00 .00 4,085.00 285,278.09 160,636.91 64 723,698.73 9120.050 Machinery and Equipment-Police Body Camera- Reserved 163,000.00 .00 163,000.00 139,932.15 116,360.84 148,731.41 (102,092.25)163 116,255.44 9152.001 Street Lights-Replacement 125,000.00 .00 125,000.00 .00 .00 .00 125,000.00 0 33,830.00 9152.004 Settler's Park-Campus Refresh 50,000.00 .00 50,000.00 .00 .00 7,498.28 42,501.72 15 3,756.10 9152.008 Pond Drainage 40,000.00 .00 40,000.00 .00 .00 812.50 39,187.50 2 .00 9152.009 Grade Crossing Elimination Study 100,000.00 .00 100,000.00 .00 .00 .00 100,000.00 0 .00 9152.010 Gateway Signage 200,000.00 .00 200,000.00 .00 .00 .00 200,000.00 0 .00 9152.011 Riverfront Engineering(OSLAD)75,000.00 .00 75,000.00 11,832.50 .00 41,969.16 33,030.84 56 .00 9155 Bridge Repairs & Reconstruction 1,025,000.00 .00 1,025,000.00 2,200.00 .00 74,119.08 950,880.92 7 12,586.10 9156 Storm & Drainage Improvements 40,000.00 .00 40,000.00 3,886.25 .00 62,191.25 (22,191.25)155 75,577.84 9164 Pavement Patching 125,000.00 .00 125,000.00 .00 .00 5,844.50 119,155.50 5 117,009.56 9165 Roadway Improvements 2,750,000.00 .00 2,750,000.00 211,872.19 .00 2,661,753.53 88,246.47 97 3,083,652.93 9165.009 143rd St. East Extension 8,100,000.00 .00 8,100,000.00 149,694.55 .00 9,698,273.82 (1,598,273.82)120 1,848,838.52 9165.019 I-55 Interchange Design 40,000.00 .00 40,000.00 .00 .00 .00 40,000.00 0 .00 9165.027 Lockport St. Bybass 250,000.00 .00 250,000.00 .00 .00 27,326.17 222,673.83 11 .00 9165.028 Renwick Corridor 325,000.00 .00 325,000.00 23,447.52 .00 187,722.52 137,277.48 58 63,995.93 9165.033 143rd Street-West Extension 8,000,000.00 .00 8,000,000.00 16,553.50 .00 93,722.00 7,906,278.00 1 128,279.18 9165.034 Old Town Reconstruction .00 .00 .00 .00 .00 16,342.50 (16,342.50)+++.00 9180.001 Beautification Improvements 150,000.00 .00 150,000.00 .00 .00 3,077.50 146,922.50 2 73,069.52 Division 91 - Capital Totals $24,258,000.00 $0.00 $24,258,000.00 $779,541.83 $300,676.84 $14,883,925.88 $9,073,397.28 63%$7,851,764.40 Division 99 - Transfers 9905 Transfer to Debt Service 2,045,399.00 .00 2,045,399.00 .00 .00 2,045,399.00 .00 100 2,045,191.00 Division 99 - Transfers Totals $2,045,399.00 $0.00 $2,045,399.00 $0.00 $0.00 $2,045,399.00 $0.00 100%$2,045,191.00 Unit 00 - Non-Departmental Totals $26,413,399.00 $0.00 $26,413,399.00 $788,806.48 $300,676.84 $16,993,925.73 $9,118,796.43 65%$10,007,606.67 EXPENSE TOTALS $26,413,399.00 $0.00 $26,413,399.00 $788,806.48 $300,676.84 $16,993,925.73 $9,118,796.43 65%$10,007,606.67 Fund 11 - Capital Improvement Fund Totals REVENUE TOTALS 25,383,000.00 .00 25,383,000.00 1,362,539.39 .00 11,798,192.32 13,584,807.68 46%22,439,654.61 EXPENSE TOTALS 26,413,399.00 .00 26,413,399.00 788,806.48 300,676.84 16,993,925.73 9,118,796.43 65%10,007,606.67 Fund 11 - Capital Improvement Fund Totals ($1,030,399.00)$0.00 ($1,030,399.00)$573,732.91 ($300,676.84)($5,195,733.41)$4,466,011.25 $12,432,047.94 Fund 14 - D.A.R.E. Fund REVENUE 0800.800 Interest Income 100.00 .00 100.00 15.41 .00 105.46 (5.46)105 152.71 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 23 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 79 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 14 - D.A.R.E. Fund REVENUE 0801.840 DARE Contribution 15,000.00 .00 15,000.00 .00 .00 8,741.50 6,258.50 58 13,748.89 REVENUE TOTALS $15,100.00 $0.00 $15,100.00 $15.41 $0.00 $8,846.96 $6,253.04 59%$13,901.60 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8245 D.A.R.E. Program 20,000.00 .00 20,000.00 .00 .00 5,859.94 14,140.06 29 18,223.93 Division 00 - Non-Divisional Totals $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $5,859.94 $14,140.06 29%$18,223.93 Unit 00 - Non-Departmental Totals $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $5,859.94 $14,140.06 29%$18,223.93 EXPENSE TOTALS $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $5,859.94 $14,140.06 29%$18,223.93 Fund 14 - D.A.R.E. Fund Totals REVENUE TOTALS 15,100.00 .00 15,100.00 15.41 .00 8,846.96 6,253.04 59%13,901.60 EXPENSE TOTALS 20,000.00 .00 20,000.00 .00 .00 5,859.94 14,140.06 29%18,223.93 Fund 14 - D.A.R.E. Fund Totals ($4,900.00)$0.00 ($4,900.00)$15.41 $0.00 $2,987.02 ($7,887.02)($4,322.33) Fund 17 - Tax Increment Financing-Downtown REVENUE 0400.401 Property Tax Revenue 750,000.00 .00 750,000.00 .00 .00 752,596.43 (2,596.43)100 747,530.96 0800.800 Interest Income 500.00 .00 500.00 .00 .00 .00 500.00 0 .00 REVENUE TOTALS $750,500.00 $0.00 $750,500.00 $0.00 $0.00 $752,596.43 ($2,096.43)100%$747,530.96 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8077 Property Tax Rebate 350,000.00 .00 350,000.00 352,258.92 .00 352,258.92 (2,258.92)101 350,222.22 Division 00 - Non-Divisional Totals $350,000.00 $0.00 $350,000.00 $352,258.92 $0.00 $352,258.92 ($2,258.92)101%$350,222.22 Division 91 - Capital 8135 Contractual Services 225,000.00 .00 225,000.00 3,380.00 .00 139,564.88 85,435.12 62 490,510.32 9199 Facade Improvements 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 13,512.38 Division 91 - Capital Totals $245,000.00 $0.00 $245,000.00 $3,380.00 $0.00 $139,564.88 $105,435.12 57%$504,022.70 Unit 00 - Non-Departmental Totals $595,000.00 $0.00 $595,000.00 $355,638.92 $0.00 $491,823.80 $103,176.20 83%$854,244.92 EXPENSE TOTALS $595,000.00 $0.00 $595,000.00 $355,638.92 $0.00 $491,823.80 $103,176.20 83%$854,244.92 Fund 17 - Tax Increment Financing-Downtown Totals REVENUE TOTALS 750,500.00 .00 750,500.00 .00 .00 752,596.43 (2,096.43)100%747,530.96 EXPENSE TOTALS 595,000.00 .00 595,000.00 355,638.92 .00 491,823.80 103,176.20 83%854,244.92 Fund 17 - Tax Increment Financing-Downtown Totals $155,500.00 $0.00 $155,500.00 ($355,638.92)$0.00 $260,772.63 ($105,272.63)($106,713.96) Fund 18 - Tax Increment Financing-Rt 30 REVENUE 0400.401 Property Tax Revenue 800,000.00 .00 800,000.00 .00 .00 564,785.77 235,214.23 71 639,912.70 0800.800 Interest Income 50.00 .00 50.00 .00 .00 .00 50.00 0 .00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 24 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 80 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 18 - Tax Increment Financing-Rt 30 REVENUE TOTALS $800,050.00 $0.00 $800,050.00 $0.00 $0.00 $564,785.77 $235,264.23 71%$639,912.70 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 8077 Property Tax Rebate 400,000.00 .00 400,000.00 264,349.06 .00 264,349.06 135,650.94 66 299,802.38 8077.001 Redevelopment Rebate .00 .00 .00 239,971.91 .00 239,971.91 (239,971.91)+++329,066.13 Division 00 - Non-Divisional Totals $400,000.00 $0.00 $400,000.00 $504,320.97 $0.00 $504,320.97 ($104,320.97)126%$628,868.51 Unit 00 - Non-Departmental Totals $400,000.00 $0.00 $400,000.00 $504,320.97 $0.00 $504,320.97 ($104,320.97)126%$628,868.51 EXPENSE TOTALS $400,000.00 $0.00 $400,000.00 $504,320.97 $0.00 $504,320.97 ($104,320.97)126%$628,868.51 Fund 18 - Tax Increment Financing-Rt 30 Totals REVENUE TOTALS 800,050.00 .00 800,050.00 .00 .00 564,785.77 235,264.23 71%639,912.70 EXPENSE TOTALS 400,000.00 .00 400,000.00 504,320.97 .00 504,320.97 (104,320.97)126%628,868.51 Fund 18 - Tax Increment Financing-Rt 30 Totals $400,050.00 $0.00 $400,050.00 ($504,320.97)$0.00 $60,464.80 $339,585.20 $11,044.19 Fund 26 - Sex Offender's Registration Fund REVENUE 0600.606 Sex Offenders Registration .00 .00 .00 .00 .00 730.00 (730.00)+++670.00 REVENUE TOTALS $0.00 $0.00 $0.00 $0.00 $0.00 $730.00 ($730.00)+++$670.00 EXPENSE Unit 00 - Non-Departmental Division 00 - Non-Divisional 9290 Sex Offender's Registration Fee .00 .00 .00 270.00 .00 590.00 (590.00)+++500.00 Division 00 - Non-Divisional Totals $0.00 $0.00 $0.00 $270.00 $0.00 $590.00 ($590.00)+++$500.00 Unit 00 - Non-Departmental Totals $0.00 $0.00 $0.00 $270.00 $0.00 $590.00 ($590.00)+++$500.00 EXPENSE TOTALS $0.00 $0.00 $0.00 $270.00 $0.00 $590.00 ($590.00)+++$500.00 Fund 26 - Sex Offender's Registration Fund Totals REVENUE TOTALS .00 .00 .00 .00 .00 730.00 (730.00)+++670.00 EXPENSE TOTALS .00 .00 .00 270.00 .00 590.00 (590.00)+++500.00 Fund 26 - Sex Offender's Registration Fund Totals $0.00 $0.00 $0.00 ($270.00)$0.00 $140.00 ($140.00)$170.00 Fund 27 - Alcohol Enforcement Fund REVENUE 0600.610 Alcohol Fines 15,000.00 .00 15,000.00 1,615.50 .00 11,457.50 3,542.50 76 22,523.00 0800.800 Interest Income 100.00 .00 100.00 .00 .00 .00 100.00 0 .00 REVENUE TOTALS $15,100.00 $0.00 $15,100.00 $1,615.50 $0.00 $11,457.50 $3,642.50 76%$22,523.00 EXPENSE Unit 00 - Non-Departmental Division 99 - Transfers 9901 Transfer to General 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0 20,000.00 Division 99 - Transfers Totals $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $0.00 $20,000.00 0%$20,000.00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 25 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 81 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total Fund 27 - Alcohol Enforcement Fund EXPENSE Unit 00 - Non-Departmental Totals $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $0.00 $20,000.00 0%$20,000.00 EXPENSE TOTALS $20,000.00 $0.00 $20,000.00 $0.00 $0.00 $0.00 $20,000.00 0%$20,000.00 Fund 27 - Alcohol Enforcement Fund Totals REVENUE TOTALS 15,100.00 .00 15,100.00 1,615.50 .00 11,457.50 3,642.50 76%22,523.00 EXPENSE TOTALS 20,000.00 .00 20,000.00 .00 .00 .00 20,000.00 0%20,000.00 Fund 27 - Alcohol Enforcement Fund Totals ($4,900.00)$0.00 ($4,900.00)$1,615.50 $0.00 $11,457.50 ($16,357.50)$2,523.00 Fund 28 - Drug Enforcement Fund REVENUE 0600.611 Drug Fines .00 .00 .00 .00 .00 1,385.50 (1,385.50)+++1,993.50 REVENUE TOTALS $0.00 $0.00 $0.00 $0.00 $0.00 $1,385.50 ($1,385.50)+++$1,993.50 Fund 28 - Drug Enforcement Fund Totals REVENUE TOTALS .00 .00 .00 .00 .00 1,385.50 (1,385.50)+++1,993.50 EXPENSE TOTALS .00 .00 .00 .00 .00 .00 .00 +++.00 Fund 28 - Drug Enforcement Fund Totals $0.00 $0.00 $0.00 $0.00 $0.00 $1,385.50 ($1,385.50)$1,993.50 Fund 29 - Police Vehicle Replacement Fund REVENUE 0600.612 Vehicle Replacement-Will .00 .00 .00 .00 .00 60.00 (60.00)+++300.00 REVENUE TOTALS $0.00 $0.00 $0.00 $0.00 $0.00 $60.00 ($60.00)+++$300.00 EXPENSE Unit 00 - Non-Departmental Division 91 - Capital 9120 Machinery and Equipment .00 .00 .00 .00 .00 16.50 (16.50)+++76,932.70 Division 91 - Capital Totals $0.00 $0.00 $0.00 $0.00 $0.00 $16.50 ($16.50)+++$76,932.70 Unit 00 - Non-Departmental Totals $0.00 $0.00 $0.00 $0.00 $0.00 $16.50 ($16.50)+++$76,932.70 EXPENSE TOTALS $0.00 $0.00 $0.00 $0.00 $0.00 $16.50 ($16.50)+++$76,932.70 Fund 29 - Police Vehicle Replacement Fund Totals REVENUE TOTALS .00 .00 .00 .00 .00 60.00 (60.00)+++300.00 EXPENSE TOTALS .00 .00 .00 .00 .00 16.50 (16.50)+++76,932.70 Fund 29 - Police Vehicle Replacement Fund Totals $0.00 $0.00 $0.00 $0.00 $0.00 $43.50 ($43.50)($76,632.70) Fund 40 - PEMA Fund REVENUE 0801.822 Donation/Contribution .00 .00 .00 .00 .00 2,500.00 (2,500.00)+++4,000.00 REVENUE TOTALS $0.00 $0.00 $0.00 $0.00 $0.00 $2,500.00 ($2,500.00)+++$4,000.00 Fund 40 - PEMA Fund Totals REVENUE TOTALS .00 .00 .00 .00 .00 2,500.00 (2,500.00)+++4,000.00 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 26 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 82 Adopted Budget Amended Current Month YTD YTD Budget - YTD % Used/ Account Account Description Budget Amendments Budget Transactions Encumbrances Transactions Transactions Rec'd Prior Year Total EXPENSE TOTALS .00 .00 .00 .00 .00 .00 .00 +++.00 Fund 40 - PEMA Fund Totals $0.00 $0.00 $0.00 $0.00 $0.00 $2,500.00 ($2,500.00)$4,000.00 Grand Totals REVENUE TOTALS 100,552,722.00 .00 100,552,722.00 6,395,028.62 .00 81,419,307.74 19,133,414.26 81%131,271,773.18 EXPENSE TOTALS 100,599,123.00 .00 100,599,123.00 5,836,906.96 752,774.63 61,800,898.87 38,045,449.50 62%105,141,186.04 Grand Totals ($46,401.00)$0.00 ($46,401.00)$558,121.66 ($752,774.63)$19,618,408.87 ($18,912,035.24)$26,130,587.14 Run by Colleen Thornton on 02/27/2024 10:32:14 AM Page 27 of 27 Budget Performance Report Fiscal Year to Date 01/31/24 Exclude Rollup Account 83 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD $2,821,382.23 $0.00 $31,939,193.93 $3,271,291.07 91%$30,493,235.05 .00 .00 .00 .00 +++.00 1,249,880.74 31,803.16 6,344,757.30 5,068,409.54 56 6,460,727.83 942,361.23 34,860.06 11,044,940.95 4,644,531.99 70 10,421,696.91 10,500.87 .00 63,701.83 92,748.17 41 62,478.33 387,125.85 385,434.57 2,993,696.40 1,581,294.03 68 2,413,309.14 141,252.46 .00 1,300,059.23 784,950.77 62 1,239,043.26 1,995.00 .00 13,576.72 44,444.28 23 9,441.18 $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 65%$20,606,696.65 2,821,382.23 .00 31,939,193.93 3,271,291.07 91%30,493,235.05 2,733,116.15 452,097.79 21,760,732.43 12,216,378.78 65%20,606,696.65 $88,266.08 ($452,097.79)$10,178,461.50 ($8,945,087.71)$9,886,538.40 Grand Totals 2,821,382.23 .00 31,939,193.93 3,271,291.07 91%30,493,235.05 2,733,116.15 452,097.79 21,760,732.43 12,216,378.78 65%20,606,696.65 Grand Totals $88,266.08 ($452,097.79)$10,178,461.50 ($8,945,087.71)$9,886,538.40 EXPENSE TOTALS 34,429,209.00 $781,276.00 Fund 01 - General Fund Totals $781,276.00 REVENUE TOTALS 35,210,485.00 Fund 01 - General Fund Totals REVENUE TOTALS 35,210,485.00 EXPENSE TOTALS 34,429,209.00 Unit 50 - Police Commission 58,021.00 EXPENSE TOTALS $34,429,209.00 Unit 07 - PEMA 156,450.00 Unit 08 - Street Department 4,960,425.00 Unit 09 - Community Development 2,085,010.00 Unit 00 - Non-Departmental .00 Unit 04 - Administration/Finance 11,444,970.00 Unit 05 - Police Department 15,724,333.00 Fund 01 - General Fund REVENUE REVENUE TOTALS $35,210,485.00 EXPENSE Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget Run by Traci Pleckham on 02/28/2024 08:47:53 AM Page 1 of 1 84 Current Month YTD Budget - YTD % Used/ Transactions Transactions Transactions Rec'd Prior Year YTD 2023 Actual 2022 Actual 2021 Actual 2020 Actual .00 7,722,905.47 (389,865.47)105 7,186,519.28 7,186,519.28 7,240,883.72 7,023,861.84 6,302,841.60 1,646,512.68 14,002,586.84 2,862,413.16 83 14,044,078.73 18,847,574.74 16,689,021.65 13,220,143.43 11,556,110.43 131,360.30 1,079,577.41 326,422.59 77 1,072,522.67 1,448,584.95 1,265,768.28 972,348.60 1,008,303.57 252,439.52 1,774,904.73 (46,704.73)103 1,639,588.77 2,217,946.10 2,129,562.64 1,724,514.60 1,460,593.29 43,831.23 556,486.34 (22,486.34)104 485,491.33 656,953.30 562,840.22 524,874.17 678,495.48 511,804.49 5,024,294.00 860,701.00 85 4,738,725.09 5,893,063.07 5,589,076.93 5,257,179.67 5,173,763.26 10,833.00 75,028.21 (29,278.21)164 79,883.29 90,239.17 81,260.74 1,932,957.98 65,421.56 15,311.33 433,514.83 126,485.17 77 461,375.51 600,279.94 605,638.10 572,856.47 601,566.68 78,295.85 801,840.39 (651,840.39)535 236,423.19 442,454.28 (91,661.44)52,735.64 380,540.01 5,841.04 70,816.10 52,683.90 57 158,269.95 240,702.58 228,563.19 174,773.11 142,969.99 125,152.79 397,239.61 162,760.39 71 390,357.24 504,091.74 485,539.82 103,443.37 468,281.18 .00 .00 20,000.00 0 .00 20,000.00 25,000.00 25,000.00 25,000.00 $2,821,382.23 $31,939,193.93 $3,271,291.07 91%$30,493,235.05 $38,148,409.15 $34,811,493.85 $31,584,688.88 $27,863,887.05 $2,821,382.23 $31,939,193.93 $3,271,291.07 $30,493,235.05 $38,148,409.15 $34,811,493.85 $31,584,688.88 $27,863,887.05Fund 01 - General Fund Totals $35,210,485.00 Interfund Transfers 20,000.00 REVENUE TOTALS $35,210,485.00 Investment Income 150,000.00 Miscellaneous 123,500.00 Intergovernmental 560,000.00 Charges for Services 5,884,995.00 Grants 45,750.00 Franchise Fees 560,000.00 Other Taxes 1,406,000.00 Licenses and Permits 1,728,200.00 Fines and Forfeits 534,000.00 Fund 01 - General Fund REVENUE Property Taxes 7,333,040.00 State of Illinois Taxes 16,865,000.00 Revenue Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Detail Listing Adopted Classification Budget Run by Traci Pleckham on 02/28/2024 08:44:51 AM Page 1 of 1 85 Current Month YTD Budget - YTD % Used/ Account Description Transactions Transactions Transactions Rec'd Prior Year YTD Property Tax Revenue .00 4,769,979.41 (361,939.41)108 4,501,224.62 Property Tax Rev-Road & Bridge .00 439,619.94 (39,619.94)110 412,355.12 Property Tax Rev-Police Pension .00 1,940,408.46 9,591.54 100 1,698,688.88 Property Tax Revenue-IMRF .00 572,897.66 2,102.34 100 574,250.66 $0.00 $7,722,905.47 ($389,865.47)105%$7,186,519.28 Municipal Sales Tax 759,277.33 7,074,749.00 1,425,251.00 83 6,987,936.25 Illinois Income Tax 713,930.07 5,520,373.05 1,079,626.95 84 5,555,850.10 Replacement Tax 14,605.61 104,069.19 (14,069.19)116 134,564.07 Replacement Tax-Library .00 .00 .00 +++8,495.51 Local Use Tax 158,699.67 1,303,395.60 371,604.40 78 1,357,232.80 $1,646,512.68 $14,002,586.84 $2,862,413.16 83%$14,044,078.73 Hotel/Motel Tax .00 3,477.22 (2,477.22)348 1,364.78 Amusement Tax 135.61 9,882.38 (4,882.38)198 8,874.05 Local Motor Fuel Tax 131,224.69 1,066,217.81 333,782.19 76 1,062,283.84 $131,360.30 $1,079,577.41 $326,422.59 77%$1,072,522.67 Liquor License (550.00)107,097.70 (7,097.70)107 114,797.20 Contractors License 3,650.00 37,350.00 7,650.00 83 36,500.00 Cigarette License .00 6,000.00 .00 100 6,000.00 Scavenger License .00 50.00 150.00 25 100.00 Business License 8,700.00 47,037.50 2,962.50 94 65,887.50 Building Permit 235,850.03 1,537,159.85 (37,159.85)102 1,361,805.86 Sign Permit 544.49 4,369.68 630.32 87 3,703.21 Special Movement Permit 4,125.00 34,075.00 (14,075.00)170 48,425.00 Solicitors Permit 120.00 1,765.00 235.00 88 2,370.00 $252,439.52 $1,774,904.73 ($46,704.73)103%$1,639,588.77Licenses and Permits Totals $1,728,200.00 0570.560 2,000.00 0570.555 1,500,000.00 0570.556 5,000.00 0570.557 20,000.00 0550.553 6,000.00 0550.554 200.00 0550.558 50,000.00 Licenses and Permits 0550.551 100,000.00 0550.552 45,000.00 0500.501 5,000.00 0500.503 1,400,000.00 Other Taxes Totals $1,406,000.00 State of Illinois Taxes Totals $16,865,000.00 Other Taxes 0500.500 1,000.00 0450.453 90,000.00 0450.454 .00 0450.455 1,675,000.00 0450.451 8,500,000.00 0450.452 6,600,000.00 0400.404 575,000.00 Property Taxes Totals $7,333,040.00 State of Illinois Taxes 0400.401 4,408,040.00 0400.402 400,000.00 0400.403 1,950,000.00 Fund 01 - General Fund REVENUE Property Taxes Revenue Budget by Account Classification Report Through 01/31/24 Prior Fiscal Year Activity Included Detail Listing Adopted Account Budget Run by Traci Pleckham on 02/28/2024 08:52:54 AM Page 1 of 3 86 Current Month YTD Budget - YTD % Used/ Account Description Transactions Transactions Transactions Rec'd Prior Year YTD Revenue Budget by Account Classification Report Through 01/31/24 Prior Fiscal Year Activity Included Detail Listing Adopted Account Budget County Court Fines 17,943.62 248,835.21 76,164.79 77 275,573.65 Administrative Fines(P-Tickets)6,210.00 70,594.50 29,405.50 71 84,550.00 Asset Seizure-Non Federal .00 143,769.45 (43,769.45)144 25,810.80 Alarm Fees 1,000.00 5,350.00 (4,350.00)535 1,850.00 Kendall County Court Fines 1,025.00 5,633.07 (2,633.07)188 3,641.70 Administrative Fines- Late Fee 755.00 5,355.00 (355.00)107 4,620.00 Asset Seizure-Federal (Dept of Justice Equitable Share) 16,897.61 68,689.13 (68,689.13)+++89,445.18 Asset Seizure-Federal (U.S. Treasury Equitable Share) .00 8,259.98 (8,259.98)+++.00 $43,831.23 $556,486.34 ($22,486.34)104%$485,491.33 Garbage Fee 475,517.98 4,581,667.77 683,177.23 87 4,290,644.94 Garbage Penalty 6,023.01 51,380.24 (11,380.24)128 45,980.27 Zoning Applications 5,289.00 34,286.66 (19,286.66)229 37,267.40 Planning Fees 100.00 20,850.00 (20,850.00)+++.00 Accident Report Fees 1,025.00 8,150.00 (3,150.00)163 6,945.00 Copies-Maps & Ordinances 88.50 1,201.30 298.70 80 1,449.73 Impound Fee 750.00 14,500.00 10,500.00 58 21,750.00 Parking Lot Revenue .00 1,200.00 800.00 60 1,900.00 Tower Rent 4,761.00 38,340.53 8,109.47 83 36,638.10 Rental Income 4,100.00 36,900.00 12,300.00 75 38,900.00 Rental-Community/Multi Room 250.00 610.00 390.00 61 440.00 Special Detail/OT Reimbursement 13,900.00 60,207.50 24,792.50 71 81,809.65 Water & Sewer Service Charge .00 175,000.00 175,000.00 50 175,000.00 $511,804.49 $5,024,294.00 $860,701.00 85%$4,738,725.09 FEMA Grant .00 .00 .00 +++12,693.27 Grant Revenue .00 .00 .00 +++3,000.00 Bulletproof Vest Grant 1,950.00 6,827.50 (3,827.50)228 4,251.95 Tobacco Grant .00 3,134.00 (384.00)114 4,503.00 Traffic Grant 8,883.00 65,066.71 (25,066.71)163 55,435.07 $10,833.00 $75,028.21 ($29,278.21)164%$79,883.29 0700.710 2,750.00 0700.717 40,000.00 Grants Totals $45,750.00 Grants 0700.005 .00 0650.904 85,000.00 0690.902 350,000.00 0700.704 3,000.00 0700.650 .00 0650.825 49,200.00 0650.830 1,000.00 0650.815 2,000.00 0650.818 46,450.00 Charges for Services Totals $5,884,995.00 0650.653 5,000.00 0650.654 1,500.00 0650.670 25,000.00 0650.651 15,000.00 0650.652 .00 0600.632 .00 0600.604 1,000.00 0600.605 3,000.00 0600.607 5,000.00 0620.656 40,000.00 Fines and Forfeits Totals $534,000.00 Charges for Services 0620.655 5,264,845.00 0600.602 100,000.00 0600.603 100,000.00 Fines and Forfeits 0600.630 .00 0600.601 325,000.00 Run by Traci Pleckham on 02/28/2024 08:52:54 AM Page 2 of 3 87 Current Month YTD Budget - YTD % Used/ Account Description Transactions Transactions Transactions Rec'd Prior Year YTD Revenue Budget by Account Classification Report Through 01/31/24 Prior Fiscal Year Activity Included Detail Listing Adopted Account Budget AT&T Franchise Fees 15,311.33 68,401.06 11,598.94 86 62,139.93 Cable TV-Franchise Fees .00 365,113.77 114,886.23 76 399,235.58 $15,311.33 $433,514.83 $126,485.17 77%$461,375.51 Interest Income 60,938.44 588,801.58 (438,801.58)393 264,750.29 Realized Gain/Loss On Investment 1,360.97 1,360.97 (1,360.97)+++.00 Unrealized Gain/Loss (126.11)57,125.89 (57,125.89)+++(39,367.00) Unrealized Gain/Loss IMET 16,122.55 154,551.95 (154,551.95)+++11,039.90 $78,295.85 $801,840.39 ($651,840.39)535%$236,423.19 Event Sponsorship Program 2,000.00 4,519.25 (2,519.25)226 3,770.00 Reimbursement Police Training .00 1,193.00 (1,193.00)+++.00 Amphitheater Rent 550.00 800.00 (300.00)160 250.00 Donation/Contribution .00 17,689.50 (12,689.50)354 16,393.09 Sales-Fixed Assets .00 .00 1,000.00 0 2,346.94 Other Reimbursements 600.00 27,010.55 62,989.45 30 114,448.75 Other Receipts 2,691.04 19,603.80 5,396.20 78 21,061.17 $5,841.04 $70,816.10 $52,683.90 57%$158,269.95 School Liaison Reimbursement 125,152.79 381,617.29 168,382.71 69 375,006.27 HIDTA/Organized Crime Reimb .00 15,622.32 (5,622.32)156 15,350.97 $125,152.79 $397,239.61 $162,760.39 71%$390,357.24 Transfer From Alcohol Enforc..00 .00 20,000.00 0 .00 $0.00 $0.00 $20,000.00 0%$0.00 $2,821,382.23 $31,939,193.93 $3,271,291.07 91%$30,493,235.05 $2,821,382.23 $31,939,193.93 $3,271,291.07 $30,493,235.05 Grand Totals $2,821,382.23 $31,939,193.93 $3,271,291.07 $30,493,235.05 0999.927 20,000.00 Interfund Transfers Fund 01 - General Fund Totals $35,210,485.00 $35,210,485.00 Interfund Transfers Totals $20,000.00 REVENUE TOTALS $35,210,485.00 Miscellaneous Totals $123,500.00 Intergovernmental 0805.000 90,000.00 0806.000 25,000.00 Intergovernmental Totals $560,000.00 0860.804 550,000.00 0860.819 10,000.00 0801.802 500.00 Miscellaneous 0801.200 2,000.00 0801.801 .00 0803.000 1,000.00 0801.822 5,000.00 0800.827 .00 0800.830 .00 Investment Income Totals $150,000.00 Investment Income 0800.800 150,000.00 0800.826 .00 0750.750 80,000.00 0750.751 480,000.00 Franchise Fees Totals $560,000.00 Franchise Fees Run by Traci Pleckham on 02/28/2024 08:52:54 AM Page 3 of 3 88 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD .00 .00 .00 .00 +++.00 $0.00 $0.00 $0.00 $0.00 +++$0.00 849,245.04 .00 3,363,900.08 1,753,014.92 66 3,158,239.02 56,279.67 .00 217,580.32 195,719.68 53 479,946.16 100,656.89 .00 913,127.83 703,047.17 56 941,541.86 12,492.99 .00 142,961.82 89,923.18 61 132,835.58 10,480.76 .00 101,339.89 119,270.11 46 99,376.72 22,395.45 .00 212,824.52 127,465.48 63 203,776.78 173,528.72 31,803.16 1,095,633.53 425,108.31 73 788,919.31 24,801.22 .00 297,389.31 254,860.69 54 356,092.40 .00 .00 .00 .00 +++.00 .00 .00 .00 1,400,000.00 0 300,000.00 $1,249,880.74 $31,803.16 $6,344,757.30 $5,068,409.54 56%$6,460,727.83 (26,690.36).00 365,272.71 215,992.29 63 391,976.57 595,469.78 15,229.46 7,567,637.59 2,720,383.95 74 6,527,972.09 303,091.43 .00 2,295,771.94 1,264,389.06 64 2,193,121.73 .00 .00 .00 .00 +++.00 4,194.00 .00 18,824.57 81,175.43 19 3,054.00 3,336.96 .00 68,546.99 (33,546.99)196 50,832.72 59,748.15 .00 659,027.43 279,628.57 70 1,215,657.94 .00 .00 .00 .00 +++.00 1,893.57 19,630.60 51,914.03 119,455.37 37 27,396.30 1,317.70 .00 17,945.69 (2,945.69)120 11,685.56 $942,361.23 $34,860.06 $11,044,940.95 $4,644,531.99 70%$10,421,696.91 10,500.87 .00 63,701.83 92,748.17 41 62,478.33 $10,500.87 $0.00 $63,701.83 $92,748.17 41%$62,478.33Unit 07 - PEMA Totals $156,450.00 Unit 05 - Police Department Totals $15,724,333.00 Unit 07 - PEMA Division 07 - PEMA Program 156,450.00 Division 57 - Court Services .00 Division 91 - Capital 191,000.00 Division 93 - Contingencies 15,000.00 Division 54 - Seizure/Forfeiture 100,000.00 Division 55 - Police Special Activities 35,000.00 Division 56 - Police Support Services 938,656.00 Division 51 - Police Patrol 10,303,251.00 Division 52 - Police Administration 3,560,161.00 Division 53 - Police Records .00 Unit 04 - Administration/Finance Totals $11,444,970.00 Unit 05 - Police Department Division 02 - Administration Program 581,265.00 Division 09 - Legal Program 552,250.00 Division 93 - Contingencies .00 Division 99 - Transfers 1,400,000.00 Division 04 - Facility Management Program 220,610.00 Division 06 - Human Resources Program 340,290.00 Division 08 - IT Program 1,552,545.00 Division 01 - Legislative Program 413,300.00 Division 02 - Administration Program 1,616,175.00 Division 03 - Community Relations Program 232,885.00 Unit 00 - Non-Departmental Totals $0.00 Unit 04 - Administration/Finance Division 00 - Non-Divisional 5,116,915.00 Fund 01 - General Fund EXPENSE Unit 00 - Non-Departmental Division 94 - Contra .00 Expense Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget Run by Traci Pleckham on 02/28/2024 08:50:35 AM Page 1 of 2 89 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Expense Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget 58,996.47 .00 538,138.27 259,601.73 67 294,900.95 291,127.72 385,434.57 2,095,083.10 1,126,372.33 69 1,741,711.08 .00 .00 .00 .00 +++.00 12,863.81 .00 130,615.95 107,469.05 55 161,900.44 24,137.85 .00 229,859.08 87,850.92 72 214,796.67 $387,125.85 $385,434.57 $2,993,696.40 $1,581,294.03 68%$2,413,309.14 53,666.20 .00 508,455.05 351,324.95 59 453,913.76 87,586.26 .00 791,604.18 433,625.82 65 785,129.50 .00 .00 .00 .00 +++.00 $141,252.46 $0.00 $1,300,059.23 $784,950.77 62%$1,239,043.26 1,995.00 .00 13,576.72 44,444.28 23 9,441.18 $1,995.00 $0.00 $13,576.72 $44,444.28 23%$9,441.18 $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 65%$20,606,696.65 $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 $20,606,696.65 Grand Totals $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 $20,606,696.65$34,429,209.00 Unit 50 - Police Commission Totals $58,021.00 EXPENSE TOTALS $34,429,209.00 Fund 01 - General Fund Totals $34,429,209.00 Unit 09 - Community Development Totals $2,085,010.00 Unit 50 - Police Commission Division 02 - Administration Program 58,021.00 Division 20 - Planning Program 859,780.00 Division 21 - Building Program 1,225,230.00 Division 24 - Historic Preservation Program .00 Division 63 - Vehicle Maintenance Program 317,710.00 Unit 08 - Street Department Totals $4,960,425.00 Unit 09 - Community Development Division 60 - Street Maintenance Program 3,606,890.00 Division 61 - Snow and Ice Removal Program .00 Division 62 - Forestry Program 238,085.00 Unit 08 - Street Department Division 02 - Administration Program 797,740.00 Run by Traci Pleckham on 02/28/2024 08:50:35 AM Page 2 of 2 90 Current Month YTD YTD Budget - YTD % Used/ Organization Description Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD General Fund,Non-Departmental .00 .00 .00 .00 +++.00 General Fund,Administration/Finance 154,536.86 .00 1,494,751.65 680,748.35 69 1,401,185.08 General Fund,Police Department 678,893.80 .00 6,394,690.40 3,064,147.60 68 6,084,942.87 General Fund,PEMA .00 .00 .00 .00 +++.00 General Fund,Street Department 156,751.80 .00 1,449,571.45 512,428.55 74 1,231,272.69 General Fund,Community Development 99,783.62 .00 887,114.98 424,885.02 68 843,334.94 General Fund,Police Commission .00 .00 1,227.77 5,272.23 19 1,526.87 $1,089,966.08 $0.00 $10,227,356.25 $4,687,481.75 69%$9,562,262.45 General Fund,Administration/Finance 51,069.37 .00 502,469.20 405,735.80 55 530,821.30 General Fund,Police Department 161,488.77 .00 3,533,828.49 809,918.51 81 3,267,490.06 General Fund,PEMA 1,199.25 .00 1,407.80 2,592.20 35 1,619.25 General Fund,Street Department 56,044.50 .00 550,879.91 256,045.09 68 479,340.42 General Fund,Community Development 35,002.70 .00 317,248.57 196,511.43 62 323,600.10 General Fund,Police Commission .00 .00 93.91 1,827.09 5 666.81 $304,804.59 $0.00 $4,905,927.88 $1,672,630.12 75%$4,603,537.94 General Fund,Administration/Finance 721.75 .00 8,775.44 13,274.56 40 6,615.41 General Fund,Police Department 5,889.42 .00 51,923.14 22,896.86 69 49,035.12 General Fund,PEMA 856.25 .00 6,631.59 12,368.41 35 6,712.49 General Fund,Street Department 61,558.98 .00 168,870.51 34,629.49 83 62,108.31 General Fund,Community Development 554.35 .00 4,796.30 5,703.70 46 4,266.01 $69,580.75 $0.00 $240,996.98 $88,873.02 73%$128,737.34 General Fund,Administration/Finance 35,295.43 .00 117,374.42 55,425.58 68 106,959.33 General Fund,Police Department 26,292.39 15,229.46 233,086.80 157,623.74 61 251,484.92 General Fund,PEMA 2,274.68 .00 9,700.53 20,799.47 32 8,069.59 General Fund,Street Department 65,151.65 366,348.67 295,094.27 (70,442.94)112 123,075.07 General Fund,Community Development 1,470.55 .00 12,349.73 23,900.27 34 12,635.94 General Fund,Police Commission 400.00 .00 400.00 2,200.00 15 375.00 $130,884.70 $381,578.13 $668,005.75 $189,506.12 85%$502,599.85 01-09 36,250.00 01-50 2,600.00 Supplies and Commodities Totals $1,239,090.00 01-05 405,940.00 01-07 30,500.00 01-08 591,000.00 Utilities Totals $329,870.00 Supplies and Commodities 01-04 172,800.00 01-07 19,000.00 01-08 203,500.00 01-09 10,500.00 Utilities 01-04 22,050.00 01-05 74,820.00 01-09 513,760.00 01-50 1,921.00 Benefits Totals $6,578,558.00 01-05 4,343,747.00 01-07 4,000.00 01-08 806,925.00 Salaries and Wages Totals $14,914,838.00 Benefits 01-04 908,205.00 01-08 1,962,000.00 01-09 1,312,000.00 01-50 6,500.00 01-04 2,175,500.00 01-05 9,458,838.00 01-07 .00 EXPENSE Salaries and Wages 01-00 .00 Expense Budget Cross Organization Report by Account Classification Through 01/31/24 Prior Fiscal Year Activity Included Adopted Organization Budget Run by Traci Pleckham on 02/28/2024 08:53:59 AM Page 1 of 2 91 Current Month YTD YTD Budget - YTD % Used/ Organization Description Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Expense Budget Cross Organization Report by Account Classification Through 01/31/24 Prior Fiscal Year Activity Included Adopted Organization Budget General Fund,Administration/Finance 987,471.85 26,970.00 4,090,069.68 2,145,875.32 66 3,803,683.85 General Fund,Police Department 66,585.58 .00 746,528.40 478,459.60 61 716,749.08 General Fund,PEMA 5,111.94 .00 43,233.49 46,716.51 48 44,042.80 General Fund,Street Department 47,618.92 19,085.90 529,280.26 848,633.84 39 517,512.65 General Fund,Community Development 4,441.24 .00 78,549.65 133,950.35 37 55,206.27 General Fund,Police Commission 1,595.00 .00 11,855.04 35,144.96 25 6,872.50 $1,112,824.53 $46,055.90 $5,499,516.52 $3,688,780.58 60%$5,144,067.15 General Fund,Administration/Finance 20,785.48 4,833.16 131,316.91 1,767,349.93 7 611,462.86 General Fund,Police Department 3,211.27 19,630.60 84,883.72 111,485.68 48 51,994.86 General Fund,PEMA 1,058.75 .00 2,728.42 10,271.58 21 2,034.20 General Fund,Street Department .00 .00 .00 .00 +++.00 General Fund,Community Development .00 .00 .00 .00 +++.00 General Fund,Police Commission .00 .00 .00 .00 +++.00 $25,055.50 $24,463.76 $218,929.05 $1,889,107.19 11%$665,491.92 $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 65%$20,606,696.65 Grand Totals $2,733,116.15 $452,097.79 $21,760,732.43 $12,216,378.78 $20,606,696.65$34,429,209.00 Other Totals $2,132,500.00 EXPENSE TOTALS $34,429,209.00 01-08 .00 01-09 .00 01-50 .00 01-04 1,903,500.00 01-05 216,000.00 01-07 13,000.00 01-50 47,000.00 Contractual Services Totals $9,234,353.00 Other 01-07 89,950.00 01-08 1,397,000.00 01-09 212,500.00 Contractual Services 01-04 6,262,915.00 01-05 1,224,988.00 Run by Traci Pleckham on 02/28/2024 08:53:59 AM Page 2 of 2 92 Current Month YTD Budget - YTD % Used/ Transactions Transactions Transactions Rec'd Prior Year YTD 2023 Actual 2022 Actual 2021 Actual 2020 Actual 245,595.33 2,304,592.86 695,407.14 77 2,372,220.78 3,168,756.24 2,993,857.02 2,114,518.07 1,801,904.09 266,725.27 2,570,965.17 (415,965.17)119 3,258,357.03 4,379,139.37 3,737,652.15 3,410,305.48 1,593,513.50 1,484,961.38 17,371,044.42 3,267,955.58 84 16,336,111.20 20,628,871.85 19,679,119.70 19,140,281.55 16,846,437.63 .00 .00 980,000.00 0 3,014,819.33 2,753,042.53 .00 .00 .00 62,963.54 808,831.76 (658,831.76)539 502,521.11 883,868.36 (177,283.23)62,162.54 404,487.95 .00 13,527.00 14,473.00 48 26,357.28 995,458.85 2,758,203.94 982,111.32 .00 .00 868,287.06 1,040,712.94 45 3,350,099.58 229,559.78 .00 .00 2,441,470.47 .00 .00 .00 +++.00 .00 .00 .00 .00 $2,060,245.52 $23,937,248.27 $4,923,751.73 83%$28,860,486.31 $33,038,696.98 $28,991,549.58 $25,709,378.96 $23,087,813.64 $2,060,245.52 $23,937,248.27 $4,923,751.73 $28,860,486.31 $33,038,696.98 $28,991,549.58 $25,709,378.96 $23,087,813.64 REVENUE TOTALS $28,861,000.00 Fund 02 - Water and Sewer Fund Totals $28,861,000.00 Miscellaneous 28,000.00 Debt Proceeds 1,909,000.00 Interfund Transfers .00 Charges for Services 20,639,000.00 Grants 980,000.00 Investment Income 150,000.00 Fund 02 - Water and Sewer Fund REVENUE State of Illinois Taxes 3,000,000.00 Licenses and Permits 2,155,000.00 Revenue Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Detail ListingAdopted Classification Budget Run by Traci Pleckham on 02/28/2024 08:27:42 AM Page 1 of 1 93 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD 51,614.90 .00 923,906.54 440,980.46 68 971,495.94 1,008,780.28 .00 9,111,890.82 3,565,706.18 72 8,184,728.87 .00 .00 .00 .00 +++.00 .00 .00 .00 .00 +++.00 $1,060,395.18 $0.00 $10,035,797.36 $4,006,686.64 71%$9,156,224.81 41,584.61 .00 749,313.69 315,073.31 70 722,377.21 150,198.92 .00 1,406,102.91 854,944.09 62 1,089,562.31 .00 .00 .00 .00 +++.00 .00 .00 .00 .00 +++.00 $191,783.53 $0.00 $2,155,416.60 $1,170,017.40 65%$1,811,939.52 67,940.33 .00 2,211,108.46 7,763,891.54 22 3,053,014.70 .00 .00 490,446.30 1,004,327.70 33 421,567.68 .00 .00 .00 .00 +++.00 $67,940.33 $0.00 $2,701,554.76 $8,768,219.24 24%$3,474,582.38 $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 52%$14,442,746.71 $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 $14,442,746.71 Grand Totals $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 $14,442,746.71$28,837,692.00 EXPENSE TOTALS $28,837,692.00 Fund 02 - Water and Sewer Fund Totals $28,837,692.00 Division 92 - Bonds 1,494,774.00 Division 99 - Transfers .00 Unit 12 - Utility Expansion Totals $11,469,774.00 Unit 11 - Sewer Department Totals $3,325,434.00 Unit 12 - Utility Expansion Division 91 - Capital 9,975,000.00 Division 40 - Sewer Treatment Program 2,261,047.00 Division 91 - Capital .00 Division 93 - Contingencies .00 Unit 10 - Water Department Totals $14,042,484.00 Unit 11 - Sewer Department Division 02 - Administration Program 1,064,387.00 Division 30 - Water Distribution Program 12,677,597.00 Division 91 - Capital .00 Division 93 - Contingencies .00 Fund 02 - Water and Sewer Fund EXPENSE Unit 10 - Water Department Division 02 - Administration Program 1,364,887.00 Expense Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget Run by Traci Pleckham on 02/28/2024 08:51:51 AM Page 1 of 1 94 Current Month YTD YTD Budget - YTD % Used/ Organization Description Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Water and Sewer Fund,Water Department,Administration Program 19,101.09 .00 181,636.88 109,863.12 62 164,927.76 Water and Sewer Fund,Water Department,Water Distribution Program 41,544.00 .00 372,656.99 177,343.01 68 322,944.86 Water and Sewer Fund,Sewer Department,Administration Program 19,217.70 .00 182,197.56 109,302.44 63 162,232.36 Water and Sewer Fund,Sewer Department,Sewer Treatment Program 40,587.04 .00 357,240.69 181,759.31 66 297,927.03 $120,449.83 $0.00 $1,093,732.12 $578,267.88 65%$948,032.01 Water and Sewer Fund,Water Department,Administration Program 7,733.40 .00 70,296.54 63,068.46 53 60,914.52 Water and Sewer Fund,Water Department,Water Distribution Program 11,792.14 .00 105,696.76 101,878.24 51 111,479.97 Water and Sewer Fund,Sewer Department,Administration Program 6,918.86 .00 77,888.05 61,476.95 56 66,318.29 Water and Sewer Fund,Sewer Department,Sewer Treatment Program 12,131.60 .00 116,309.74 94,215.26 55 103,453.56 $38,576.00 $0.00 $370,191.09 $320,638.91 54%$342,166.34 Water and Sewer Fund,Water Department,Administration Program 591.33 .00 4,899.15 3,100.85 61 3,831.67 Water and Sewer Fund,Water Department,Water Distribution Program 35,213.08 .00 146,678.47 8,321.53 95 81,563.55 Water and Sewer Fund,Sewer Department,Administration Program 353.40 .00 2,875.93 3,624.07 44 2,294.57 Water and Sewer Fund,Sewer Department,Sewer Treatment Program 81,445.93 .00 330,796.47 249,203.53 57 262,772.22 $117,603.74 $0.00 $485,250.02 $264,249.98 65%$350,462.01 Water and Sewer Fund,Water Department,Administration Program 13,675.96 .00 259,134.14 107,865.86 71 341,833.21 Water and Sewer Fund,Water Department,Water Distribution Program 1,026.77 .00 41,956.88 15,043.12 74 37,541.23 Water and Sewer Fund,Sewer Department,Administration Program 3,415.29 .00 94,032.65 16,467.35 85 96,390.66 Water and Sewer Fund,Sewer Department,Sewer Treatment Program 8,227.97 .00 131,224.17 102,275.83 56 107,735.56 $26,345.99 $0.00 $526,347.84 $241,652.16 69%$583,500.66 Water and Sewer Fund,Water Department,Administration Program 10,513.12 .00 82,417.83 69,582.17 54 75,213.78 Water and Sewer Fund,Water Department,Water Distribution Program 919,204.29 .00 8,206,879.72 3,263,120.28 72 7,393,924.26 Water and Sewer Fund,Sewer Department,Administration Program 11,679.36 .00 66,797.50 36,702.50 65 70,366.33 Water and Sewer Fund,Sewer Department,Sewer Treatment Program 7,806.38 .00 232,509.84 227,490.16 51 80,398.94 Water and Sewer Fund,Utility Expansion ,Capital 1,710.00 .00 632,709.22 242,290.78 72 84,733.03 $950,913.15 $0.00 $9,221,314.11 $3,839,185.89 71%$7,704,636.34 02-12-91 875,000.00 Contractual Services Totals $13,060,500.00 02-10-30 11,470,000.00 02-11-02 103,500.00 02-11-40 460,000.00 Supplies and Commodities Totals $768,000.00 Contractual Services 02-10-02 152,000.00 02-10-30 57,000.00 02-11-02 110,500.00 02-11-40 233,500.00 Utilities Totals $749,500.00 Supplies and Commodities 02-10-02 367,000.00 02-10-30 155,000.00 02-11-02 6,500.00 02-11-40 580,000.00 Benefits Totals $690,830.00 Utilities 02-10-02 8,000.00 02-10-30 207,575.00 02-11-02 139,365.00 02-11-40 210,525.00 Salaries and Wages Totals $1,672,000.00 Benefits 02-10-02 133,365.00 02-10-30 550,000.00 02-11-02 291,500.00 02-11-40 539,000.00 EXPENSE Salaries and Wages 02-10-02 291,500.00 Expense Budget Cross Organization Report by Account Classification Through 01/31/24 Prior Fiscal Year Activity Included Adopted Organization Budget Run by Traci Pleckham on 02/28/2024 08:54:59 AM Page 1 of 2 95 Current Month YTD YTD Budget - YTD % Used/ Organization Description Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Expense Budget Cross Organization Report by Account Classification Through 01/31/24 Prior Fiscal Year Activity Included Adopted Organization Budget Water and Sewer Fund,Water Department,Administration Program .00 .00 325,522.00 87,500.00 79 324,775.00 Water and Sewer Fund,Water Department,Water Distribution Program .00 .00 238,022.00 .00 100 237,275.00 Water and Sewer Fund,Water Department,Capital .00 .00 .00 .00 +++.00 Water and Sewer Fund,Water Department,Contingencies .00 .00 .00 .00 +++.00 Water and Sewer Fund,Sewer Department,Administration Program .00 .00 325,522.00 87,500.00 79 324,775.00 Water and Sewer Fund,Sewer Department,Sewer Treatment Program .00 .00 238,022.00 .00 100 237,275.00 Water and Sewer Fund,Sewer Department,Capital .00 .00 .00 .00 +++.00 Water and Sewer Fund,Sewer Department,Contingencies .00 .00 .00 .00 +++.00 Water and Sewer Fund,Utility Expansion ,Capital 66,230.33 .00 1,578,399.24 7,521,600.76 17 2,968,281.67 Water and Sewer Fund,Utility Expansion ,Bonds .00 .00 490,446.30 1,004,327.70 33 421,567.68 Water and Sewer Fund,Utility Expansion ,Transfers .00 .00 .00 .00 +++.00 $66,230.33 $0.00 $3,195,933.54 $8,700,928.46 27%$4,513,949.35 $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 52%$14,442,746.71 Grand Totals $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 $14,442,746.71 EXPENSE TOTALS $28,837,692.00 $28,837,692.00 02-12-92 1,494,774.00 02-12-99 .00 Other Totals $11,896,862.00 02-11-91 .00 02-11-93 .00 02-12-91 9,100,000.00 02-10-93 .00 02-11-02 413,022.00 02-11-40 238,022.00 02-10-02 413,022.00 02-10-30 238,022.00 02-10-91 .00 Other Run by Traci Pleckham on 02/28/2024 08:54:59 AM Page 2 of 2 96 Current Month YTD Budget - YTD % Used/ Transactions Transactions Transactions Rec'd Prior Year YTD 2023 Actual 2022 Actual 2021 Actual 2020 Actual 491,264.36 4,609,877.20 1,540,122.80 75 4,745,153.28 6,338,463.18 5,988,612.29 4,229,670.63 3,604,348.76 351,844.02 2,576,341.79 1,348,658.21 66 2,900,226.64 4,012,205.66 3,812,880.95 3,287,274.22 3,298,561.62 207,465.56 1,192,539.85 (1,052,539.85)852 494,448.00 632,441.42 268,857.66 140,819.02 98,949.15 30,200.00 321,006.00 53,994.00 86 303,724.38 370,105.00 402,726.90 344,100.01 320,551.35 750.00 15,850.00 12,150.00 57 27,710.00 39,225.00 25,290.00 44,880.00 29,810.00 174,004.18 392,791.78 11,572,208.22 3 .00 1,117,481.72 2,431,420.71 1,025,568.69 258,216.46 107,011.27 1,010,905.23 (760,905.23)404 294,352.41 527,900.25 6,421.86 34,708.64 316,490.45 .00 1,678,880.47 (528,880.47)146 77,553.38 116,295.38 226,442.76 296,080.67 882,168.33 .00 .00 1,400,000.00 0 .00 9,285,537.00 6,002,811.00 3,121,257.00 2,008,012.00 $1,362,539.39 $11,798,192.32 $13,584,807.68 46%$8,843,168.09 $22,439,654.61 $19,165,464.13 $12,524,358.88 $10,817,108.12 $1,362,539.39 $11,798,192.32 $13,584,807.68 $8,843,168.09 $22,439,654.61 $19,165,464.13 $12,524,358.88 $10,817,108.12 Interfund Transfers 1,400,000.00 REVENUE TOTALS $25,383,000.00 Fund 11 - Capital Improvement Fund Totals $25,383,000.00 Grants 11,965,000.00 Investment Income 250,000.00 Miscellaneous 1,150,000.00 Licenses and Permits 140,000.00 Fines and Forfeits 375,000.00 Charges for Services 28,000.00 Fund 11 - Capital Improvement Fund REVENUE State of Illinois Taxes 6,150,000.00 Other Taxes 3,925,000.00 Revenue Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Detail ListingAdopted Classification Budget Run by Traci Pleckham on 02/28/2024 08:46:53 AM Page 1 of 1 97 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD $2,060,245.52 $0.00 $23,937,248.27 $4,923,751.73 83%$28,860,486.31 1,060,395.18 .00 10,035,797.36 4,006,686.64 71 9,156,224.81 191,783.53 .00 2,155,416.60 1,170,017.40 65 1,811,939.52 67,940.33 .00 2,701,554.76 8,768,219.24 24 3,474,582.38 $1,320,119.04 $0.00 $14,892,768.72 $13,944,923.28 52%$14,442,746.71 2,060,245.52 .00 23,937,248.27 4,923,751.73 83%28,860,486.31 1,320,119.04 .00 14,892,768.72 13,944,923.28 52%14,442,746.71 $740,126.48 $0.00 $9,044,479.55 ($9,021,171.55)$14,417,739.60 $107,616.37 $0.00 $499,003.39 ($499,003.39)+++$13,875.67 .00 .00 .00 .00 +++.00 $0.00 $0.00 $0.00 $0.00 +++$0.00 107,616.37 .00 499,003.39 (499,003.39)+++13,875.67 .00 .00 .00 .00 +++.00 $107,616.37 $0.00 $499,003.39 ($499,003.39)$13,875.67 $198,494.39 $0.00 $1,881,397.98 ($31,397.98)102%$1,839,114.18 .00 .00 2,223,942.18 2,276,057.82 49 2,287,108.05 $0.00 $0.00 $2,223,942.18 $2,276,057.82 49%$2,287,108.05 198,494.39 .00 1,881,397.98 (31,397.98)102%1,839,114.18 .00 .00 2,223,942.18 2,276,057.82 49%2,287,108.05 $198,494.39 $0.00 ($342,544.20)($2,307,455.80)($447,993.87) EXPENSE TOTALS 4,500,000.00 Fund 04 - Motor Fuel Tax Totals ($2,650,000.00) Fund 04 - Motor Fuel Tax Totals REVENUE TOTALS 1,850,000.00 EXPENSE Unit 00 - Non-Departmental 4,500,000.00 EXPENSE TOTALS $4,500,000.00 Fund 03 - Capital Replacement Fund Totals $0.00 Fund 04 - Motor Fuel Tax REVENUE REVENUE TOTALS $1,850,000.00 Fund 03 - Capital Replacement Fund Totals REVENUE TOTALS .00 EXPENSE TOTALS .00 Unit 00 - Non-Departmental .00 EXPENSE TOTALS $0.00 Fund 03 - Capital Replacement Fund REVENUE REVENUE TOTALS $0.00 EXPENSE EXPENSE TOTALS 28,837,692.00 Fund 02 - Water and Sewer Fund Totals $23,308.00 EXPENSE TOTALS $28,837,692.00 Fund 02 - Water and Sewer Fund Totals Unit 12 - Utility Expansion 11,469,774.00 Fund 02 - Water and Sewer Fund REVENUE REVENUE TOTALS $28,861,000.00 EXPENSE REVENUE TOTALS 28,861,000.00 Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget Unit 10 - Water Department 14,042,484.00 Unit 11 - Sewer Department 3,325,434.00 Run by Traci Pleckham on 02/28/2024 08:49:38 AM Page 1 of 4 98 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget $0.00 $0.00 $2,997,487.00 $0.00 100%$2,994,291.00 (669.38).00 2,996,212.77 1,274.23 100 2,994,288.53 ($669.38)$0.00 $2,996,212.77 $1,274.23 100%$2,994,288.53 .00 .00 2,997,487.00 .00 100%2,994,291.00 (669.38).00 2,996,212.77 1,274.23 100%2,994,288.53 $669.38 $0.00 $1,274.23 ($1,274.23)$2.47 $0.00 $0.00 $834,628.60 ($9,628.60)101%$985,178.51 .00 .00 712,702.00 172,634.00 81 746,866.00 $0.00 $0.00 $712,702.00 $172,634.00 81%$746,866.00 .00 .00 834,628.60 (9,628.60)101%985,178.51 .00 .00 712,702.00 172,634.00 81%746,866.00 $0.00 $0.00 $121,926.60 ($182,262.60)$238,312.51 $0.00 $0.00 $50,866.83 ($866.83)102%$51,599.80 .00 .00 45,140.00 1,860.00 96 43,825.00 $0.00 $0.00 $45,140.00 $1,860.00 96%$43,825.00 .00 .00 50,866.83 (866.83)102%51,599.80 .00 .00 45,140.00 1,860.00 96%43,825.00 $0.00 $0.00 $5,726.83 ($2,726.83)$7,774.80 EXPENSE TOTALS 47,000.00 Fund 08 - Audit Fund Totals $3,000.00 Fund 08 - Audit Fund Totals REVENUE TOTALS 50,000.00 EXPENSE Unit 00 - Non-Departmental 47,000.00 EXPENSE TOTALS $47,000.00 Fund 07 - Tort Immunity Fund Totals ($60,336.00) Fund 08 - Audit Fund REVENUE REVENUE TOTALS $50,000.00 Fund 07 - Tort Immunity Fund Totals REVENUE TOTALS 825,000.00 EXPENSE TOTALS 885,336.00 Unit 00 - Non-Departmental 885,336.00 EXPENSE TOTALS $885,336.00 Fund 07 - Tort Immunity Fund REVENUE REVENUE TOTALS $825,000.00 EXPENSE REVENUE TOTALS 2,997,487.00 EXPENSE TOTALS 2,997,487.00 Fund 05 - Bond and Interest Fund Totals $0.00 EXPENSE TOTALS $2,997,487.00 Fund 05 - Bond and Interest Fund Totals REVENUE REVENUE TOTALS $2,997,487.00 EXPENSE Unit 00 - Non-Departmental 2,997,487.00 Fund 05 - Bond and Interest Fund Run by Traci Pleckham on 02/28/2024 08:49:38 AM Page 2 of 4 99 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget ($156,880.19)$0.00 $6,138,927.26 ($2,343,927.26)162%$2,510,896.25 135,304.78 .00 1,172,863.83 281,136.17 81 1,024,604.84 $135,304.78 $0.00 $1,172,863.83 $281,136.17 81%$1,024,604.84 (156,880.19).00 6,138,927.26 (2,343,927.26)162%2,510,896.25 135,304.78 .00 1,172,863.83 281,136.17 81%1,024,604.84 ($292,184.97)$0.00 $4,966,063.43 ($2,625,063.43)$1,486,291.41 $1,362,539.39 $0.00 $11,798,192.32 $13,584,807.68 46%$8,843,168.09 788,806.48 300,676.84 16,993,925.73 9,118,796.43 65 7,399,761.52 $788,806.48 $300,676.84 $16,993,925.73 $9,118,796.43 65%$7,399,761.52 1,362,539.39 .00 11,798,192.32 13,584,807.68 46%8,843,168.09 788,806.48 300,676.84 16,993,925.73 9,118,796.43 65%7,399,761.52 $573,732.91 ($300,676.84)($5,195,733.41)$4,466,011.25 $1,443,406.57 $15.41 $0.00 $8,846.96 $6,253.04 59%$13,727.37 .00 .00 5,859.94 14,140.06 29 8,113.78 $0.00 $0.00 $5,859.94 $14,140.06 29%$8,113.78 15.41 .00 8,846.96 6,253.04 59%13,727.37 .00 .00 5,859.94 14,140.06 29%8,113.78 $15.41 $0.00 $2,987.02 ($7,887.02)$5,613.59 EXPENSE TOTALS 20,000.00 Fund 14 - D.A.R.E. Fund Totals ($4,900.00) Fund 14 - D.A.R.E. Fund Totals REVENUE TOTALS 15,100.00 EXPENSE Unit 00 - Non-Departmental 20,000.00 EXPENSE TOTALS $20,000.00 Fund 11 - Capital Improvement Fund Totals ($1,030,399.00) Fund 14 - D.A.R.E. Fund REVENUE REVENUE TOTALS $15,100.00 Fund 11 - Capital Improvement Fund Totals REVENUE TOTALS 25,383,000.00 EXPENSE TOTALS 26,413,399.00 Unit 00 - Non-Departmental 26,413,399.00 EXPENSE TOTALS $26,413,399.00 Fund 11 - Capital Improvement Fund REVENUE REVENUE TOTALS $25,383,000.00 EXPENSE REVENUE TOTALS 3,795,000.00 EXPENSE TOTALS 1,454,000.00 Fund 10 - Police Pension Fund Totals $2,341,000.00 EXPENSE TOTALS $1,454,000.00 Fund 10 - Police Pension Fund Totals REVENUE REVENUE TOTALS $3,795,000.00 EXPENSE Unit 00 - Non-Departmental 1,454,000.00 Fund 10 - Police Pension Fund Run by Traci Pleckham on 02/28/2024 08:49:38 AM Page 3 of 4 100 Current Month YTD YTD Budget - YTD % Used/ Transactions Encumbrances Transactions Transactions Rec'd Prior Year YTD Budget by Organization Report Through 01/31/24 Prior Fiscal Year Activity Included Summary Listing Adopted Organization Budget $0.00 $0.00 $752,596.43 ($2,096.43)100%$747,530.96 355,638.92 .00 491,823.80 103,176.20 83 458,160.55 $355,638.92 $0.00 $491,823.80 $103,176.20 83%$458,160.55 .00 .00 752,596.43 (2,096.43)100%747,530.96 355,638.92 .00 491,823.80 103,176.20 83%458,160.55 ($355,638.92)$0.00 $260,772.63 ($105,272.63)$289,370.41 $0.00 $0.00 $564,785.77 $235,264.23 71%$639,912.70 504,320.97 .00 504,320.97 (104,320.97)126 299,802.38 $504,320.97 $0.00 $504,320.97 ($104,320.97)126%$299,802.38 .00 .00 564,785.77 235,264.23 71%639,912.70 504,320.97 .00 504,320.97 (104,320.97)126%299,802.38 ($504,320.97)$0.00 $60,464.80 $339,585.20 $340,110.32 $1,615.50 $0.00 $11,457.50 $3,642.50 76%$17,323.00 .00 .00 .00 20,000.00 0 .00 $0.00 $0.00 $0.00 $20,000.00 0%$0.00 1,615.50 .00 11,457.50 3,642.50 76%17,323.00 .00 .00 .00 20,000.00 0%.00 $1,615.50 $0.00 $11,457.50 ($16,357.50)$17,323.00 EXPENSE TOTALS 20,000.00 Fund 27 - Alcohol Enforcement Fund Totals ($4,900.00) Fund 27 - Alcohol Enforcement Fund Totals REVENUE TOTALS 15,100.00 EXPENSE Unit 00 - Non-Departmental 20,000.00 EXPENSE TOTALS $20,000.00 Fund 18 - Tax Increment Financing-Rt 30 Totals $400,050.00 Fund 27 - Alcohol Enforcement Fund REVENUE REVENUE TOTALS $15,100.00 Fund 18 - Tax Increment Financing-Rt 30 Totals REVENUE TOTALS 800,050.00 EXPENSE TOTALS 400,000.00 Unit 00 - Non-Departmental 400,000.00 EXPENSE TOTALS $400,000.00 Fund 18 - Tax Increment Financing-Rt 30 REVENUE REVENUE TOTALS $800,050.00 EXPENSE REVENUE TOTALS 750,500.00 EXPENSE TOTALS 595,000.00 Fund 17 - Tax Increment Financing-Downtown Totals $155,500.00 EXPENSE TOTALS $595,000.00 Fund 17 - Tax Increment Financing-Downtown Totals REVENUE REVENUE TOTALS $750,500.00 EXPENSE Unit 00 - Non-Departmental 595,000.00 Fund 17 - Tax Increment Financing-Downtown Run by Traci Pleckham on 02/28/2024 08:49:38 AM Page 4 of 4 101 24401 W. Lockport Street Plainfield, IL 60544 Phone (815) 436-7093 Fax (815) 436-1950 Web www.plainfieldil.gov M E M O R A N D U M To: Board of Trustees From: Mayor Argoudelis Date: February 21, 2024 Subject: New Liquor License – Maple Butter Cafe We received a liquor license application for a Class E(b) Liquor License for Maple Butter Café to be located at 24020 W. 119th Street. A Class E(b) liquor license allows for the retail sale of all alcoholic liquor for consumption on the premises where no portion of the licensed premises contains a lounge or bar, and the primary business conducted on the licensed premises is a: (a) coffee shop; or (b) limited-service dining establishment. The applicant was the previous owner Plainfield Delight. During ownership of Plainfield Delight, the applicant held a Village of Plainfield Liquor License and did not receive any liquor license violations. The Plainfield Police Department conducted a background check on the applicant and reports no adverse or unfavorable information that might prohibit the Plainfield Liquor Commissioner from issuing a liquor license. I will place this item on the March 4, 2024 Village Board Meeting for formal consideration. With the Board’s concurrence, the following motion would be necessary: I move to adopt Ordinance No. , increasing the Class “E” Liquor Licenses to 10 for Maple Butter Café located at 24020 W. 119th Street. JOHN F. ARGOUDELIS PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally J. Larson Tom Ruane Brian Wojowski 102 ORDINANCE NO. _______ AN ORDINANCE AMENDING CHAPTER 4 OF THE CODE OF ORDINANCES OF THE VILLAGE OF PLAINFIELD REGARDING ALCOHOLIC LIQUOR NOW, THEREFORE, BE IT ORDAINED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL AND KENDALL COUNTIES, ILLINOIS AS FOLLOWS: I. That Chapter 4, Article II, Section 4-22 (a) of the Code of Ordinances is hereby amended as follows: Class E: The number of licenses is changed from 9 to 10. This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as required by law. This Ordinance shall be numbered as Ordinance No. _______. PASSED THIS 4TH DAY OF MARCH, 2024. AYES: NAYS: ABSENT: APPROVED THIS 4TH DAY OF MARCH, 2024. VILLAGE PRESIDENT ATTEST: VILLAGE CLERK 103 MEMORANDUM To: Joshua Blakemore, Village Administrator From: Scott Threewitt, Director of Public Works Date: February 28, 2024 Re: Proposed 143rd Street East Roadway Extension Property Acquisition-Legal Fees (October 2023) Background Findings The item under consideration by the Village Board pertains to services rendered by Dunn, Martin & Miller, Ltd. for the 143rd Street East Extension in October 2023. Invoices for these services were recently forwarded by the Illinois Department of Transportation to the Village and are specific to eminent domain proceedings for the following properties: Plainfield Corners, LLC (1NN0002) and U-Store-It (1NN0004). 1NN0002 Plainfield Corners, LLC $4,925.00 1NN0004 U-Store-It $33,397.50 TOTAL $38,322.50 Policy Considerations The Village has entered into an Intergovernmental Agreement with the Illinois Department of Transportation and this acquisition is consistent with that agreement. According to Section 2-76(d)(5) of the Village Code of Ordinances, the Village Administrator shall make a recommendation to the President and Board of Trustees on purchases over the $10,000 statutory limit. The Board has the right to accept or reject any or all proposals. Financial Considerations Land acquisition for the 143rd Street East Extension is funded through the Capital Improvement Fund under the line item for 143rd Street East Extension (11-00-91-9165.009). Recommendation Staff recommends that the Village Board approve legal fees for services rendered by Dunn, Martin & Miller, Ltd. for the 143rd Street East Extension for October 2023 totaling $38,322.50. 104 BUREAU OF LAND ACQUISITION Route: 143rd Street Location: US 30 / 143rd Street County: Will Job No.: R-91-012-20Parcels: 1NN0002, 1NN0004 and 1NN0005 VIA ELECTRONIC DELIVERY February 15, 2024 Mr. Scott Threewitt, P.E., Lead Engineer Village of Plainfield 14400 Coil Plus Drive Plainfield, IL 60544 Dear Mr. Threewitt: Enclosed please find cover letter/statement dated November 3, 2023 in the amount of $38,322.50 from Dunn, Martin & Miller, Ltd. for services rendered in October 2023. This cover letter/statement covers the expense of eminent domain proceedings for the above-referenced parcels and are being forwarded to the Village of Plainfield for payment. Please submit your remittance directly to Dunn, Martin & Miller, Ltd. Also, please send a copy of your remittance to Ms. Joy A. Gustafson, Local Agency Coordinator (IDOT). Should you have any questions or require additional information, please do not hesitate to contact Ms. Gustafson at Joy.Gustafson@illinois.gov or (847) 705-4334. Very truly yours, Jose Rios, PE Region One Engineer By: Omolara Johnson B ureau Chief of Land Acquisition 105 Received 11/3/2023 106 Approved Amount $38,322.50 JButler 1/8/2024 /s/Jose Rios Omolara Johnson01/12/2024 107 108 109 110 111 112 113 114 115 24401 W. Lockport Street · Plainfield, IL 60544 Phone (815) 4363-7093 Fax (815) 436-1950 www.plainfield-il.org MEMO TO: PRESIDENT ARGOUDELIS and BOARD OF TRUSTEES FROM: JAKE MELROSE, AICP, E.D. DIRECTOR MEETING DATE: MARCH 4, 2024 SUBJECT: GREENBRIAR BOND REDUCTION (Bond No. CMS0344913) On behalf of the Greenbriar developer, D.R. Horton, staff is submitting the attached bond reduction request associated with the security bond provided for the necessary public improvements of the Willow Run subdivision located generally NEC Steiner Road and Lockport St./IL Route 126. At this time, substantial public improvements have been completed in particular phases and the Village’s Subdivision Code allows for the development to request a reduction to reflect the completed work. The Village recommends reducing the bond per the following: Phase I Improvements: $613,666.75 Phase II Improvements: $2,500.00 Phase III Improvements: $709,820.14. Total Willow Run Unit 2 Bond amount to Remain w/ contingency: $1,458,585.58 Staff recommends approval. This matter will be placed on the consent agenda for the March 4, 2024 meeting of the Board of Trustees. Encl. Review Letter by Baxter Woodman and Attached Bond Reduction Request (2-8-24) Cc: Scott Threewitt, P.E., Director of Public Works Angela Geraci, DR Horton John F. Argoudelis PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally Larson Tom Ruane Brian Wojowski 116 February 8, 2024 Mr. Jake Melrose, AICP Economic Development Manager Village of Plainfield 24401 West Lockport Street Plainfield, IL 60544 Subject: Village of Plainfield – Greenbriar Unit 1 Bond Reduction - Bond # CMS0344913 Dear Mr. Melrose: Baxter & Woodman completed a review of DR Horton’s request to reduce the bond amounts on the above referenced project. Below is a breakdown of the current project status and our recommendations: PHASE I Erosion Control Improvements Original Bond amount posted $ 113,666.75 Current Bond amount remaining $ 113,666.75 Recommended Bond amount to remain $ 113,666.75 Mass Earthwork and Demolition Improvements Original Bond amount posted $ 743,936.00 Current Bond amount remaining $ 743,936.00 Recommended Bond amount to remain $ 0.00 Water Main Improvements Original Bond amount posted $ 876,656.00 Current Bond amount remaining $ 876,656.00 Recommended Bond amount to remain $ 0.00 Sanitary Sewer Improvements Original Bond amount posted $ 1,174,645.00 Current Bond amount remaining $ 1,174,645.00 Recommended Bond amount to remain $ 500,000.00 117 Storm Sewer Improvements Original Bond amount posted $ 1,555,645.00 Current Bond amount remaining $ 1,555,645.00 Recommended Bond amount to remain $ 0.00 Subtotal -PHASE I Bond amount to remain $ 613,666.75 PHASE II Pavement Improvements Original Bond amount posted $ 793,549.00 Current Bond amount remaining $ 793,549.00 Recommended Bond amount to remain $ 0.00 Lighting and Signage Improvements Original Bond amount posted $ 140,000.00 Current Bond amount remaining $ 140,000.00 Recommended Bond amount to remain $ 2,500.00 Subtotal -PHASE II Bond amount to remain $ 2,500.00 PHASE III Pavement Improvements Original Bond amount posted $ 713,742.85 Current Bond amount remaining $ 713,742.85 Recommended Bond amount to remain $ 442,135.14 Landscaping Improvements Original Bond amount posted $ 267,685.00 Current Bond amount remaining $ 267,685.00 Recommended Bond amount to remain $ 267,685.00 Subtotal -PHASE III Bond amount to remain $ 709,820.14 118 Total Greenbriar Unit 1 Bond amount to remain PHASE I $ 613,666.75 PHASE II $ 2,500.00 PHASE III $ 709,820.14 Subtotal:$ 1,325,986.89 10% Contingency $ 132,598.69 TOTAL:$ 1,458,585.58 If you have any questions or need additional information, please contact us. Very truly yours, BAXTER & WOODMAN, INC. Matt Abbeduto, P.E, Construction Services Department Manager C: Jonathan S. Proulx, AICP, Community Development Director Scott Threewitt, P.E., Director of Public Works Angela Geraci, DR Horton Dave Boyd, Baxter & Woodman, Inc. 119 120 DATE: 1/23/24 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTALCOMPLETECOMPLETEREMAINING EROSION CONTROL IMPROVEMENTS Silt Fence L.F $1.75 18,953 $33,167.75 100.00%$0.00 $33,167.75Inlet Protector w/Maintenance EA.$180.00 151 $27,180.00 100.00%$0.00 $27,180.00Turf Seed Mix AC.$1,500.00 10.00 $15,000.00 100.00%$0.00 $15,000.00Erosion Control Blanket S.Y.$0.50 16,638 $8,319.00 100.00%$0.00 $8,319.00Turf Reinforcement Mat S.Y.$50.00 210 $10,500.00 100.00%$0.00 $10,500.00Rock Check Dam EA.$1,500.00 9 $13,500.00 100.00%$0.00 $13,500.00Construction Entrance EA.$3,500.00 1 $3,500.00 100.00%$0.00 $3,500.00Concrete Washout Facility EA.$2,500.00 1 $2,500.00 100.00%$0.00 $2,500.00 Sub-Total $113,666.75 $0.00 $113,666.75 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING MASS EARTHWORK & DEMOLITION IMPROVEMENTS Topsoil Strip to Stockpile C.Y.$3.00 99,529 $298,587.00 100.00% 99,529 $298,587.00 $0.00 Topsoil Strip to Unclassified Fills C.Y.$3.00 31,235 $93,705.00 100.00% 31,235 $93,705.00 $0.00 Topsoil Respread from Stockpile (Lots)C.Y.$4.00 29,239 $116,956.00 100.00% 29,239 $116,956.00 $0.00 Clay Excavation to Structural Fill C.Y.$4.00 58,672 $234,688.00 100.00% 58,672 $234,688.00 $0.00 Sub-Total $743,936.00 $743,936.00 $0.00 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING WATERMAIN IMPROVEMENTS DIWM 8", Cl. 52 L.F.$40.00 7,633 $305,320.00 100.00% 7,633 $305,320.00 $0.00 DIWM 12", Cl. 52 L.F.$50.00 2,808 $140,400.00 100.00% 2,808 $140,400.00 $0.00 8" Valve in 4' Vault EA.$3,600.00 16 $57,600.00 100.00% 16 $57,600.00 $0.00 12" Valve in 5' Vault EA.$6,000.00 9 $54,000.00 100.00% 9 $54,000.00 $0.00 Hydrant w/Aux. Valve EA.$3,900.00 29 $113,100.00 100.00% 29 $113,100.00 $0.00 Water Service 1 1/4", Ty. K w/ Box (Long)EA.$1,800.00 58 $104,400.00 100.00% 58 $104,400.00 $0.00 Water Service 1 1/4", Ty. K w/ Box (Short)EA.$950.00 69 $65,550.00 100.00% 69 $65,550.00 $0.00 Connect to existing EA.$1,000.00 2 $2,000.00 100.00% 2 $2,000.00 $0.00 Trench Backfill L.F.$40.00 850 $34,000.00 100.00% 850 $34,000.00 $0.00 Watermain Protection L.F.$0.50 572 $286.00 100.00% 572 $286.00 $0.00 Sub-Total $876,656.00 $876,656.00 $0.00 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING SANITARY SEWER IMPROVEMENTS Sanitary Sewer, 8" PVC SDR 26 L.F.$40.00 2,173 $86,920.00 100.00% 2,173 $86,920.00 $0.00 Sanitary Sewer, 10" PVC SDR 26 L.F.$50.00 3,177 $158,850.00 100.00% 3,177 $158,850.00 $0.00 Televise Sanitary Sewer L.F.$2.00 5,350 $10,700.00 100.00% 5,350 $10,700.00 $0.00 Sanitary M.H., Ty. A w/ Ty. 1 Fr & SS Lid EA.$3,000.00 23 $69,000.00 100.00%23 $69,000.00 $0.00 Sanitary Service, 6" PVC SDR 26 Short EA.$600.00 57 $34,200.00 100.00%57 $34,200.00 $0.00 Sanitary Service, 6" PVC SDR 26 Long EA.$2,500.00 70 $175,000.00 100.00%70 $175,000.00 $0.00 Lift Station EA. $500,000.00 1 $500,000.00 100.00%1 $0.00 $500,000.00 Force Main, 6" PVC SDR 26 ASTM D2241 & F477 JOINTS L.F.$45.00 2,155 $96,975.00 100.00% 2,155 $96,975.00 $0.00 Connect to Existing Sanitary Sewer Manhole EA.$2,500.00 1 $2,500.00 100.00%1 $2,500.00 $0.00 Trench Backfill L.F.$45.00 900 $40,500.00 100.00%900 $40,500.00 $0.00 Sub-Total $1,174,645.00 $674,645.00 $500,000.00 Greenbriar - Phase 1 - Unit 1 Village of Plainfield BOND REDUCTION BOND #CMS0344913 Page 1 of 3 121 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING STORM SEWER IMPROVEMENTS Storm Sewer, 12" RCP, Ty. 1 L.F.$42.00 2,787 $117,054.00 100.00% 2,787 $117,054.00 $0.00 Storm Sewer, 15" RCP, Ty. 1 L.F.$45.00 1,023 $46,035.00 100.00% 1,023 $46,035.00 $0.00 Storm Sewer, 18" RCP, Ty. 1 L.F.$48.00 593 $28,464.00 100.00% 593 $28,464.00 $0.00 Storm Sewer, 21" RCP, Ty. 1 L.F.$50.00 206 $10,300.00 100.00% 206 $10,300.00 $0.00 Storm Sewer, 24" RCP, Ty. 1 L.F.$55.00 611 $33,605.00 100.00% 611 $33,605.00 $0.00 Storm Sewer, 27" RCP, Ty. 1 L.F.$58.00 296 $17,168.00 100.00% 296 $17,168.00 $0.00 Storm Sewer, 30" RCP, Ty. 1 L.F.$60.00 387 $23,220.00 100.00% 387 $23,220.00 $0.00 Storm Sewer, 36" RCP, Ty. 1 L.F.$66.00 1,062 $70,092.00 100.00% 1,062 $70,092.00 $0.00 Storm Sewer, 42" RCP, Ty. 1 L.F.$80.00 1,865 $149,200.00 100.00% 1,865 $149,200.00 $0.00 Storm Sewer, 48" RCP, Ty. 1 L.F.$85.00 778 $66,130.00 100.00% 778 $66,130.00 $0.00 Storm Sewer, 54" RCP, Ty. 1 L.F.$90.00 1,615 $145,350.00 100.00% 1,615 $145,350.00 $0.00 Storm Sewer, 24" x 36" RCP, Ty. 1 Elliptical L.F.$85.00 30 $2,550.00 100.00% 30 $2,550.00 $0.00 Storm Sewer, 18" x 24" RCP, Ty. 1 Elliptical L.F.$80.00 30 $2,400.00 100.00% 30 $2,400.00 $0.00 Storm Sewer, 29" x 45" RCP, Ty. 1 Elliptical L.F.$100.00 30 $3,000.00 100.00% 30 $3,000.00 $0.00 Storm Sewer, 24" x 38" RCP, Ty. 1 Elliptical L.F.$90.00 643 $57,870.00 100.00% 643 $57,870.00 $0.00 Storm Sewer, 8" PVC SDR 26 L.F.$18.00 44 $792.00 100.00% 44 $792.00 $0.00 Storm Manhole, 4' Dia., Ty. A w/ Ty. 1 Fr. & O.L EA.$3,000.00 6 $18,000.00 100.00% 6 $18,000.00 $0.00 Storm Manhole, 4' Dia., Ty. A w/ Ty. 1 Fr. & C.L.EA.$3,000.00 6 $18,000.00 100.00% 6 $18,000.00 $0.00 Storm Manhole, 4' Dia., Ty. A w/R-3281-AL FR. & GR.EA.$3,000.00 1 $3,000.00 100.00% 1 $3,000.00 $0.00 Storm Manhole, 4' Dia., Ty. A w/R-3501P FR. & GR.EA.$4,000.00 4 $16,000.00 100.00% 4 $16,000.00 $0.00 Storm Manhole, 5' Dia., Ty. A w/ Ty. 1 Fr. & O.L.EA.$4,500.00 6 $27,000.00 100.00% 6 $27,000.00 $0.00 Storm Manhole, 5' Dia., Ty. A w/ Ty. 1 Fr. & C.L.EA.$4,500.00 8 $36,000.00 100.00% 8 $36,000.00 $0.00 Storm Manhole, 5' Dia., Ty. A w/R-3501P FR. & GR.EA.$6,000.00 1 $6,000.00 100.00% 1 $6,000.00 $0.00 Storm Manhole, 6' Dia., Ty. A w/ Ty. 1 Fr. & O.L.EA.$7,000.00 21 $147,000.00 100.00% 21 $147,000.00 $0.00 Storm Manhole, 6' Dia., Ty. A w/ Ty. 1 Fr. & C.L.EA.$7,000.00 5 $35,000.00 100.00% 5 $35,000.00 $0.00 Storm Manhole, 6' Dia., Ty. A w/R-3501P FR. & GR.EA.$7,000.00 3 $21,000.00 100.00% 3 $21,000.00 $0.00 Storm Manhole, 7' Dia., Ty. A w/ Ty. 1 Fr. & C.L.EA.$7,700.00 6 $46,200.00 100.00% 6 $46,200.00 $0.00 Storm Manhole, 7' Dia., Ty. A w/ Ty. 1 Fr. & O.L.EA.$7,700.00 1 $7,700.00 100.00% 1 $7,700.00 $0.00 Storm Manhole, 8' Dia., Ty. A w/ Ty. 1 Fr. & C.L.EA.$8,400.00 2 $16,800.00 100.00% 2 $16,800.00 $0.00 Storm Manhole, 8' Dia., Ty. A w/ Ty. 1 Fr. & O.L.EA.$8,400.00 1 $8,400.00 100.00% 1 $8,400.00 $0.00 54 x 48 Base Tee MH TY. A w/TY. 1 FR. & O.L EA.$5,000.00 21 $105,000.00 100.00% 21 $105,000.00 $0.00 Catch Basin, 7' Dia., w/R-3501P FR. & GR.EA.$7,500.00 2 $15,000.00 100.00% 2 $15,000.00 $0.00 Catch Basin, 6' Dia., w/R-3501P FR. & GR.EA.$6,800.00 3 $20,400.00 100.00% 3 $20,400.00 $0.00 Catch Basin, 6' Dia., w/TY. 1 FR. & C.L.EA.$6,800.00 2 $13,600.00 100.00% 2 $13,600.00 $0.00 Catch Basin, 5' Dia., w/R-3501P FR. & GR.EA.$6,000.00 2 $12,000.00 100.00% 2 $12,000.00 $0.00 Catch Basin, 4' Dia., Ty. A w/ R-3501P FR. & GR.EA.$3,800.00 5 $19,000.00 100.00% 5 $19,000.00 $0.00 Catch Basin, 3' Dia., Ty. A w/ R-3501P FR. & GR.EA.$3,400.00 1 $3,400.00 100.00% 1 $3,400.00 $0.00 Catch Basin, 3' Dia., w/R-3281-AL FR & GR.EA.$3,000.00 6 $18,000.00 100.00% 6 $18,000.00 $0.00 Catch Basin, 2' Dia., Ty. A w/ R-3501P FR. & GR.EA.$2,800.00 12 $33,600.00 100.00% 12 $33,600.00 $0.00 Inlet, 2' Dia., Ty. 1 Fr. & O.L.EA.$1,000.00 10 $10,000.00 100.00% 10 $10,000.00 $0.00 Inlet, 2' Dia., w/R-3501P FR. & GR.EA.$1,000.00 29 $29,000.00 100.00% 29 $29,000.00 $0.00 Inlet, 2' Dia., Ty. A w/ R-3281-Al Fr. & Gr.EA.$1,000.00 1 $1,000.00 100.00% 1 $1,000.00 $0.00 Inlet, 3' Dia., w/R-3501P FR. & GR.EA.$1,100.00 2 $2,200.00 100.00% 2 $2,200.00 $0.00 Inlet, 3' Dia., Ty. 1 Fr. & O.L.EA.$1,100.00 -$0.00 100.00% -$0.00 $0.00 Flared End Section, 12" RCP w/ Grate EA.$1,000.00 5 $5,000.00 100.00% 5 $5,000.00 $0.00 Flared End Section, 15" RCP w/ Grate EA.$1,000.00 1 $1,000.00 100.00% 1 $1,000.00 $0.00 Flared End Section, 24" RCP w/ Grate EA.$1,250.00 8 $10,000.00 100.00% 8 $10,000.00 $0.00 Flared End Section, 27" RCP w/ Grate EA.$1,700.00 1 $1,700.00 100.00% 1 $1,700.00 $0.00 Flared End Section, 42" RCP w/Grate EA.$2,800.00 2 $5,600.00 100.00% 2 $5,600.00 $0.00 Flared End Section, 48" RCP w/ Grate EA.$3,000.00 2 $6,000.00 100.00% 2 $6,000.00 $0.00 Flared End Section, 54" RCP w/ Grate EA.$3,200.00 1 $3,200.00 100.00% 1 $3,200.00 $0.00 Flared End Section, 18" x 24" RCP w/ Grate EA.$1,800.00 1 $1,800.00 100.00% 1 $1,800.00 $0.00 Flared End Section, 24" x 36" RCP w/ Grate EA.$2,000.00 1 $2,000.00 100.00% 1 $2,000.00 $0.00 Flared End Section, 24" x 38" RCP w/ Grate EA.$2,500.00 2 $5,000.00 100.00% 2 $5,000.00 $0.00 Flared End Section, 29" x 45" RCP w/ Grate EA.$3,000.00 1 $3,000.00 100.00% 1 $3,000.00 $0.00 Temp. Riser Pipe Perf. w/ PVC Outlet Pipe EA.$50.00 2 $100.00 100.00% 2 $100.00 $0.00 Trench Backfill L.F.$35.00 1,449 $50,715.00 100.00%1,449 $50,715.00 $0.00 Sub-Total $1,556,645.00 $1,556,645.00 $0.00 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING PAVEMENT IMPROVEMENTS Fine Grading S.Y.1.50$23,434 $35,151.00 100.00% 23,434 $35,151.00 $0.00 Aggregate Base Course, Type B, 12", 18" Beyond Curb S.Y.10.00$2,957 $29,570.00 100.00% 2,957 $29,570.00 $0.00 Aggregate Base Course, Type B, 10", 18" Beyond Curb S.Y.9.00$20,477 $184,293.00 100.00%20,477 $184,293.00 $0.00 Hot Mix Asphalt Binder Course - 3"TON 75.00$3,356 $251,700.00 100.00% 3,356 $251,700.00 $0.00 Bit. Material. Prime Coat @ .3 Gal/S.Y.Gal.3.50$7,030 $24,605.00 100.00% 7,030 $24,605.00 $0.00 Rolled Curb and Gutter L.F.20.00$11,204 $224,080.00 100.00% 11,204 $224,080.00 $0.00 B-6.12 Curb and Gutter L.F.25.00$1,766 $44,150.00 100.00% 1,766 $44,150.00 $0.00 Sub-Total $793,549.00 $793,549.00 $0.00 Page 2 of 3 122 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING Single Arm LED Street Light, complete EA.4,500.00$22 $99,000.00 100.00%22 $99,000.00 $0.00Double Arm LED Street Light, complete EA.6,000.00$6 $36,000.00 100.00%6 $36,000.00 $0.00 Signage L.S.2,500.00$1 $2,500.00 100.00%1 $2,500.00 $0.00 Pavement Striping L.S.2,500.00$1 $2,500.00 100.00%1 $0.00 $2,500.00 Sub-Total $140,000.00 $137,500.00 $2,500.00 Bond Amount toRemain $2,500.00 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING Bit. Surface Cse., 1 1/2"TON 75.00$ 3,051 $228,825.00 95.00% 2,898 $217,383.75 $11,441.25 Bit Material Tack Coat @ .1 Gal./SY Gal.3.45$ 2,343 $8,083.35 95.00% 2,226 $7,679.18 $404.17 PCC Sidewalk, 5" Thick, 5" Wide S.F.7.00$61,120 $427,840.00 0.00%-$0.00 $427,840.00 Bike Path, 8' Wide, Fine Grading S.Y.1.50$2,847 $4,270.50 95.00% 2,705 $4,056.98 $213.53 Bike Path, 8' Wide, Aggregate Base Course, Type B, 6"S.Y.6.50$2,847 $18,505.50 95.00% 2,705 $17,580.23 $925.27 Bike Path, 8' Wide, Bit. Material Tack Coat @ 0.1 gal/sy Gal.2.50$285 $712.50 95.00%271 $676.88 $35.63 Bike Path, 8' Wide, Hot Mix Asphalt Surface Course, 2"TON 78.00$327 $25,506.00 95.00%311 $24,230.70 $1,275.30 Sub-Total $713,742.85 $271,607.71 $442,135.14 PAY ITEM UNITS UNIT COST QUANTITY TOTAL COST % COMPLETE QUANTITY TOTAL TOTAL COMPLETE COMPLETE REMAINING Street Trees @ 40' c-c EA.300.00$ 390 $117,000.00 100.00%-$0.00 $117,000.00 Parkway Restoration Seeding Class 1 Type 1A Salt Tolerant S.Y.0.50$ 14,370 $7,185.00 100.00%-$0.00 $7,185.00 Native Landscape Maintenance & Monitoring YEAR 14,500.00$ 3 $43,500.00 100.00%-$0.00 $43,500.00 Ornamental Stone swale liner TON 100.00$ 250 $25,000.00 100.00%-$0.00 $25,000.00 Detention Basin Landscaping EA.75,000.00$ 1 $75,000.00 100.00%-$0.00 $75,000.00 Sub-Total $267,685.00 $0.00 $267,685.00 Phase 1 $613,666.75 Phase 2 $2,500.00 Phase 3 $709,820.14 Total $1,325,986.89 $132,598.69 $1,458,585.58 LANDSCAPE IMPROVEMENTS Summary Remaining Bond Amount + 10% Contingency LIGHTING & SIGNAGE IMPROVEMENTS PAVEMENT IMPROVEMENTS Page 3 of 3 123 Vendor Invoice No.Status Invoice Date G/L Date Payment Date Invoice Amount 12254 - TRACY, JOHNSON & WILSON 2024-00001423 Edit 01/10/2024 03/05/2024 1,569.75 12254 - TRACY, JOHNSON & WILSON 2024-00001424 Edit 02/09/2024 03/05/2024 1,696.50 12254 - TRACY, JOHNSON & WILSON 2024-00001425 Edit 01/10/2024 03/05/2024 3,391.50 12254 - TRACY, JOHNSON & WILSON 2024-00001426 Edit 02/09/2024 03/05/2024 2,227.00 Invoice Transactions 4 $8,884.75 Invoice Transactions 4 $8,884.75 12254 - TRACY, JOHNSON & WILSON 2024-00001427 Edit 01/10/2024 03/05/2024 741.00 Invoice Transactions 1 $741.00 Invoice Transactions 1 $741.00 Invoice Transactions 5 $9,625.75 12254 - TRACY, JOHNSON & WILSON 2024-00001428 Edit 01/10/2024 03/05/2024 390.00 Invoice Transactions 1 $390.00 Invoice Transactions 1 $390.00 Invoice Transactions 1 $390.00 Invoice Transactions 6 $10,015.75 Invoice Transactions 6 $10,015.75Grand Totals Division 20 - Planning Program Totals Unit 09 - Community Development Totals Fund 01 - General Fund Totals Division 20 - Planning Program Account 8065 - Legal Fees 55/30 (Boulevard) Incentive Agreement Account 8065 - Legal Fees Totals Division 09 - Legal Program Totals Unit 04 - Administration/Finance Totals Unit 09 - Community Development Division 09 - Legal Program Account 8065 - Legal Fees Traffic Prosecution Assistance 7560-318L Account 8065 - Legal Fees Totals VH Legal Fees 7560.001 Account 8065 - Legal Fees Totals Division 02 - Administration Program Totals Division 02 - Administration Program Account 8065 - Legal Fees Shrock, Phelps, et al. vs. VOP 7560-320L Shrock, Phelps, et al. vs. VOP 7560-320L VH Legal Fees 7560.001 Accounts Payable by G/L Distribution Report Invoice Due Date Range 03/05/24 - 03/05/24 Invoice Description Fund 01 - General Fund Unit 04 - Administration/Finance Run by Kristin Partyka on 02/29/2024 11:05:09 AM Page 1 of 1 124 TO: PRESIDENT ARGOUDELIS and BOARD OF TRUSTEES FROM: ALYSSA MARTIN, AICP DATE: MARCH 4, 2024 SUBJECT: HAWK AUTO CASE NUMBER: 2036-120723.SPR.FP REQUEST: Site Plan Review and Final Plat LOCATION: 16761 S Route 59 APPLICANTS: Simon Design Group on behalf of Hawk Auto CURRENT ZONING: B3 Highway Business District COMP. PLAN: General Commercial DISCUSSION The petitioner, Hawk Auto, is proposing to construct a new car dealership on a vacant 89-acre parcel located approximately at 16761 IL Route 59 just north of Rolf Road and Plainsman Terrace subdivision. The applicant is seeking site plan approval and re-approval of the previously approved final plat at the March 27, 2023, Plan Commission hearing and the April 3, 2023, Village Board hearing. The proposed site is zoned B3 Highway Business District and auto sales is considered a permitted use in the subject zoning district. A rezoning from R1 to B3 was approved at the previously mentioned hearings. Existing Conditions/Site Context The adjacent land-uses, zoning and functional street classifications are identified below: North: Utility easement East: Vacant Lot and wetlands (R1 Low Density Single-family Residential) South: Plainsman Terrace Subdivision Residential (R1 Low Density Single-family Residential) West: R-1 Single Family Residential District/Fritz Farm (Rte 59 – Major Arterial) SITE PLAN ANALYSIS The new proposed Hawk Auto car dealership contains four separate buildings, each containing a separate dealer, with each building ranging in size from 16,900 square feet to 28,700 square feet. The site location is situated off S Rte59 between Rolf Road and Dayfield Drive. Two dealerships are currently moving forward at this time, Cadillac and Volkswagen, which are for the two JOHN F. ARGOUDELIS PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally J. Larson Tom Ruane Brian Wojowski 125 REPORT TO THE VILLAGE BOARD Page #2 of 4 CASE #2036-120723.SPR.FP 2/28/2024 HAWK AUTO SITE PLAN & PLAT southern buildings. Hawk Auto is seeking approval of the full master plan of the site and the other two dealerships will come in under administrative site plan review and final engineering. Specific site plan aspects are discussed below. Parking, Access, and Circulation Three access points are proposed for the site spaced evenly across the site along Rte 59 (~583ft from northern to the middle access and 563ft from the middle to the southern access). The southern and northern access points are right-in/right-out, while the middle access is a full access with a lane for ingress and a right and left turn lane for egress with a proposed signalized intersection. A new left turn, southbound lane will be constructed as part of the project in accordance with IDOT standards. The applicant is seeking a traffic signal; however, this is under IDOT’s control. Two 12 x 65’ loading spaces are provided to the rear of buildings at the southern end of the site. One space per building is provided along the sides of the northern structures. By its nature, the dealership has expansive parking. All parking meets Village Ordinance size, spacing, and required counts. Customer parking is situated along the front and side facades of each building with employee parking to the rear. Engineering / Stormwater Management Current Village policy does not require final engineering at the time of site plan review; however, a preliminary engineering review has been done regarding stormwater management and the detention pond proposed directly east of the dealership. As a stipulation of approval, all requirements of the Village Engineer must be met with final engineering. 126 REPORT TO THE VILLAGE BOARD Page #3 of 4 CASE #2036-120723.SPR.FP 2/28/2024 HAWK AUTO SITE PLAN & PLAT Zoning Ordinance Compliance Staff notes the following with respect to additional development standards of the B-3 zoning district not discussed above: Development Standard Required Provided Minimum Lot Area 43,560 sf complies Minimum Lot Width (sf) 100 ft >100 ft Maximum Building Height 35 ft ~25 ft Floor-Area Ratio 0.4 complies Minimum Front Setback 30 ft complies Minimum Interior Side Setback 15 ft complies Minimum Rear Setback 30 ft complies Elevations / Façade / Architecture Elevations have been provided presenting buildings utilizing large glass areas providing views into the showroom. For the VW building, white concrete is proposed for the front façade (with the majority being windows) and aluminum composite for the secondary façades. The Cadillac building will mainly have aluminum siding with large showroom windows. Building articulation has been provided, particularly on the Cadillac elevation, and the elevations meet the site plan requirements of the Village Code. Landscaping The applicant submitted a landscape plan as part of the site plan review application that conforms to the Village code and requirements previously imposed regarding the transitional yard and berm separation from the residential area to the south of the site. Vegetation will line the shared internal access, as well as the front/rear/north side of the property. Street trees are provided at regular intervals along Rte 59. The required 60’ landscape buffer on the southern end of the property will be built on a berm of varying height from 1-3’ tall (majority of berm is 3’ feet in height). Staff had recommended the berm is undulating to provide a more natural aesthetic and be covered with evergreen trees and shrubs so as to maintain visual separation even in the winter months, which was updated on the landscaping plan. In addition, a 6’ tall cedar plank fence will be placed on the south end of the property along the parking lot directly in front of the berm. Lighting / Photometrics The applicant has submitted a photometric plan that demonstrates that the light spill diminishes to at or below the maximum permitted levels at the property line (0.5 footcandles). The proposed mounting height of the parking lot light fixtures does not exceed the principal height of the building, in accordance with the site plan review ordinance. The applicant has also provided cut sheets of the proposed fixtures. The initial photometric plan provided showed intense lighting levels but has been greatly reduced after comments by staff were provided. 127 REPORT TO THE VILLAGE BOARD Page #4 of 4 CASE #2036-120723.SPR.FP 2/28/2024 HAWK AUTO SITE PLAN & PLAT FINAL PLAT As previously mentioned, the final plat was approved by the Village Board on April 3, 2023. The original parcel is being subdivided into two parcels. Lot 1 will contain the dealership, and Lot 2 will contain stormwater detention and possible future development. The stormwater area has since changed from the initial approval and now abuts the residential area providing additional buffer from future development of the vacant land area. PLAN COMMISSION Plan Commission heard this case at their February 6, 2024 meeting. There were a few public comments and these commenters asked questions pertaining to the stormwater management/flooding and landscape buffering. Commissioner comments were in relation to traffic, access, and lighting. The petitioner explained there is substantiative plantings for screening purposes that exceed village standards. Additionally, staff and the applicant expressed that proper measures will be taken with IDOT and village coordination regarding access points and road improvements. As for lighting, the applicant has noted the suggestion for lower lighting temperatures, although the applicant has expressed the need for higher temperatures for security and adequate visual representation of vehicles. The application received a unanimous positive recommendation (vote: 4-0). COMMITTEE OF THE WHOLE The application was presented at the February 26, 2024 Committee of the Whole meeting. Some trustees noted there should be flexibility in the location of street trees and the lighting intensity in the interior of the site. Staff can work with the application on these adjustments if requested. The proposal received a favorable recommendation from all trustees present. CONCLUSION/RECOMMENDATION Staff finds the site plan proposal and final plat meets all requirements of the Village Ordinance. Prior to any Village Board discussion, staff recommends approval of the proposed site plan and final plat. Should Village Board concur, the following motions are offered for your consideration: FINAL PLAT MOTION I move we recommend approval of the proposed Hawk Auto Final Plat of Subdivision, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District 3. Compliance with the requirements of IDOT SITE PLAN MOTION I move we recommend approval of the proposed site plan review for the Hawk Auto Site Plan, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District 3. Compliance with the requirements of IDOT 128 FIR 5/8FCCFCCFIPFCCFCCFIR_5/8.CAP.ORG 27NQXFIR 5/8 BENTFIR 5/8 YLW CAPFIR 5/8 CAP.YLWFIR 5/8 CAP.YLWFIR 5/8FIR_CAP.2INFIR_CAP.2IN_IDOTFIR_5/8_CAP.YLWFIR_5/8_CAP.YLWFIR_5/8FIR_5/8 BENTFIP_1.5FCC602.52SBM_HYD.NW.TAGBOLTFIR_5/8FIP_3/4FIP_3/4FIR_5/8FIR_5/8FIP_1FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8.BENTFCC100SIR_CAP101SCC102SCC103SCC104SCC105SCC106SCC108SCC109SCC111SCC112SCC113SCC114SCC115SCCFCC_TCFADFADFIR_5/8.CAP.YLWWETLAND11.28 AC.WETLANDS01° 49' 00"E 1640.35'N88° 55' 12"E 2569.29'N01° 55' 23"W 307.78'S88° 04' 37"W5.00'N01° 55' 23"W 747.00'N88° 04' 37"E5.00'N01° 55' 23"W 258.85'S88° 54' 06"W 1248.03'N01° 54' 18"W 328.07'S88° 52' 50"W 1318.30'35' DRAINAGE EASEMENTSTORMWATERRETENTION & DRAINAGEEASEMENTDRAINAGEEASEMENT123456781415161312111718192021222324PLAINSMAN TERRACEDOC. R75-32760 REC. NOV. 26, 1975PLAINSMAN TERRACEDOC. R75-32760 REC. NOV. 26, 197520' DRAINAGE EASEMENT10' UTILITY EASEMENT10' P.U.E.UNSUBDIVIDED20' DRAINAGE EASEMENT N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9N. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE1/4 OF THE NW 1/4 OF SEC. 27-36-9E. LINE OF THE NW 1/4 OF SEC. 27-36-9 W. LINE OF THE NW 1/4 OF SEC. 27-36-9 UNSUBDIVIDEDUNSUBDIVIDEDUNSUBDIVIDEDIL RTE 59 UNSUBDIVIDEDEXCEPTION EXCEPTIONEXCEPTION N. LINE OF THE NW 1/4 OF SEC. 27-36-9P.O.B.EXCEPTION69.30'(N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)(S01° 55' 33"E)(S88° 04' 27"W)(S01° 55' 33"E)(258.88')70.99'N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')HERETOFORE CONVEYED TO IDOT PER DOC. R2011031724 1.20' N &0.18' E0.35' SAT CORNER0.18' W2.98' WAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNER0.13' W0.12' N0.06' EON LINE0.11' N0.30' S0.43' SONLINEONLINE0.10' N0.91' N &0.20' WHERETOFORE DEDICATED PER DOC. 463161AT CORNERAT CORNERAT CORNERAT CORNER14.28' NE14.75' SE18.78' ELYUNSUBDIVIDEDSHED X4.06' SSHED X3.91' SSHED X5.13' WFENCE X0.22' S0.16' WFENCE X0.17' WFENCE XONLINEFENCE X1.11' NFENCE X2.44' NWOODFENCECHAINLINK FENCECHAINLINK FENCEFENCE X0.63' SFENCE X0.37' SFENCE XONLINESHED X1.32' SFENCE X0.40' SSHED X3.95' SFENCE X3.07' SFENCE X3.81' SCHAINLINK FENCE20' UTILITY EASEMENT PER DOC. R2003-10559830' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYTEMPORARY CONSTRUCTIONEASEMENT PER DOC. R2011-317240.11' ESIGN X0.51' W21.93' SEINLET11.32' SLIMITS O F " Z O N E A " A S S C A L E D F R O M FIRM M A P PANEL N O . 1 7 1 9 7 C 0 1 3 0 G LIMITS OF 0.2% ANNUALCHANCE FLOOD HAZARDCHAINLINK FENCEWOODFENCEWOOD POSTSHEDSHEDSHEDSHEDSHEDSHEET 3MATCH LINESHEET 2SHEET 4SHEET 5SHEET 4 SHEET 3 SHEET 5 SHEET 2 SHEDSHEDSHEDSHEDCONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.GRAVELIL RTE 59 275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYAT CORNERDETENTION BASINONLY ONLY BLDG - 120,000 SFBLDG -316,900 SFBLDG - 227,000 SFTRASHHWL 595.3NWL 590.3LOT 1LOT 2LANDSCAPE BERM AREA: SEEGRADING PLAN FOR DETAILSPROPOSEDSIGNALIZEDINTERSECTION24' (TYP)18.5' (TYP)24'24'24' (TYP)18' (TYP)29'24' (TYP)18' (TYP)26.4'18.5'149.9'36'24' (TYP)30.4'9' (TYP)18' (TYP)24.1'18.5' (TYP)24' (TYP)18.5' (TYP)140.4'18' (TYP)27'18.5' (TYP)135.3'18' (TYP)32'25'18'25'29'39'18' (TYP)31'31'60'LANDSCAPEBUFFER 563.8'583.3'5'9' (TYP)24' (TYP)15114121214449261212484826243415231081756141534241614142028144211119617336234101010101830814241246461612522PROPOSED 6'CEDAR PLANKFENCE42PROPOSEDSECURITY GATE(TYP.)12' X 65'12' X 65'12' X 65'12' X 65'12' X 65'12' X 65'LOADING STALL(TYP.)CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDPARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*13 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (7,400 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (41,582 SF/5000)ADA STALLSTOTAL39258476REQUIRED392515483PROVIDEDBUILDING #1LOADING STALLSBICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)1122PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*21 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,462 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (23,301 SF/5000)ADA STALLSTOTAL6385480REQUIRED6327114105PROVIDEDBUILDING #2LOADING STALLS2222BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*23 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,360 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (32,952 SF/5000)ADA STALLS69874REQUIRED6922374PROVIDEDBUILDING #4TOTAL22LOADING STALLS22BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)88132PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*11 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (1,700 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (41,816 SF/5000)ADA STALLS3368249REQUIRED332014269PROVIDEDBUILDING #3LOADING STALLS11BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)22TOTALPARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*21 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,462 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (23,301 SF/5000)ADA STALLSTOTAL204472814293REQUIRED204947714389PROVIDEDOVERALL SITETOTAL VEHICLE STORAGE671LOADING STALLS6688BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)DRAWING NO.C1.0N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.0 Site220957.dwg1/25/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS OVERALL SITE PLAN HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALE129 FCCFCCFIPFCCFCCFIR 5/8 BENTFIR 5/8 YLW CAPFIR_CAP.2INFIR_CAP.2IN_IDOTFIR_5/8_CAP.YLWFIR_5/8_CAP.YLWFCCFIR_5/8602.52SBM_HYD.NW.TAGBOLT101SCC106SCC108SCC109SCCN01° 55' 23"W 307.78'S88° 04' 37"W5.00'69.30'(N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')1.20' N &0.18' EAT CORNERAT CORNER14.28' NE14.75' SE21.93' SEIL RTE 59 AT CORNERONLY ONLY BLDG - 120,000 SFBLDG -316,900 SFLOT 1NEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGCUSTOMERPARKINGUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYEMPLOYEEPARKINGEMPLOYEEPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYCUSTOMERPARKINGEV QUARANTINE AREA -16'-0" AROUND CARUSED VEHICLEDISPLAYSTUB FOR FUTURELOT 2 DEVELOPMENT29' 39'31'STUB FOR FUTURELOT 2 DEVELOPMENT30' BUILDING SETBACK5' PARKING SETBACK5' PARKING SETBACK15' BUILDING SETBACK30' BUILDING SETBACK20' PARKING SETBACK BACK OF CURB (TYP)18'18'24'18'24'18'18.5'30.4'11'9.5'9'18'24.1'18.5'18'24'18'18'24'18.5'140.4'18'27'18'24'18'18'24'18.5'135.3'18'32'18'24'18.5'18'25'18'18'24'18.5'18'25'18'BACK OF CURB (TYP)PROPOSEDSIGNALIZEDINTERSECTION5' (TYP.)583.3'PROPOSED SECURITYGATE (TYP.)NOTES:1. ALL DIMENSIONS SHOWN ARE TO BACK OF CURB UNLESSOTHERWISE NOTED.2. ALL PROPOSED ON-SITE STRIPING SHALL BE PAINTEDYELLOW UNLESS OTHERWISE NOTED.3. BUILDING DIMENSIONS ARE TO OUTSIDE FACE OFBUILDING UNLESS OTHERWISE NOTED.4. ALL CURB AND GUTTER SHALL BE B6.12 UNLESSOTHERWISE NOTED.CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDDRAWING NO.C1.1N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.1 Lay220957.dwg1/24/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS LAYOUT AND PAVING PLAN - NORTH HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALEFOR CONTINUATION SEE C1.2130 FIR 5/8FIR_5/8FIR_5/8 BENTFIP_1.5FIR_5/8FCC105SCC113SCC114SCC115SCCFADFADFIR_5/8.CAP.YLWN01° 55' 23"W 747.00'N88° 04' 37"E5.00'N01° 55' 23"W 258.85'S88° 54' 06"W 1248.03'2021IL RTE 59 (S01° 55' 33"E)(S88° 04' 27"W)(S01° 55' 33"E)(258.88')70.99'N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')0.43' SONLINEONLINE0.10' N0.91' N &0.20' WAT CORNERAT CORNER18.78' ELYSHEET 3SHEET 2ONLY ONLY BLDG - 227,000 SFTRASHLOT 1CUSTOMERPARKINGCUSTOMERPARKINGNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYSERVICE VEHICLESTAGINGNEW VEHICLEDISPLAYEMPLYEEPARKINGNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGCUSTOMERPARKINGCUSTOMERPARKINGVEHICLEDISPLAYVEHICLEDISPLAYEV QUARANTINE AREA -16'-0" AROUND CAREMPLOYEEPARKINGEMPLOYEEPARKINGUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYSERVICE CUSTOMER PARKINGNEW VEHICLEDISPLAYEMPLOYEEPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYSTUB FOR FUTURELOT 2 DEVELOPMENT29' 39'18'24'18.5'18'24'18.5'18' 18'24'18.5'24'18' 18' 29'18'24'18'18'26.4'18.5'9'31'60'LANDSCAPEBUFFER 149.9'PROPOSED LIFT STATIONTO BE DESIGNED AND SUBMITTEDIN FINAL ENGINEERING20' BUILDING SETBACK30' BUILDINGSETBACK5' PARKING SETBACK30' BUILDING SETBACK20' PARKING SETBACK 36'BACK OF CURB (TYP)LANDSCAPE BERM AREA: SEEGRADING PLAN FOR DETAILSPROPOSEDSIGNALIZEDINTERSECTION5' (TYP.)563.8'PROPOSED 6' CEDARPLANK FENCEPROPOSED SECURITYGATE (TYP.)NOTES:1. ALL DIMENSIONS SHOWN ARE TO BACK OF CURB UNLESSOTHERWISE NOTED.2. ALL PROPOSED ON-SITE STRIPING SHALL BE PAINTEDYELLOW UNLESS OTHERWISE NOTED.3. BUILDING DIMENSIONS ARE TO OUTSIDE FACE OFBUILDING UNLESS OTHERWISE NOTED.4. ALL CURB AND GUTTER SHALL BE B6.12 UNLESSOTHERWISE NOTED.CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDDRAWING NO.C1.2N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.1 Lay220957.dwg1/24/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS LAYOUT AND PAVING PLAN - SOUTH HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALEFOR CONTINUATION SEE C1.1131 EXL-6 EXL-6EXL-6EXL-6EXL-6EXL-6EXL-6EXL-6 EXL- 6EXL-6EXL-6EXL-4 EXL-4 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5 EXL- 5 EV QUARANTINE AREA -16'-0" AROUND CAR ID HUB1A0.50a23TYP3TYP3TYP#TYP2 2 KEYED NOTES1.FUTURE ELECTRICAL VEHICLE CHARGING STATION. 2" UNDERGROUND CONDUIT.CONDUIT SIZES MAY NEED TO BE ADJUSTED FOR LONG RUNS TO ACCOMMODATEVOLTAGE DROP. CONDUIT SIZE TO ADHERE TO ELECTRICAL CODES AND CHARGINGSTATION EQUIPMENT REQUIREMENTS. SEE ELEC. PANEL SCHEDULE FOR LOAD CAPACITY.2.CONDUIT TO BE INSTALLED FROM EV STATION TO ELECTRICAL DISTRIBUTION SOURCEFOR FUTURE UNIT PLANCEMENT.3.6" HIGH CONCRETE CURB.4.PROPERTY LINE.5.PROVIDE RAMPED SIDEWALK FOR ACCESSIBLE ENTRY6.LANDSCAPED AREA7.PYLON SIGN OR DIRECTIONAL SIGN, ACTUAL LOCATIONS TO BE COORDINATED WITHSIGN SUPPLIER. SIGN REVIEW SHALL BE UNDER SEPARATE PERMIT, SHOWN FORREFERENCE ONLY.8.TRASH ENCLOSURE9.UTILITY TRANSFORMER10.REFER TO SITE DETAILS ON SHEET A0.51. PROVIDE ALL EXTERIOR PAVING/ MATERIAL/FINISHES IN FRONT OF DEALERSHIP AND CUSTOMER PARKING AS INDICATED ONENLARGED PAVING PLAN. PROVIDE EV CHARGERS IN CUSTOMER PARKING AREA AND NEWCAR DISPLAY AREA LOCATIONS.11.EV QUARANTINE ZONE OF 16'-0" CLEAR AROUND DESIGNATED AFFECTED EV CAR INPARKING LOT.LEGENDNOTE DESIGNATOR - REFER TO DRAWING NOTES ON THIS SHEETPARKING LOT POLESELECTRIC VEHICLE CHARGINGEVXEXISTING STREET LIGHTDARK PAVERS (PV-2)STAMPED CONCRETE OR ASPHALT (SEE FINISH MATERIALS SCHEDULE) (PV-1)CONCRETE (UNFINISHED UNLESS OTHERWISE NOTED)FIELD TURF (FT-1) OR KENTUCKY BLUEGRASSCRUSHED GRAVEL (CG)XDECORATIVE STONE (ST-1) ALT: UNILOCK PAVER 4x12, 4x8 OR 6x12 INNORDIC STAYA.ACCOMMODATE DC FAST CHARGING AND NETWORK CONNECTIVITY WITH CAT6. RUN CONDUIT FROM ALL EV STATION LOCATIONS TO ELECTRICALDISTRIBUTION SOURCE. FINAL EV LOCATIONS TO BE COORDINATED BY GC.B.ALL SIGNAGE IS SHOWN FOR DESIGN INTENT ONLY. PLAN REVIEW SHALL BEUNDER A SEPARATE PERMIT, SUBMITTED BY THE SIGN FABRICATOR. GC TOCOORDINATE.C.SEE SHEET AX.XX FOR SITE LIGHTING DESIGN CRITERIA.D.SEE SHEET AX.XX FOR BUILDING GRAPHICS LOCATIONS.E.SITE SIZE = 0.XX ACRESF.INDICATES GREEN SPACE/LOW LANDSCAPING. SEE SHEET AX.XXFOR PROTOTYPE LANDSCAPE PLANGENERAL NOTESSCALE:SITE PLAN1" = 30'-0"1©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager132 LEGENDNOTE DESIGNATOR - REFER TO DRAWING NOTES ON THIS SHEETPARKING LOT POLESELECTRIC VEHICLE CHARGINGEVXEXISTING STREET LIGHTDARK PAVERS (PV-2)STAMPED CONCRETE OR ASPHALT (SEE FINISH MATERIALS SCHEDULE) (PV-1)CONCRETE (UNFINISHED UNLESS OTHERWISE NOTED)FIELD TURF (FT-1) OR KENTUCKY BLUEGRASSCRUSHED GRAVEL (CG)DECORATIVE STONE (ST-1) ALT: UNILOCK PAVER 4x12, 4x8 OR 6x12 INNORDIC STAYCUSTOMERPARKING2A0.50aTYP.WC-13TAGCGCGWC-13CGWC-13PV-1TAGWC-13ST-1WC-13PV-1PV-1WC-13ST-1WC-13ST-1ST-1NOTE: TEXT IS TO BE CENTERED INBOTTOM THIRD OF PARKING SPACEKEYED NOTES1.REFER TO EXTERIOR FINISH SCHEDULE FOR EXTERIORMATERIALS INFORMATION.2.PROVIDE AND SIZE CONDUIT TO EV CHARGER STATIONSAS FOLLOWS:a.ACCOMMODATE DC FAST CHARGING AND NETWORKCONNECTIVITY WITH CAT 6. RUN CONDUIT FROM ALLEV STATION LOCATIONS TO ELECTRICALDISTRIBUTION SOURCE.b.CONDUIT SIZES MAY NEED TO BE ADJUSTED FORLONG RUNS TO ACCOMMODATE VOLTAGE DROP.c.CONDUIT SIZE TO ADHERE TO ELECTRICAL CODESAND CHARGING STATION EQUIPMENT REQUIREMENTS.d.CONDUIT TO BE INSTALLED FROM EV STATION TOELECTRICAL DISTRIBUTION SOURCE FOR FUTURE UNITPLACEMENT.3.WC-1 TO BE WHITE CONCRETE SUPPLEMENTALCEMENTITIOUS CONCRETE MATERIAL OF LIMESTONE OREQUAL TYPE. FINAL MOCK-UP OF WHITE CONCRETE TOBE APPROVED BY ARCHITECT.XSCALE:CUSTOMER PARKING DETAIL1/8" = 1'-0"1SCALE:ENLARGED STALL DETAIL1/2" = 1'-0"2©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager133 ALIGNMENTEXPRESSEXPRESSEXPRESSEXPRESSEXPRESSEXPRESS#KEYED NOTESDRAWING NOTESSCALE:FLOOR PLAN1/8"14'X4' 67"DIA67"DIA 4'X4' 67"DIA 67"DIA 4TYP.4TYP.4TYP.4TYP.13TYP.255SCALE:FLOOR PLAN - MEZZANINE1/8"2©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGN134 Service XpressService Xpress16761Hawk PlainfieldServiceService XpressDRAWING NOTES#GENERAL NOTESLEGENDX-?EG-?#SCALE:EXT ELEVATION - FRONT1/8"1SCALE:EXT ELEVATION - LEFT3/32"2SCALE:EXT ELEVATION - RIGHT1/8"3SCALE:EXT ELEVATION - BACK1/8"4©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGN135 SCALE:EXT ELEVATION - FRONT1/8"1©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager136 ©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager137 SERVICE LANESSHOWROOMGUEST LOUNGESALESNEW CAR DELIVERYSERVICE RECEPTIONBUILDING SUPPORTPARTS + SERVICESCALE:FLOOR PLAN1/8"1©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner138 LEVEL 010' - 0"ACM1ACM FACADEWITH BONELINECADILLAC SIGNAGEACM2ACM FACADEEXGL1CLEAR SHOWROOM GLASSACM2DISPLAY FRAMEEPT1EXTERIOR PAINTACM1ACM FACADEEXGL2EXTERIOR GLAZING8'-0"2'-0"LEVEL 010' - 0"CADILLAC SIGNAGEACM2DISPLAY FRAMEACM2ACM FACADEACM2ACM FACADEACM1ACM FACADEWITH BONELINEEXGL1CLEAR SHOWROOM GLASSACM1ACM FACADEACM1ACM FACADE12'-0"FULL HEIGHT GLASSDOOR - COILING ORSECTIONALCADILLAC SERVICESIGNAGELEVEL 010' - 0"EPT1EXTERIOR PAINTLEVEL 010' - 0"EXGL1EPT1EXTERIOR PAINTACM1ACM FACADECLEAR SHOWROOM GLASSACM2ACM FACADESCALE:EXT ELEVATION - FRONT1/8"1SCALE:EXT ELEVATION - LEFT3/32"2SCALE:EXT ELEVATION - RIGHT1/8"3SCALE:EXT ELEVATION - BACK1/8"4©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner139 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan WagnerSCALE:EXT RENDERING-1140 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner141 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner142 143 1.01.62.85.510.814.324.025.324.018.713.58.66.96.77.17.68.28.89.09.29.29.29.08.78.58.58.78.88.88.88.68.58.58.88.98.98.98.78.58.58.78.98.98.98.78.48.07.36.76.15.13.82.60.90.40.20.11.01.62.95.17.39.223.024.224.920.215.111.79.57.97.57.77.87.77.98.59.09.39.18.97.97.47.58.28.68.68.67.87.47.58.28.78.78.78.07.57.47.88.68.68.78.27.46.86.56.66.35.84.53.30.90.40.20.10.81.42.12.83.85.119.423.421.917.512.39.58.58.18.08.18.38.17.28.58.98.98.68.37.67.07.17.77.97.97.97.57.07.17.78.08.08.07.77.17.07.68.08.08.07.77.06.46.36.26.25.84.93.80.90.40.20.10.60.81.01.31.93.720.816.811.38.67.97.87.98.08.15.65.55.75.75.33.50.90.50.30.20.30.40.50.71.21.820.616.611.48.98.17.87.87.87.84.84.75.25.55.53.51.00.50.30.20.20.20.30.50.81.820.116.211.79.28.58.17.97.87.77.36.86.46.25.95.44.84.34.04.04.24.44.44.54.44.34.44.75.05.05.15.15.05.15.25.45.45.35.04.64.34.14.24.85.15.03.61.00.60.30.20.10.10.20.30.61.919.57.36.96.55.95.55.14.63.93.43.33.33.53.73.83.83.83.94.04.34.64.84.94.84.85.05.15.45.55.34.94.54.24.04.24.74.84.43.81.00.60.30.20.10.10.10.20.71.818.06.96.56.25.54.74.23.63.12.72.52.62.83.13.33.43.53.63.94.24.54.74.84.84.94.95.35.55.75.45.04.64.44.24.34.74.74.03.31.00.60.30.20.10.10.20.61.717.86.35.95.85.04.23.52.92.21.82.12.12.22.52.83.23.53.84.14.34.64.85.05.15.25.45.46.06.15.95.45.04.74.54.64.74.13.52.71.00.60.30.20.10.10.10.20.51.618.95.95.85.31.61.92.12.53.03.74.34.64.74.74.95.35.65.75.75.65.96.46.35.95.45.24.94.94.94.33.62.70.90.50.20.10.10.10.10.30.51.519.35.45.14.71.31.51.82.33.03.94.64.94.94.74.85.25.65.75.75.65.45.26.36.25.96.05.75.55.35.04.23.30.90.40.20.10.10.10.20.30.62.019.64.44.13.91.11.31.62.12.73.64.44.74.64.44.75.25.75.85.75.75.55.24.65.56.36.76.56.16.05.54.73.80.80.40.20.10.10.10.20.40.62.019.33.43.23.05.86.36.56.55.95.43.50.70.30.10.10.10.10.20.40.61.418.62.25.95.96.26.56.15.73.40.70.30.10.10.10.10.10.40.61.618.01.76.56.66.46.45.85.13.40.70.30.10.10.10.10.20.30.71.716.81.46.36.46.36.15.54.53.60.70.30.10.10.10.10.20.61.717.11.66.06.26.15.85.03.92.90.70.30.20.10.10.10.20.41.518.82.16.06.26.15.54.23.22.30.70.40.20.10.10.20.41.319.72.75.85.95.85.14.03.02.20.60.40.20.10.10.10.41.820.43.65.05.15.14.74.23.32.60.60.40.20.20.10.10.31.820.44.63.74.14.24.34.03.53.10.50.40.30.20.10.10.31.316.220.719.65.53.13.33.64.14.14.12.80.60.40.30.20.10.20.41.415.917.218.26.26.05.74.63.73.22.62.01.61.51.61.71.92.22.82.92.52.42.42.42.53.03.02.62.52.62.93.44.14.43.74.54.24.34.84.84.93.10.80.50.30.20.10.10.20.51.612.113.115.26.86.46.05.14.23.63.02.42.12.12.22.52.83.13.53.63.43.13.13.13.33.63.63.43.33.53.84.45.05.14.54.94.74.75.15.14.83.51.00.60.30.20.10.10.20.61.610.010.512.57.37.06.25.34.53.83.22.72.52.62.93.33.63.94.14.14.03.73.63.63.83.93.93.94.04.24.65.15.55.55.15.35.15.15.35.14.53.91.10.60.30.10.10.20.30.61.515.57.57.16.25.34.54.03.42.92.72.93.54.04.44.64.74.64.44.13.93.94.04.14.34.44.54.75.15.55.75.75.45.55.45.45.55.14.23.51.20.60.30.10.10.10.20.30.51.417.37.37.06.25.34.54.03.53.13.03.44.04.85.25.35.15.04.84.34.03.94.04.24.34.75.05.25.35.55.55.55.35.65.65.75.64.73.93.01.20.60.30.10.10.10.20.30.51.418.46.76.96.25.54.64.03.63.33.44.04.75.45.46.05.85.55.04.54.14.04.04.34.64.94.95.35.55.55.45.45.45.55.35.95.85.14.13.11.20.60.20.10.10.20.30.52.019.55.66.46.15.44.74.23.93.83.94.65.45.85.86.66.25.54.84.64.34.14.14.54.85.04.55.15.65.65.45.55.55.54.45.76.15.84.73.81.30.60.20.10.10.10.30.51.819.85.36.05.65.14.54.34.24.24.55.26.06.46.37.06.65.85.04.64.34.14.14.44.84.94.25.05.35.35.25.35.35.34.35.56.05.85.14.31.20.60.30.10.10.10.20.41.420.05.35.55.04.64.44.34.44.75.15.66.26.96.76.96.45.85.14.54.14.14.24.44.64.84.74.94.95.04.94.94.95.04.65.35.75.85.53.91.20.60.30.10.10.20.51.720.95.34.84.44.24.24.44.85.25.55.96.46.86.96.76.05.55.04.64.24.24.34.44.54.74.74.74.74.74.84.74.64.64.64.75.25.45.63.71.20.60.30.10.10.10.61.721.94.54.03.83.84.14.65.15.76.06.36.56.66.66.25.85.24.94.64.54.54.54.64.84.74.64.64.84.94.84.74.54.14.04.04.64.84.83.71.10.60.20.10.10.10.41.721.34.03.53.33.54.04.65.35.95.96.46.56.56.35.95.55.04.84.64.54.64.74.84.94.84.84.84.94.94.94.64.23.83.53.53.94.13.93.50.90.60.30.10.10.10.41.521.13.22.82.73.03.64.45.25.44.86.06.16.05.75.44.84.44.34.24.14.24.54.54.84.74.74.74.84.74.64.23.73.32.92.83.13.22.92.60.70.50.30.20.10.20.42.021.217.211.57.76.34.84.03.12.52.12.12.53.13.94.75.24.35.45.45.25.14.84.23.83.83.73.53.84.14.14.54.54.74.94.94.74.23.73.22.72.22.22.42.11.91.70.50.40.20.10.10.20.42.020.816.610.87.45.54.13.22.62.11.81.82.12.63.33.94.44.34.84.74.34.54.23.43.03.33.12.62.82.82.94.34.64.95.14.84.74.03.42.82.31.81.82.01.91.71.50.30.30.20.10.10.20.41.520.115.910.46.64.63.42.72.21.91.61.61.92.22.63.03.43.63.63.53.84.54.95.14.24.64.13.42.72.11.71.72.02.32.12.00.20.20.10.10.10.20.51.620.016.210.36.04.02.92.32.01.71.51.61.82.02.22.42.62.72.72.74.14.85.25.23.84.64.13.42.62.11.61.62.12.52.52.40.10.10.10.10.10.10.20.61.520.516.89.75.33.42.41.91.61.51.41.51.61.81.92.02.02.02.02.04.04.54.95.04.44.43.93.22.51.91.51.62.22.83.22.10.10.10.10.10.10.10.20.41.319.315.59.24.93.02.01.61.41.41.41.51.21.31.31.33.53.94.34.64.54.03.42.82.31.91.51.62.32.93.52.10.10.10.10.10.10.20.20.918.514.18.64.73.02.01.61.51.51.51.23.23.53.83.93.83.42.92.52.11.81.51.52.22.73.02.20.10.10.10.10.10.20.21.318.614.18.24.83.22.42.01.92.01.81.93.03.33.43.33.22.82.52.21.91.71.51.62.12.42.42.30.10.10.10.10.10.10.11.418.814.28.24.93.52.82.52.42.42.42.53.03.03.02.82.52.22.01.81.61.41.31.62.02.21.91.80.10.10.10.10.10.10.10.818.313.88.45.13.73.02.93.03.23.33.32.82.82.62.32.01.71.51.31.31.21.31.61.91.71.61.30.20.20.10.10.10.10.818.214.39.05.33.93.43.43.74.04.24.32.52.32.22.01.81.61.41.21.21.21.41.82.22.11.91.60.30.20.10.10.10.10.31.019.115.69.05.24.03.73.94.24.64.85.01.81.91.92.01.81.81.61.51.51.61.82.22.83.12.82.40.40.20.10.10.10.10.21.018.715.19.05.34.13.94.24.04.14.35.11.51.61.82.02.12.12.02.02.02.22.32.73.43.83.63.10.50.20.10.10.10.10.20.818.013.88.75.24.03.74.14.34.44.75.11.51.61.82.02.22.32.42.42.52.72.83.23.94.34.43.00.50.20.10.10.10.10.20.31.218.013.68.05.03.93.53.74.04.34.34.01.61.71.82.12.32.52.62.93.23.43.53.74.34.74.82.90.50.20.10.20.20.30.30.51.818.413.87.94.93.93.33.33.63.73.63.22.70.10.11.91.81.92.12.32.63.03.43.84.04.14.14.54.64.33.00.50.20.10.30.50.60.70.91.817.913.38.05.34.03.43.23.13.12.92.62.21.90.21.91.81.82.02.32.73.33.84.14.24.34.54.64.33.73.10.40.20.10.50.81.21.51.82.717.913.59.06.24.73.93.42.92.72.42.11.91.81.61.41.51.61.92.32.83.43.83.93.83.94.44.54.13.22.30.40.20.10.71.11.82.94.25.618.915.511.38.46.65.03.62.82.42.12.02.02.02.11.61.91.91.51.51.51.62.12.11.81.61.51.62.02.01.61.91.81.92.22.52.93.43.94.24.44.44.34.03.22.41.70.50.20.10.71.11.93.56.810.016.518.020.119.415.712.49.05.53.52.62.11.91.81.81.92.12.32.22.11.91.81.82.02.32.42.21.91.81.92.22.21.92.12.02.12.42.73.13.43.74.04.24.13.83.32.72.11.40.50.20.10.81.21.83.26.612.717.920.221.921.418.715.39.25.13.52.92.52.22.02.12.22.32.52.72.52.42.42.42.52.72.72.62.52.42.42.52.52.32.52.52.62.93.33.53.63.84.04.13.93.63.02.51.91.20.50.20.10.81.32.03.35.511.016.922.326.123.819.014.58.75.74.33.53.12.82.72.82.92.93.02.92.82.83.03.13.43.43.33.22.92.72.93.03.13.13.33.23.23.53.83.94.14.34.34.23.93.52.82.21.71.20.60.30.10.10.50.91.62.85.210.616.015.616.216.818.414.58.95.84.13.22.82.93.03.33.43.23.02.72.22.73.13.43.83.83.53.22.82.32.63.13.33.63.83.53.43.33.53.94.14.44.44.13.63.02.21.81.41.00.60.30.10.10.10.20.20.20.41.01.72.43.03.23.73.73.12.52.02.02.53.03.73.83.22.72.21.92.22.83.34.04.03.42.92.31.92.22.73.23.84.03.53.12.82.83.33.84.34.33.62.92.21.61.31.00.80.50.30.10.10.10.20.30.60.91.52.32.72.42.42.62.31.71.72.22.62.32.42.62.41.81.41.72.42.92.62.62.82.51.91.51.72.42.82.52.52.92.72.22.22.73.02.62.52.72.31.61.00.80.60.50.30.20.10.10.10.20.30.30.30.30.30.20.20.10.10.10.20.20.20.20.20.20.30.30.30.30.40.40.40.40.40.30.30.30.30.30.30.40.40.40.40.40.40.30.30.20.20.20.20.20.20.20.20.20.10.10.10.10.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.117.226.08.18.18.08.07.97.67.16.66.46.36.46.76.76.66.56.46.46.66.86.96.86.76.66.66.76.86.96.96.66.36.016.725.77.77.57.27.06.86.45.85.45.25.25.35.45.45.45.45.45.55.75.85.85.75.75.75.85.95.95.85.75.417.021.417.018.313.914.913.814.716.818.016.721.016.125.016.024.816.420.516.517.413.514.213.614.316.717.916.521.016.025.215.925.212.813.616.117.015.720.915.925.316.324.617.720.817.818.816.717.818.319.517.722.316.9 16.926.117.521.918.018.916.217.017.117.817.019.715.723.715.624.815.921.017.117.815.616.016.216.616.918.515.422.315.224.515.321.316.917.816.317.116.312.38.88.48.38.27.917.012.48.68.28.28.17.816.612.08.87.97.57.47.215.411.48.57.26.66.46.315.110.27.56.35.65.35.415.39.46.65.44.74.54.514.88.95.84.63.93.73.514.08.75.54.03.22.92.72.62.413.99.25.63.82.92.52.32.11.815.19.65.84.13.22.72.32.015.510.26.54.83.93.22.72.41.915.110.97.65.94.84.03.53.12.515.711.08.16.95.85.04.43.93.216.610.98.07.16.55.85.24.74.116.611.38.17.37.06.35.95.55.015.711.18.47.87.26.96.55.85.614.711.18.97.97.27.17.014.010.78.37.47.27.37.413.410.27.67.07.07.27.413.29.77.46.66.56.87.313.39.37.16.36.16.57.114.09.16.86.26.26.56.915.29.67.06.36.36.66.715.710.37.66.56.36.46.416.211.38.16.86.26.16.117.712.38.87.26.35.85.612.88.67.56.45.75.118.213.08.57.26.45.44.617.312.38.06.85.84.83.90.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.05.15.11.627.026.219.10.10.10.10.20.53.117.719.121.117.411.67.25.34.94.23.42.92.62.52.52.62.72.82.92.92.82.72.72.72.72.72.72.82.83.14.05.16.17.08.08.99.610.110.310.110.09.89.38.47.77.26.45.23.91.20.50.20.10.10.10.10.30.42.818.121.120.716.211.37.86.14.94.03.32.92.62.62.62.72.82.93.13.12.92.82.82.72.72.72.72.82.93.24.15.26.27.17.98.99.810.410.410.110.010.09.58.77.97.05.94.73.41.20.50.20.10.10.10.10.30.52.618.125.220.715.910.77.66.04.84.03.53.12.92.92.93.03.23.43.63.63.43.22.92.92.82.72.82.93.23.84.65.76.57.17.98.79.410.010.210.09.99.89.38.57.87.15.94.83.51.20.50.20.10.10.10.20.40.62.818.426.720.816.110.57.56.05.04.44.03.73.53.43.53.73.94.34.64.54.33.93.63.33.13.13.33.53.94.75.66.57.17.37.98.27.98.19.59.79.79.27.97.17.37.26.55.34.01.20.50.20.10.10.10.20.40.73.018.523.320.916.010.87.76.45.55.14.84.64.44.24.34.54.95.15.45.45.14.84.44.03.73.84.04.45.05.76.57.17.47.57.67.87.98.28.68.78.78.47.87.16.86.86.35.54.41.20.50.20.10.10.10.20.40.83.818.920.321.216.711.58.16.75.95.65.55.35.15.05.15.35.65.75.55.65.55.65.14.84.54.64.95.36.06.16.77.07.37.36.97.07.27.37.37.27.27.16.96.35.96.06.05.73.91.10.50.20.10.10.10.20.41.03.817.819.022.217.911.68.27.16.46.06.06.05.95.75.65.76.06.15.96.06.16.15.75.55.55.65.86.16.56.97.17.27.57.06.66.56.46.46.26.06.06.05.75.35.05.35.45.63.61.00.50.20.10.10.10.20.40.93.818.219.621.917.812.18.97.77.06.76.76.86.66.36.06.06.16.26.46.56.56.56.46.36.36.36.76.76.97.17.57.67.36.86.46.15.95.85.65.45.35.14.84.34.14.54.74.73.50.90.40.20.10.10.20.40.73.619.021.421.717.512.79.58.67.97.87.67.36.76.56.46.05.96.16.26.56.66.76.97.17.26.97.27.27.17.17.37.37.16.76.46.15.95.65.25.14.84.54.13.63.53.84.03.73.30.70.40.20.10.10.10.30.73.119.025.622.217.913.110.19.18.98.78.27.76.86.66.45.85.65.65.85.86.06.87.17.57.77.27.47.67.37.06.96.86.76.46.16.05.85.34.84.44.13.73.22.82.73.13.22.82.40.60.40.20.10.10.10.30.63.219.322.518.613.510.69.59.38.98.47.96.66.66.05.45.15.25.45.45.76.17.17.47.87.47.77.47.06.56.46.26.36.06.06.05.85.34.63.93.42.92.42.12.12.32.11.91.60.40.30.20.10.10.30.63.119.025.222.518.313.911.110.29.38.68.07.66.75.74.74.03.65.96.76.97.06.66.05.85.85.65.75.65.85.95.85.34.53.73.02.41.91.51.72.01.91.71.50.30.20.20.10.10.20.63.619.321.722.718.814.511.410.49.28.27.56.85.94.84.03.53.15.76.26.56.45.85.25.25.45.35.45.55.86.05.65.14.63.82.92.31.71.41.52.02.32.11.90.20.10.10.10.10.10.20.83.918.420.123.420.014.310.79.58.87.96.96.05.14.13.93.54.14.95.25.34.54.14.33.82.92.21.61.21.42.02.52.52.50.10.10.10.10.10.10.20.83.918.219.923.319.613.89.68.28.07.06.05.14.23.24.04.54.95.25.14.74.23.62.82.11.51.21.42.22.83.22.20.10.10.10.10.10.10.30.63.518.920.921.717.612.79.07.66.55.64.73.93.12.43.54.04.34.64.74.33.83.12.52.01.51.21.42.32.93.52.20.20.10.10.10.10.10.20.30.62.918.323.820.816.011.07.86.25.04.13.52.92.31.83.23.53.84.04.03.73.32.72.32.01.61.31.52.22.83.12.30.20.10.10.10.10.10.20.40.62.918.426.620.315.69.86.64.93.93.22.72.31.81.53.23.43.53.53.53.22.82.52.22.01.71.51.72.22.62.62.50.20.20.10.10.10.10.20.40.72.718.024.220.014.89.25.84.13.12.62.32.01.61.33.13.43.33.33.23.02.72.52.42.21.91.82.02.42.62.32.00.30.30.20.10.10.10.20.40.73.218.220.319.814.89.35.53.72.82.32.11.91.51.33.43.63.33.33.23.12.92.82.82.62.42.42.52.72.42.11.70.50.30.20.10.10.20.40.83.517.618.520.315.89.35.43.62.72.32.11.91.51.23.73.73.43.43.43.43.43.53.43.23.13.03.13.33.02.62.10.60.40.20.10.10.10.20.30.83.416.917.920.916.39.55.53.93.02.52.21.91.51.23.23.43.53.73.84.04.14.14.03.93.83.63.63.93.93.52.90.70.40.20.10.10.10.10.30.53.318.019.019.815.39.96.14.43.42.92.62.32.01.81.92.33.13.74.14.65.35.85.75.55.35.14.84.03.43.13.23.33.94.04.24.44.74.94.94.74.74.74.64.34.24.44.54.23.60.80.40.20.10.10.10.10.20.42.417.421.819.614.89.86.65.14.03.32.92.52.11.91.92.33.03.74.35.05.76.26.16.15.85.54.94.13.43.13.13.33.94.24.65.05.45.75.85.65.65.55.35.04.75.05.25.13.50.90.40.20.10.10.10.20.32.217.225.119.615.19.86.85.74.74.03.32.82.42.22.22.63.34.14.75.56.46.86.46.66.66.15.34.63.83.43.43.64.34.75.35.86.16.66.86.86.66.46.05.65.45.85.85.73.61.00.40.20.10.10.10.32.116.623.719.314.89.76.75.85.44.73.93.43.02.72.73.13.84.65.26.06.77.26.47.27.36.65.75.04.33.83.84.24.95.46.06.15.96.47.87.97.77.05.75.25.96.36.05.53.91.00.40.20.10.10.10.32.315.718.818.413.99.56.86.05.75.24.54.03.53.33.33.74.45.15.66.26.87.37.37.47.56.96.05.44.74.34.44.95.55.96.57.07.58.18.78.68.48.07.36.66.56.55.95.14.11.10.50.20.10.10.10.42.513.715.116.312.48.86.66.35.85.34.84.44.13.93.94.45.05.66.16.46.87.47.87.97.67.06.45.75.25.05.15.56.06.46.77.38.18.79.09.08.78.37.87.16.56.35.84.63.51.10.50.20.10.10.10.41.98.89.811.910.37.66.15.75.55.35.05.04.94.84.95.35.86.36.76.97.27.57.87.97.57.46.96.56.05.85.96.26.76.97.27.88.49.09.29.19.08.78.17.36.65.95.14.12.91.20.60.20.10.10.10.10.20.41.65.66.17.07.56.35.25.15.25.35.55.65.85.76.06.36.97.37.57.67.77.98.18.38.27.97.67.37.06.87.07.37.67.77.98.28.89.39.79.79.49.18.47.56.65.84.94.02.71.30.60.30.10.10.10.20.51.54.24.95.05.35.34.64.54.95.46.06.46.66.57.27.68.08.38.48.28.18.28.58.88.78.68.37.97.77.98.28.48.68.68.48.69.39.910.110.39.99.38.77.86.96.05.03.92.61.30.60.30.10.40.61.01.83.56.49.39.99.610.09.26.85.45.45.86.56.86.66.87.68.48.99.09.08.16.97.78.69.19.19.18.27.17.48.39.19.19.38.87.87.58.910.010.210.39.78.57.57.47.06.05.03.92.51.20.60.30.11.01.72.84.88.913.719.121.821.619.316.311.27.66.66.46.87.47.78.18.49.19.19.19.18.78.38.48.99.08.99.18.78.48.59.09.29.19.39.08.68.79.29.69.69.79.58.88.27.66.85.74.73.72.31.10.50.30.11.11.72.74.69.714.422.226.326.522.717.611.77.46.56.56.87.48.18.79.09.19.29.29.08.88.78.68.78.98.98.88.88.78.78.89.19.19.08.98.88.89.09.19.29.29.08.78.37.56.65.84.73.62.30.90.50.20.10.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.028.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.30.30.30.40.40.50.50.50.50.50.50.40.60.60.50.50.50.50.50.50.50.50.50.50.50.50.50.50.40.50.50.40.40.40.40.40.30.30.30.30.30.20.20.10.10.10.10.20.20.30.30.30.30.40.40.50.60.60.70.80.90.90.91.01.01.00.80.90.90.90.90.80.80.70.70.70.70.70.80.80.90.90.91.01.01.11.11.01.01.00.90.80.70.60.60.50.40.30.20.10.10.10.10.20.30.40.50.60.60.70.80.80.91.01.11.31.51.11.71.61.61.61.61.51.51.51.41.31.21.11.11.11.01.01.01.11.31.51.61.61.71.81.91.92.02.01.91.71.51.31.11.10.90.70.50.30.20.10.10.10.20.30.50.91.52.43.33.33.43.64.13.93.94.44.54.54.54.74.54.34.64.64.24.14.34.13.73.73.93.53.53.63.83.63.94.74.54.54.75.35.35.45.65.14.94.84.23.12.31.91.51.10.70.40.20.10.10.10.30.50.61.22.03.14.04.95.55.55.04.84.75.25.96.56.35.65.15.05.25.56.06.05.34.74.24.34.65.15.34.74.34.24.55.46.06.66.46.16.36.46.77.27.06.15.03.92.92.31.91.40.80.40.20.10.71.01.93.13.53.64.96.57.57.26.76.46.16.06.05.96.36.56.35.95.86.05.95.85.85.75.45.04.94.84.74.94.84.64.64.95.15.76.06.46.66.97.77.67.27.37.26.65.94.83.52.72.21.60.80.30.20.12.44.17.712.414.817.119.118.917.714.310.68.87.67.06.76.36.35.86.05.96.06.25.65.65.55.45.14.84.74.54.54.44.14.04.34.84.95.55.86.36.67.27.97.87.57.37.26.76.15.34.33.32.51.80.70.30.10.12.43.98.013.216.922.225.122.018.715.110.78.67.76.96.36.05.75.25.25.35.55.44.75.14.74.64.44.03.63.63.73.53.03.03.63.94.04.95.25.86.36.67.07.37.27.06.86.35.75.34.94.03.02.20.70.30.10.12.34.59.513.515.517.220.520.620.018.012.58.67.36.76.15.65.34.84.74.84.94.74.44.33.93.94.55.25.25.05.46.46.86.76.15.14.54.85.24.83.83.00.70.30.12.54.67.08.610.011.817.317.418.417.413.28.87.36.86.15.45.14.84.54.44.54.54.44.04.44.95.35.55.76.26.26.26.05.65.25.15.24.94.33.50.70.30.12.02.83.64.55.36.716.918.019.816.211.98.97.76.86.05.35.04.64.22.93.94.24.54.95.25.65.75.65.55.55.34.94.74.95.04.93.20.70.30.11.01.31.72.32.74.117.919.820.415.711.28.67.66.65.85.34.83.92.82.43.63.94.14.54.85.05.15.04.95.04.74.44.34.64.85.13.20.70.30.10.50.60.91.31.83.317.523.921.016.211.08.47.26.45.65.14.23.42.63.63.84.14.24.44.64.64.64.64.44.23.83.74.14.44.53.20.70.30.10.10.20.40.60.91.33.417.927.421.417.111.38.37.06.15.44.64.03.22.33.74.04.14.24.44.44.34.44.23.93.63.33.23.63.83.63.20.60.30.20.10.10.20.40.71.23.018.225.521.617.211.88.87.26.05.14.53.82.82.03.94.14.24.24.34.24.03.83.63.32.92.62.62.93.02.72.40.50.30.20.10.10.20.30.61.02.919.221.822.017.912.88.97.66.35.44.63.82.82.04.04.14.24.34.24.03.73.33.02.72.21.92.02.22.01.81.60.40.30.10.10.10.10.30.51.13.318.820.322.919.613.79.47.97.16.15.14.23.22.63.84.04.34.54.54.23.83.22.72.31.81.51.61.91.81.61.50.20.20.10.10.10.10.20.41.13.318.319.723.720.414.29.98.67.96.95.84.93.92.92.52.02.13.34.14.54.74.84.54.03.42.72.11.61.31.41.92.32.12.00.20.10.10.10.10.10.20.40.83.019.521.222.619.214.510.79.68.47.46.45.64.63.52.72.33.74.14.54.43.93.84.14.34.14.54.64.94.94.74.44.13.72.82.21.61.21.32.02.52.52.40.10.10.10.10.10.10.10.30.72.618.624.322.518.414.011.310.08.77.67.06.25.34.23.43.04.65.05.25.24.74.44.44.54.44.64.65.05.04.84.54.23.72.82.21.51.11.32.12.73.22.10.10.10.10.10.10.10.10.30.72.918.322.518.813.610.69.78.88.17.46.96.15.14.23.75.15.66.06.05.65.24.94.84.64.74.74.95.15.14.84.13.42.72.01.51.21.32.22.93.52.10.10.10.10.10.10.10.10.30.52.718.326.722.318.413.210.19.08.78.37.97.66.76.35.75.25.05.14.84.44.85.25.46.56.87.16.86.66.15.75.45.15.04.84.84.94.84.33.73.02.42.01.51.21.42.12.73.02.20.20.10.10.10.10.10.20.30.72.518.722.321.817.813.19.58.58.28.07.77.56.06.76.45.95.65.65.35.05.35.76.36.77.17.06.37.06.76.25.85.65.34.94.74.54.33.73.22.62.21.91.61.41.52.12.52.52.40.20.10.10.10.10.10.20.30.82.818.419.721.618.012.59.08.07.37.27.27.15.76.86.56.26.05.95.75.55.66.16.26.66.96.86.27.06.86.56.36.05.65.04.54.23.83.32.82.52.22.01.71.61.72.22.42.12.00.30.20.20.10.10.10.20.40.92.917.318.321.918.111.88.27.06.56.36.46.76.36.66.46.26.16.26.16.06.06.06.06.26.36.56.66.76.76.86.76.55.95.14.54.13.63.12.72.52.42.32.01.92.12.42.11.91.60.40.30.20.10.10.10.20.40.82.718.519.620.816.811.37.76.45.85.75.86.16.26.16.06.06.16.26.26.16.05.95.65.55.55.86.16.36.56.87.06.86.25.44.74.13.73.33.02.92.92.82.62.52.72.92.72.32.00.60.40.20.10.10.10.20.40.72.318.222.220.615.910.77.56.25.55.35.35.35.45.45.55.65.95.75.65.45.55.75.24.94.84.95.35.66.26.46.66.66.35.85.04.54.13.83.63.63.63.53.43.23.33.63.83.32.90.70.40.20.10.10.10.20.40.72.617.726.120.616.110.37.35.95.24.94.84.74.64.64.85.05.55.75.45.35.55.24.64.34.04.14.54.95.66.06.36.46.46.05.34.94.74.54.44.34.34.34.23.93.94.34.44.23.60.80.40.20.10.10.10.20.30.62.517.526.120.516.110.37.15.74.84.44.03.93.83.83.94.24.64.95.15.04.74.44.03.63.33.43.64.14.75.46.06.46.46.05.75.75.85.75.75.45.45.55.34.94.75.05.25.23.61.00.50.20.10.10.10.10.30.52.117.822.120.415.910.87.45.84.73.93.53.23.03.03.23.43.74.14.34.23.93.53.33.02.82.83.03.33.74.45.25.86.26.26.36.67.07.17.07.06.96.86.66.15.75.96.06.03.81.10.50.20.10.10.10.10.20.52.418.119.320.816.911.67.86.04.83.93.32.92.62.62.72.83.03.23.43.43.23.02.82.72.62.62.72.83.13.64.45.36.06.67.17.68.08.38.68.78.58.37.66.96.76.76.45.94.21.20.50.20.10.10.10.10.20.62.716.717.921.818.211.87.76.05.04.13.32.82.62.52.52.72.72.83.03.02.82.82.72.72.72.72.72.72.83.24.05.16.16.97.88.38.08.59.89.89.69.27.76.97.47.16.65.74.51.20.50.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.027.90.10.10.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.50.50.50.30.50.50.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.20.30.30.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.72.02.82.92.82.82.93.02.92.31.71.10.80.50.40.30.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.71.72.32.42.32.22.22.32.42.31.91.41.00.70.50.30.20.20.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.50.81.11.41.71.81.81.81.81.92.02.01.70.90.20.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.30.30.30.40.40.40.40.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.30.30.30.30.30.20.30.30.30.30.30.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.30.30.30.30.30.30.30.40.30.40.40.40.40.30.30.30.30.30.30.30.30.30.40.40.40.30.30.30.30.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.20.20.20.20.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.03.1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-4EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-4EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5 EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1AEXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1A EXL-1AEXL-1AEXL-1EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1B EXL-1B EXL-1BEXL-1BEXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1AEXL-1AEXL-1APlan ViewScale - 1" = 40ftDesignerKyser MccrammerDate01/17/2024ScaleNot to ScaleVersion No.001SummaryDescription Symbol Avg Max Min Max/Min Avg/MinCalc Zone Bldg 2 & 4 CustomerParking7.8 fc 19.1 fc 1.6 fc 11.9:1 4.9:1Calc Zone Bldg 2 & 4 Front Row 13.5 fc 26.2 fc 5.1 fc 5.1:1 2.6:1Calc Zone Bldg #1 Entire Site 4.0 fc 27.9 fc 0.0 fc N/A N/ACalc Zone Bldg #3 Entire Site 5.7 fc 28.1 fc 0.0 fc N/A N/AProperty Line 0.3 fc 3.1 fc 0.0 fc N/A N/ACalc Zone Bldg 2 & 4 Entire Site 4.6 fc 27.0 fc 0.0 fc N/A N/ANOTES:1. CALCULATION POINT WORK PLANE: Ground Level2. FIXTURE MOUNTING HEIGHT: 22'6" AFFGUARANTEE OF PERFORMANCE. ACTUAL LIGHT LEVELS MAYVARY.**Light Loss FactorSymbol Label Quantity Manufacturer Catalog Number Number Lamps DescriptionLumensPerLampWattageEXL-13 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 134.5EXL-1A17 Lithonia Lighting [...] 1 [...] 33580.49830.94Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 L901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left33580 415.47Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 R901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right33580 415.47EXL-1B23 Lithonia Lighting [...] 1 [...] 4846.149101.8Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 L901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left4846 50.9Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 R901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right4846 50.9EXL-250 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 269EXL-42 Lithonia Lighting DSX1 LED P6 50K80CRI T3M1 D-Series Size 1 Area Luminaire P6Performance Package 5000K CCT 80CRI Type 3 Medium18938 165.25EXL-538 Lithonia Lighting DSX1 LED P1 50K80CRI T4M1 D-Series Size 1 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 4 Medium7106 50.9**This document contains confidential and proprietary information of KSA Lighting & Controls. This document may only be used by or for the benefit of KSA Lighting & Controls representatives and customers. This lighting layout is not a professional engineering drawing and is provided for informational purposes only, without warranty as to accuracy, completeness, reliability or otherwise. KSA Lighting & Controlsis not responsible for specifying the light fixtures or illumination requirements for any specific project, nor is it responsible for meeting municipal or building code requirements. It is the obligation of the end-user to consult with a professional engineering advisor to determine whether this lighting layout meets the applicable project requirements for lighting system performance, safety, suitability and effectivenessfor use in a particular application. Field verification is recommended when calculations are based on end-user or customer-provided information. End-user environment and application (including, but not limited to, voltage variation and dirt accumulation) can cause actual field performance to differ from the calculated photometric performance represented in this lighting layout. In no event will KSA Lighting &Controls be responsible for any loss resulting from any use of this drawing.1.01.62.85.510.814.324.025.324.018.713.58.66.96.77.17.68.28.89.09.29.29.29.08.78.58.58.78.88.88.88.68.58.58.88.98.98.98.78.58.58.78.98.98.98.78.48.07.36.76.15.13.82.60.90.40.20.11.01.62.95.17.39.223.024.224.920.215.111.79.57.97.57.77.87.77.98.59.09.39.18.97.97.47.58.28.68.68.67.87.47.58.28.78.78.78.07.57.47.88.68.68.78.27.46.86.56.66.35.84.53.30.90.40.20.10.81.42.12.83.85.119.423.421.917.512.39.58.58.18.08.18.38.17.28.58.98.98.68.37.67.07.17.77.97.97.97.57.07.17.78.08.08.07.77.17.07.68.08.08.07.77.06.46.36.26.25.84.93.80.90.40.20.10.60.81.01.31.93.720.816.811.38.67.97.87.98.08.15.65.55.75.75.33.50.90.50.30.20.30.40.50.71.21.820.616.611.48.98.17.87.87.87.84.84.75.25.55.53.51.00.50.30.20.20.20.30.50.81.820.116.211.79.28.58.17.97.87.77.36.86.46.25.95.44.84.34.04.04.24.44.44.54.44.34.44.75.05.05.15.15.05.15.25.45.45.35.04.64.34.14.24.85.15.03.61.00.60.30.20.10.10.20.30.61.919.57.36.96.55.95.55.14.63.93.43.33.33.53.73.83.83.83.94.04.34.64.84.94.84.85.05.15.45.55.34.94.54.24.04.24.74.84.43.81.00.60.30.20.10.10.10.20.71.818.06.96.56.25.54.74.23.63.12.72.52.62.83.13.33.43.53.63.94.24.54.74.84.84.94.95.35.55.75.45.04.64.44.24.34.74.74.03.31.00.60.30.20.10.10.20.61.717.86.35.95.85.04.23.52.92.21.82.12.12.22.52.83.23.53.84.14.34.64.85.05.15.25.45.46.06.15.95.45.04.74.54.64.74.13.52.71.00.60.30.20.10.10.10.20.51.618.95.95.85.31.61.92.12.53.03.74.34.64.74.74.95.35.65.75.75.65.96.46.35.95.45.24.94.94.94.33.62.70.90.50.20.10.10.10.10.30.51.519.35.45.14.71.31.51.82.33.03.94.64.94.94.74.85.25.65.75.75.65.45.26.36.25.96.05.75.55.35.04.23.30.90.40.20.10.10.10.20.30.62.019.64.44.13.91.11.31.62.12.73.64.44.74.64.44.75.25.75.85.75.75.55.24.65.56.36.76.56.16.05.54.73.80.80.40.20.10.10.10.20.40.62.019.33.43.23.05.86.36.56.55.95.43.50.70.30.10.10.10.10.20.40.61.418.62.25.95.96.26.56.15.73.40.70.30.10.10.10.10.10.40.61.618.01.76.56.66.46.45.85.13.40.70.30.10.10.10.10.20.30.71.716.81.46.36.46.36.15.54.53.60.70.30.10.10.10.10.20.61.717.11.66.06.26.15.85.03.92.90.70.30.20.10.10.10.20.41.518.82.16.06.26.15.54.23.22.30.70.40.20.10.10.20.41.319.72.75.85.95.85.14.03.02.20.60.40.20.10.10.10.41.820.43.65.05.15.14.74.23.32.60.60.40.20.20.10.10.31.820.44.63.74.14.24.34.03.53.10.50.40.30.20.10.10.31.316.220.719.65.53.13.33.64.14.14.12.80.60.40.30.20.10.20.41.415.917.218.26.26.05.74.63.73.22.62.01.61.51.61.71.92.22.82.92.52.42.42.42.53.03.02.62.52.62.93.44.14.43.74.54.24.34.84.84.93.10.80.50.30.20.10.10.20.51.612.113.115.26.86.46.05.14.23.63.02.42.12.12.22.52.83.13.53.63.43.13.13.13.33.63.63.43.33.53.84.45.05.14.54.94.74.75.15.14.83.51.00.60.30.20.10.10.20.61.610.010.512.57.37.06.25.34.53.83.22.72.52.62.93.33.63.94.14.14.03.73.63.63.83.93.93.94.04.24.65.15.55.55.15.35.15.15.35.14.53.91.10.60.30.10.10.20.30.61.515.57.57.16.25.34.54.03.42.92.72.93.54.04.44.64.74.64.44.13.93.94.04.14.34.44.54.75.15.55.75.75.45.55.45.45.55.14.23.51.20.60.30.10.10.10.20.30.51.417.37.37.06.25.34.54.03.53.13.03.44.04.85.25.35.15.04.84.34.03.94.04.24.34.75.05.25.35.55.55.55.35.65.65.75.64.73.93.01.20.60.30.10.10.10.20.30.51.418.46.76.96.25.54.64.03.63.33.44.04.75.45.46.05.85.55.04.54.14.04.04.34.64.94.95.35.55.55.45.45.45.55.35.95.85.14.13.11.20.60.20.10.10.20.30.52.019.55.66.46.15.44.74.23.93.83.94.65.45.85.86.66.25.54.84.64.34.14.14.54.85.04.55.15.65.65.45.55.55.54.45.76.15.84.73.81.30.60.20.10.10.10.30.51.819.85.36.05.65.14.54.34.24.24.55.26.06.46.37.06.65.85.04.64.34.14.14.44.84.94.25.05.35.35.25.35.35.34.35.56.05.85.14.31.20.60.30.10.10.10.20.41.420.05.35.55.04.64.44.34.44.75.15.66.26.96.76.96.45.85.14.54.14.14.24.44.64.84.74.94.95.04.94.94.95.04.65.35.75.85.53.91.20.60.30.10.10.20.51.720.95.34.84.44.24.24.44.85.25.55.96.46.86.96.76.05.55.04.64.24.24.34.44.54.74.74.74.74.74.84.74.64.64.64.75.25.45.63.71.20.60.30.10.10.10.61.721.94.54.03.83.84.14.65.15.76.06.36.56.66.66.25.85.24.94.64.54.54.54.64.84.74.64.64.84.94.84.74.54.14.04.04.64.84.83.71.10.60.20.10.10.10.41.721.34.03.53.33.54.04.65.35.95.96.46.56.56.35.95.55.04.84.64.54.64.74.84.94.84.84.84.94.94.94.64.23.83.53.53.94.13.93.50.90.60.30.10.10.10.41.521.13.22.82.73.03.64.45.25.44.86.06.16.05.75.44.84.44.34.24.14.24.54.54.84.74.74.74.84.74.64.23.73.32.92.83.13.22.92.60.70.50.30.20.10.20.42.021.217.211.57.76.34.84.03.12.52.12.12.53.13.94.75.24.35.45.45.25.14.84.23.83.83.73.53.84.14.14.54.54.74.94.94.74.23.73.22.72.22.22.42.11.91.70.50.40.20.10.10.20.42.020.816.610.87.45.54.13.22.62.11.81.82.12.63.33.94.44.34.84.74.34.54.23.43.03.33.12.62.82.82.94.34.64.95.14.84.74.03.42.82.31.81.82.01.91.71.50.30.30.20.10.10.20.41.520.115.910.46.64.63.42.72.21.91.61.61.92.22.63.03.43.63.63.53.84.54.95.14.24.64.13.42.72.11.71.72.02.32.12.00.20.20.10.10.10.20.51.620.016.210.36.04.02.92.32.01.71.51.61.82.02.22.42.62.72.72.74.14.85.25.23.84.64.13.42.62.11.61.62.12.52.52.40.10.10.10.10.10.10.20.61.520.516.89.75.33.42.41.91.61.51.41.51.61.81.92.02.02.02.02.04.04.54.95.04.44.43.93.22.51.91.51.62.22.83.22.10.10.10.10.10.10.10.20.41.319.315.59.24.93.02.01.61.41.41.41.51.21.31.31.33.53.94.34.64.54.03.42.82.31.91.51.62.32.93.52.10.10.10.10.10.10.20.20.918.514.18.64.73.02.01.61.51.51.51.23.23.53.83.93.83.42.92.52.11.81.51.52.22.73.02.20.10.10.10.10.10.20.21.318.614.18.24.83.22.42.01.92.01.81.93.03.33.43.33.22.82.52.21.91.71.51.62.12.42.42.30.10.10.10.10.10.10.11.418.814.28.24.93.52.82.52.42.42.42.53.03.03.02.82.52.22.01.81.61.41.31.62.02.21.91.80.10.10.10.10.10.10.10.818.313.88.45.13.73.02.93.03.23.33.32.82.82.62.32.01.71.51.31.31.21.31.61.91.71.61.30.20.20.10.10.10.10.818.214.39.05.33.93.43.43.74.04.24.32.52.32.22.01.81.61.41.21.21.21.41.82.22.11.91.60.30.20.10.10.10.10.31.019.115.69.05.24.03.73.94.24.64.85.01.81.91.92.01.81.81.61.51.51.61.82.22.83.12.82.40.40.20.10.10.10.10.21.018.715.19.05.34.13.94.24.04.14.35.11.51.61.82.02.12.12.02.02.02.22.32.73.43.83.63.10.50.20.10.10.10.10.20.818.013.88.75.24.03.74.14.34.44.75.11.51.61.82.02.22.32.42.42.52.72.83.23.94.34.43.00.50.20.10.10.10.10.20.31.218.013.68.05.03.93.53.74.04.34.34.01.61.71.82.12.32.52.62.93.23.43.53.74.34.74.82.90.50.20.10.20.20.30.30.51.818.413.87.94.93.93.33.33.63.73.63.22.70.10.11.91.81.92.12.32.63.03.43.84.04.14.14.54.64.33.00.50.20.10.30.50.60.70.91.817.913.38.05.34.03.43.23.13.12.92.62.21.90.21.91.81.82.02.32.73.33.84.14.24.34.54.64.33.73.10.40.20.10.50.81.21.51.82.717.913.59.06.24.73.93.42.92.72.42.11.91.81.61.41.51.61.92.32.83.43.83.93.83.94.44.54.13.22.30.40.20.10.71.11.82.94.25.618.915.511.38.46.65.03.62.82.42.12.02.02.02.11.61.91.91.51.51.51.62.12.11.81.61.51.62.02.01.61.91.81.92.22.52.93.43.94.24.44.44.34.03.22.41.70.50.20.10.71.11.93.56.810.016.518.020.119.415.712.49.05.53.52.62.11.91.81.81.92.12.32.22.11.91.81.82.02.32.42.21.91.81.92.22.21.92.12.02.12.42.73.13.43.74.04.24.13.83.32.72.11.40.50.20.10.81.21.83.26.612.717.920.221.921.418.715.39.25.13.52.92.52.22.02.12.22.32.52.72.52.42.42.42.52.72.72.62.52.42.42.52.52.32.52.52.62.93.33.53.63.84.04.13.93.63.02.51.91.20.50.20.10.81.32.03.35.511.016.922.326.123.819.014.58.75.74.33.53.12.82.72.82.92.93.02.92.82.83.03.13.43.43.33.22.92.72.93.03.13.13.33.23.23.53.83.94.14.34.34.23.93.52.82.21.71.20.60.30.10.10.50.91.62.85.210.616.015.616.216.818.414.58.95.84.13.22.82.93.03.33.43.23.02.72.22.73.13.43.83.83.53.22.82.32.63.13.33.63.83.53.43.33.53.94.14.44.44.13.63.02.21.81.41.00.60.30.10.10.10.20.20.20.41.01.72.43.03.23.73.73.12.52.02.02.53.03.73.83.22.72.21.92.22.83.34.04.03.42.92.31.92.22.73.23.84.03.53.12.82.83.33.84.34.33.62.92.21.61.31.00.80.50.30.10.10.10.20.30.60.91.52.32.72.42.42.62.31.71.72.22.62.32.42.62.41.81.41.72.42.92.62.62.82.51.91.51.72.42.82.52.52.92.72.22.22.73.02.62.52.72.31.61.00.80.60.50.30.20.10.10.10.20.30.30.30.30.30.20.20.10.10.10.20.20.20.20.20.20.30.30.30.30.40.40.40.40.40.30.30.30.30.30.30.40.40.40.40.40.40.30.30.20.20.20.20.20.20.20.20.20.10.10.10.10.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.117.226.08.18.18.08.07.97.67.16.66.46.36.46.76.76.66.56.46.46.66.86.96.86.76.66.66.76.86.96.96.66.36.016.725.77.77.57.27.06.86.45.85.45.25.25.35.45.45.45.45.45.55.75.85.85.75.75.75.85.95.95.85.75.417.021.417.018.313.914.913.814.716.818.016.721.016.125.016.024.816.420.516.517.413.514.213.614.316.717.916.521.016.025.215.925.212.813.616.117.015.720.915.925.316.324.617.720.817.818.816.717.818.319.517.722.316.9 16.926.117.521.918.018.916.217.017.117.817.019.715.723.715.624.815.921.017.117.815.616.016.216.616.918.515.422.315.224.515.321.316.917.816.317.116.312.38.88.48.38.27.917.012.48.68.28.28.17.816.612.08.87.97.57.47.215.411.48.57.26.66.46.315.110.27.56.35.65.35.415.39.46.65.44.74.54.514.88.95.84.63.93.73.514.08.75.54.03.22.92.72.62.413.99.25.63.82.92.52.32.11.815.19.65.84.13.22.72.32.015.510.26.54.83.93.22.72.41.915.110.97.65.94.84.03.53.12.515.711.08.16.95.85.04.43.93.216.610.98.07.16.55.85.24.74.116.611.38.17.37.06.35.95.55.015.711.18.47.87.26.96.55.85.614.711.18.97.97.27.17.014.010.78.37.47.27.37.413.410.27.67.07.07.27.413.29.77.46.66.56.87.313.39.37.16.36.16.57.114.09.16.86.26.26.56.915.29.67.06.36.36.66.715.710.37.66.56.36.46.416.211.38.16.86.26.16.117.712.38.87.26.35.85.612.88.67.56.45.75.118.213.08.57.26.45.44.617.312.38.06.85.84.83.90.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.05.15.11.627.026.219.10.10.10.10.20.53.117.719.121.117.411.67.25.34.94.23.42.92.62.52.52.62.72.82.92.92.82.72.72.72.72.72.72.82.83.14.05.16.17.08.08.99.610.110.310.110.09.89.38.47.77.26.45.23.91.20.50.20.10.10.10.10.30.42.818.121.120.716.211.37.86.14.94.03.32.92.62.62.62.72.82.93.13.12.92.82.82.72.72.72.72.82.93.24.15.26.27.17.98.99.810.410.410.110.010.09.58.77.97.05.94.73.41.20.50.20.10.10.10.10.30.52.618.125.220.715.910.77.66.04.84.03.53.12.92.92.93.03.23.43.63.63.43.22.92.92.82.72.82.93.23.84.65.76.57.17.98.79.410.010.210.09.99.89.38.57.87.15.94.83.51.20.50.20.10.10.10.20.40.62.818.426.720.816.110.57.56.05.04.44.03.73.53.43.53.73.94.34.64.54.33.93.63.33.13.13.33.53.94.75.66.57.17.37.98.27.98.19.59.79.79.27.97.17.37.26.55.34.01.20.50.20.10.10.10.20.40.73.018.523.320.916.010.87.76.45.55.14.84.64.44.24.34.54.95.15.45.45.14.84.44.03.73.84.04.45.05.76.57.17.47.57.67.87.98.28.68.78.78.47.87.16.86.86.35.54.41.20.50.20.10.10.10.20.40.83.818.920.321.216.711.58.16.75.95.65.55.35.15.05.15.35.65.75.55.65.55.65.14.84.54.64.95.36.06.16.77.07.37.36.97.07.27.37.37.27.27.16.96.35.96.06.05.73.91.10.50.20.10.10.10.20.41.03.817.819.022.217.911.68.27.16.46.06.06.05.95.75.65.76.06.15.96.06.16.15.75.55.55.65.86.16.56.97.17.27.57.06.66.56.46.46.26.06.06.05.75.35.05.35.45.63.61.00.50.20.10.10.10.20.40.93.818.219.621.917.812.18.97.77.06.76.76.86.66.36.06.06.16.26.46.56.56.56.46.36.36.36.76.76.97.17.57.67.36.86.46.15.95.85.65.45.35.14.84.34.14.54.74.73.50.90.40.20.10.10.20.40.73.619.021.421.717.512.79.58.67.97.87.67.36.76.56.46.05.96.16.26.56.66.76.97.17.26.97.27.27.17.17.37.37.16.76.46.15.95.65.25.14.84.54.13.63.53.84.03.73.30.70.40.20.10.10.10.30.73.119.025.622.217.913.110.19.18.98.78.27.76.86.66.45.85.65.65.85.86.06.87.17.57.77.27.47.67.37.06.96.86.76.46.16.05.85.34.84.44.13.73.22.82.73.13.22.82.40.60.40.20.10.10.10.30.63.219.322.518.613.510.69.59.38.98.47.96.66.66.05.45.15.25.45.45.76.17.17.47.87.47.77.47.06.56.46.26.36.06.06.05.85.34.63.93.42.92.42.12.12.32.11.91.60.40.30.20.10.10.30.63.119.025.222.518.313.911.110.29.38.68.07.66.75.74.74.03.65.96.76.97.06.66.05.85.85.65.75.65.85.95.85.34.53.73.02.41.91.51.72.01.91.71.50.30.20.20.10.10.20.63.619.321.722.718.814.511.410.49.28.27.56.85.94.84.03.53.15.76.26.56.45.85.25.25.45.35.45.55.86.05.65.14.63.82.92.31.71.41.52.02.32.11.90.20.10.10.10.10.10.20.83.918.420.123.420.014.310.79.58.87.96.96.05.14.13.93.54.14.95.25.34.54.14.33.82.92.21.61.21.42.02.52.52.50.10.10.10.10.10.10.20.83.918.219.923.319.613.89.68.28.07.06.05.14.23.24.04.54.95.25.14.74.23.62.82.11.51.21.42.22.83.22.20.10.10.10.10.10.10.30.63.518.920.921.717.612.79.07.66.55.64.73.93.12.43.54.04.34.64.74.33.83.12.52.01.51.21.42.32.93.52.20.20.10.10.10.10.10.20.30.62.918.323.820.816.011.07.86.25.04.13.52.92.31.83.23.53.84.04.03.73.32.72.32.01.61.31.52.22.83.12.30.20.10.10.10.10.10.20.40.62.918.426.620.315.69.86.64.93.93.22.72.31.81.53.23.43.53.53.53.22.82.52.22.01.71.51.72.22.62.62.50.20.20.10.10.10.10.20.40.72.718.024.220.014.89.25.84.13.12.62.32.01.61.33.13.43.33.33.23.02.72.52.42.21.91.82.02.42.62.32.00.30.30.20.10.10.10.20.40.73.218.220.319.814.89.35.53.72.82.32.11.91.51.33.43.63.33.33.23.12.92.82.82.62.42.42.52.72.42.11.70.50.30.20.10.10.20.40.83.517.618.520.315.89.35.43.62.72.32.11.91.51.23.73.73.43.43.43.43.43.53.43.23.13.03.13.33.02.62.10.60.40.20.10.10.10.20.30.83.416.917.920.916.39.55.53.93.02.52.21.91.51.23.23.43.53.73.84.04.14.14.03.93.83.63.63.93.93.52.90.70.40.20.10.10.10.10.30.53.318.019.019.815.39.96.14.43.42.92.62.32.01.81.92.33.13.74.14.65.35.85.75.55.35.14.84.03.43.13.23.33.94.04.24.44.74.94.94.74.74.74.64.34.24.44.54.23.60.80.40.20.10.10.10.10.20.42.417.421.819.614.89.86.65.14.03.32.92.52.11.91.92.33.03.74.35.05.76.26.16.15.85.54.94.13.43.13.13.33.94.24.65.05.45.75.85.65.65.55.35.04.75.05.25.13.50.90.40.20.10.10.10.20.32.217.225.119.615.19.86.85.74.74.03.32.82.42.22.22.63.34.14.75.56.46.86.46.66.66.15.34.63.83.43.43.64.34.75.35.86.16.66.86.86.66.46.05.65.45.85.85.73.61.00.40.20.10.10.10.32.116.623.719.314.89.76.75.85.44.73.93.43.02.72.73.13.84.65.26.06.77.26.47.27.36.65.75.04.33.83.84.24.95.46.06.15.96.47.87.97.77.05.75.25.96.36.05.53.91.00.40.20.10.10.10.32.315.718.818.413.99.56.86.05.75.24.54.03.53.33.33.74.45.15.66.26.87.37.37.47.56.96.05.44.74.34.44.95.55.96.57.07.58.18.78.68.48.07.36.66.56.55.95.14.11.10.50.20.10.10.10.42.513.715.116.312.48.86.66.35.85.34.84.44.13.93.94.45.05.66.16.46.87.47.87.97.67.06.45.75.25.05.15.56.06.46.77.38.18.79.09.08.78.37.87.16.56.35.84.63.51.10.50.20.10.10.10.41.98.89.811.910.37.66.15.75.55.35.05.04.94.84.95.35.86.36.76.97.27.57.87.97.57.46.96.56.05.85.96.26.76.97.27.88.49.09.29.19.08.78.17.36.65.95.14.12.91.20.60.20.10.10.10.10.20.41.65.66.17.07.56.35.25.15.25.35.55.65.85.76.06.36.97.37.57.67.77.98.18.38.27.97.67.37.06.87.07.37.67.77.98.28.89.39.79.79.49.18.47.56.65.84.94.02.71.30.60.30.10.10.10.20.51.54.24.95.05.35.34.64.54.95.46.06.46.66.57.27.68.08.38.48.28.18.28.58.88.78.68.37.97.77.98.28.48.68.68.48.69.39.910.110.39.99.38.77.86.96.05.03.92.61.30.60.30.10.40.61.01.83.56.49.39.99.610.09.26.85.45.45.86.56.86.66.87.68.48.99.09.08.16.97.78.69.19.19.18.27.17.48.39.19.19.38.87.87.58.910.010.210.39.78.57.57.47.06.05.03.92.51.20.60.30.11.01.72.84.88.913.719.121.821.619.316.311.27.66.66.46.87.47.78.18.49.19.19.19.18.78.38.48.99.08.99.18.78.48.59.09.29.19.39.08.68.79.29.69.69.79.58.88.27.66.85.74.73.72.31.10.50.30.11.11.72.74.69.714.422.226.326.522.717.611.77.46.56.56.87.48.18.79.09.19.29.29.08.88.78.68.78.98.98.88.88.78.78.89.19.19.08.98.88.89.09.19.29.29.08.78.37.56.65.84.73.62.30.90.50.20.10.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.028.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.30.30.30.40.40.50.50.50.50.50.50.40.60.60.50.50.50.50.50.50.50.50.50.50.50.50.50.50.40.50.50.40.40.40.40.40.30.30.30.30.30.20.20.10.10.10.10.20.20.30.30.30.30.40.40.50.60.60.70.80.90.90.91.01.01.00.80.90.90.90.90.80.80.70.70.70.70.70.80.80.90.90.91.01.01.11.11.01.01.00.90.80.70.60.60.50.40.30.20.10.10.10.10.20.30.40.50.60.60.70.80.80.91.01.11.31.51.11.71.61.61.61.61.51.51.51.41.31.21.11.11.11.01.01.01.11.31.51.61.61.71.81.91.92.02.01.91.71.51.31.11.10.90.70.50.30.20.10.10.10.20.30.50.91.52.43.33.33.43.64.13.93.94.44.54.54.54.74.54.34.64.64.24.14.34.13.73.73.93.53.53.63.83.63.94.74.54.54.75.35.35.45.65.14.94.84.23.12.31.91.51.10.70.40.20.10.10.10.30.50.61.22.03.14.04.95.55.55.04.84.75.25.96.56.35.65.15.05.25.56.06.05.34.74.24.34.65.15.34.74.34.24.55.46.06.66.46.16.36.46.77.27.06.15.03.92.92.31.91.40.80.40.20.10.71.01.93.13.53.64.96.57.57.26.76.46.16.06.05.96.36.56.35.95.86.05.95.85.85.75.45.04.94.84.74.94.84.64.64.95.15.76.06.46.66.97.77.67.27.37.26.65.94.83.52.72.21.60.80.30.20.12.44.17.712.414.817.119.118.917.714.310.68.87.67.06.76.36.35.86.05.96.06.25.65.65.55.45.14.84.74.54.54.44.14.04.34.84.95.55.86.36.67.27.97.87.57.37.26.76.15.34.33.32.51.80.70.30.10.12.43.98.013.216.922.225.122.018.715.110.78.67.76.96.36.05.75.25.25.35.55.44.75.14.74.64.44.03.63.63.73.53.03.03.63.94.04.95.25.86.36.67.07.37.27.06.86.35.75.34.94.03.02.20.70.30.10.12.34.59.513.515.517.220.520.620.018.012.58.67.36.76.15.65.34.84.74.84.94.74.44.33.93.94.55.25.25.05.46.46.86.76.15.14.54.85.24.83.83.00.70.30.12.54.67.08.610.011.817.317.418.417.413.28.87.36.86.15.45.14.84.54.44.54.54.44.04.44.95.35.55.76.26.26.26.05.65.25.15.24.94.33.50.70.30.12.02.83.64.55.36.716.918.019.816.211.98.97.76.86.05.35.04.64.22.93.94.24.54.95.25.65.75.65.55.55.34.94.74.95.04.93.20.70.30.11.01.31.72.32.74.117.919.820.415.711.28.67.66.65.85.34.83.92.82.43.63.94.14.54.85.05.15.04.95.04.74.44.34.64.85.13.20.70.30.10.50.60.91.31.83.317.523.921.016.211.08.47.26.45.65.14.23.42.63.63.84.14.24.44.64.64.64.64.44.23.83.74.14.44.53.20.70.30.10.10.20.40.60.91.33.417.927.421.417.111.38.37.06.15.44.64.03.22.33.74.04.14.24.44.44.34.44.23.93.63.33.23.63.83.63.20.60.30.20.10.10.20.40.71.23.018.225.521.617.211.88.87.26.05.14.53.82.82.03.94.14.24.24.34.24.03.83.63.32.92.62.62.93.02.72.40.50.30.20.10.10.20.30.61.02.919.221.822.017.912.88.97.66.35.44.63.82.82.04.04.14.24.34.24.03.73.33.02.72.21.92.02.22.01.81.60.40.30.10.10.10.10.30.51.13.318.820.322.919.613.79.47.97.16.15.14.23.22.63.84.04.34.54.54.23.83.22.72.31.81.51.61.91.81.61.50.20.20.10.10.10.10.20.41.13.318.319.723.720.414.29.98.67.96.95.84.93.92.92.52.02.13.34.14.54.74.84.54.03.42.72.11.61.31.41.92.32.12.00.20.10.10.10.10.10.20.40.83.019.521.222.619.214.510.79.68.47.46.45.64.63.52.72.33.74.14.54.43.93.84.14.34.14.54.64.94.94.74.44.13.72.82.21.61.21.32.02.52.52.40.10.10.10.10.10.10.10.30.72.618.624.322.518.414.011.310.08.77.67.06.25.34.23.43.04.65.05.25.24.74.44.44.54.44.64.65.05.04.84.54.23.72.82.21.51.11.32.12.73.22.10.10.10.10.10.10.10.10.30.72.918.322.518.813.610.69.78.88.17.46.96.15.14.23.75.15.66.06.05.65.24.94.84.64.74.74.95.15.14.84.13.42.72.01.51.21.32.22.93.52.10.10.10.10.10.10.10.10.30.52.718.326.722.318.413.210.19.08.78.37.97.66.76.35.75.25.05.14.84.44.85.25.46.56.87.16.86.66.15.75.45.15.04.84.84.94.84.33.73.02.42.01.51.21.42.12.73.02.20.20.10.10.10.10.10.20.30.72.518.722.321.817.813.19.58.58.28.07.77.56.06.76.45.95.65.65.35.05.35.76.36.77.17.06.37.06.76.25.85.65.34.94.74.54.33.73.22.62.21.91.61.41.52.12.52.52.40.20.10.10.10.10.10.20.30.82.818.419.721.618.012.59.08.07.37.27.27.15.76.86.56.26.05.95.75.55.66.16.26.66.96.86.27.06.86.56.36.05.65.04.54.23.83.32.82.52.22.01.71.61.72.22.42.12.00.30.20.20.10.10.10.20.40.92.917.318.321.918.111.88.27.06.56.36.46.76.36.66.46.26.16.26.16.06.06.06.06.26.36.56.66.76.76.86.76.55.95.14.54.13.63.12.72.52.42.32.01.92.12.42.11.91.60.40.30.20.10.10.10.20.40.82.718.519.620.816.811.37.76.45.85.75.86.16.26.16.06.06.16.26.26.16.05.95.65.55.55.86.16.36.56.87.06.86.25.44.74.13.73.33.02.92.92.82.62.52.72.92.72.32.00.60.40.20.10.10.10.20.40.72.318.222.220.615.910.77.56.25.55.35.35.35.45.45.55.65.95.75.65.45.55.75.24.94.84.95.35.66.26.46.66.66.35.85.04.54.13.83.63.63.63.53.43.23.33.63.83.32.90.70.40.20.10.10.10.20.40.72.617.726.120.616.110.37.35.95.24.94.84.74.64.64.85.05.55.75.45.35.55.24.64.34.04.14.54.95.66.06.36.46.46.05.34.94.74.54.44.34.34.34.23.93.94.34.44.23.60.80.40.20.10.10.10.20.30.62.517.526.120.516.110.37.15.74.84.44.03.93.83.83.94.24.64.95.15.04.74.44.03.63.33.43.64.14.75.46.06.46.46.05.75.75.85.75.75.45.45.55.34.94.75.05.25.23.61.00.50.20.10.10.10.10.30.52.117.822.120.415.910.87.45.84.73.93.53.23.03.03.23.43.74.14.34.23.93.53.33.02.82.83.03.33.74.45.25.86.26.26.36.67.07.17.07.06.96.86.66.15.75.96.06.03.81.10.50.20.10.10.10.10.20.52.418.119.320.816.911.67.86.04.83.93.32.92.62.62.72.83.03.23.43.43.23.02.82.72.62.62.72.83.13.64.45.36.06.67.17.68.08.38.68.78.58.37.66.96.76.76.45.94.21.20.50.20.10.10.10.10.20.62.716.717.921.818.211.87.76.05.04.13.32.82.62.52.52.72.72.83.03.02.82.82.72.72.72.72.72.72.83.24.05.16.16.97.88.38.08.59.89.89.69.27.76.97.47.16.65.74.51.20.50.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.027.90.10.10.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.50.50.50.30.50.50.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.20.30.30.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.72.02.82.92.82.82.93.02.92.31.71.10.80.50.40.30.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.71.72.32.42.32.22.22.32.42.31.91.41.00.70.50.30.20.20.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.50.81.11.41.71.81.81.81.81.92.02.01.70.90.20.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.30.30.30.40.40.40.40.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.30.30.30.30.30.20.30.30.30.30.30.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.30.30.30.30.30.30.30.40.30.40.40.40.40.30.30.30.30.30.30.30.30.30.40.40.40.30.30.30.30.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.20.20.20.20.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.03.1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-4EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-4EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5 EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1AEXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1A EXL-1AEXL-1AEXL-1EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1B EXL-1B EXL-1BEXL-1BEXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1AEXL-1AEXL-1APlan ViewScale - 1" = 40ftDescription Symbol Avg Max Min Max/Min Avg/MinCalc Zone Bldg 2 & 4 CustomerParking7.8 fc 19.1 fc 1.6 fc 11.9:1 4.9:1Calc Zone Bldg 2 & 4 Front Row 13.5 fc 26.2 fc 5.1 fc 5.1:1 2.6:1Calc Zone Bldg #1 Entire Site 4.0 fc 27.9 fc 0.0 fc N/A N/ACalc Zone Bldg #3 Entire Site 5.7 fc 28.1 fc 0.0 fc N/A N/AProperty Line 0.3 fc 3.1 fc 0.0 fc N/A N/ACalc Zone Bldg 2 & 4 Entire Site 4.6 fc 27.0 fc 0.0 fc N/A N/ANOTES:1. CALCULATION POINT WORK PLANE: Ground Level2. FIXTURE MOUNTING HEIGHT: 22'6" AFFGUARANTEE OF PERFORMANCE. ACTUAL LIGHT LEVELS MAYVARY.**Light Loss FactorSymbol Label Quantity Manufacturer Catalog Number Number Lamps DescriptionLumensPerLampWattageEXL-13 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 134.5EXL-1A17 Lithonia Lighting [...] 1 [...] 33580.49830.94Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 L901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left33580 415.47Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 R901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right33580 415.47EXL-1B23 Lithonia Lighting [...] 1 [...] 4846.149101.8Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 L901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left4846 50.9Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 R901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right4846 50.9EXL-250 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 269EXL-42 Lithonia Lighting DSX1 LED P6 50K80CRI T3M1 D-Series Size 1 Area Luminaire P6Performance Package 5000K CCT 80CRI Type 3 Medium18938 165.25EXL-538 Lithonia Lighting DSX1 LED P1 50K80CRI T4M1 D-Series Size 1 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 4 Medium7106 50.9**This document contains confidential and proprietary information of KSA Lighting & Controls. This document may only be used by or for the benefit of KSA Lighting & Controls representatives and customers. This lighting layout is not a professional engineering drawing and is provided for informational purposes only, without warranty as to accuracy, completeness, reliability or otherwise. KSA Lighting & Controlsis not responsible for specifying the light fixtures or illumination requirements for any specific project, nor is it responsible for meeting municipal or building code requirements. It is the obligation of the end-user to consult with a professional engineering advisor to determine whether this lighting layout meets the applicable project requirements for lighting system performance, safety, suitability and effectivenessfor use in a particular application. Field verification is recommended when calculations are based on end-user or customer-provided information. End-user environment and application (including, but not limited to, voltage variation and dirt accumulation) can cause actual field performance to differ from the calculated photometric performance represented in this lighting layout. In no event will KSA Lighting &Controls be responsible for any loss resulting from any use of this drawing.PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINENORTH002DRAWING SCALE3. TOP-OF-POLE BASE, 2'-6", TYP.ZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTAS NOTED144 All-New D-Series Area Luminaires Customer Presentation January 2023 145 Confidentiality Statement The information in this presentation is confidential and proprietary, and may not be used, reproduced or distributed without the express written permission of Acuity Brands Lighting, Inc. 146 Area Portfolio Positioning Best in Class Specification Performance Renovation Discretionary Stock Specialty / Visual Comfort Specialty Pedestrian / Visual Comfort RSX Area Renovation Workhorse NEW D-Series Area Flagship Specification Best for New ConstructionESX1 Area Lowest Cost of Light Customer / Application TypePrice Eurotique Radean 147 D-Series Refresh •Flawless Aesthetic •Enhanced Features •Immaculate Photometry Fully Re-Engineered –Inside and Out! 148 •Maintains Family Appearance •Contoured Monolithic Housing •Clean Lines & Smooth Curves •Integrated Motion Sensor Flawless Aesthetics 149 150 NEW DSX1 with nLight AIR Legacy DSX1 with nLight AIR 151 •More Lumens & Improved Efficacy •More CCT and CRI choices •And much more…! Other Enhanced Features 152 D-Series Size 0 •4,400 –21,600 lumens •33W to 171W D-Series Size 1 •7,200 -35,000 lumens •51W to 277W D-Series Size 2 •18,400 -60,000 lumens •135W to 462W Lumen Range by Size 153 Power Package P1 P2 P3 P4 P5 P6 P7 Lumens (4000K, T3M)4,791 6,180 8,795 11,130 12,091 17,135 20,319 Watts 33W 45W 69W 93W 90W 137W 171W LPW 144 137 128 120 134 125 119 DLC v5.1 Premium DSX0 Performance •MORE LUMENS -New P7 package will provide 10% increase in max lumens vs. legacy DSX0 •LESS ENERGY -Or move down to new P6 package and save 29W vs. legacy DSX0 •DLC v5.1 premium (varies by CCT, CRI and optic type) 154 Power Package P1 P2 P3 P4 P5 P6 P7 P8 P9 Lumens (4000K, T3M)7,594 9,763 13,763 16,032 17,630 20,539 22,210 28,030 34,006 Watts 51W 68W 102W 124W 138W 165W 184W 216W 277W LPW 149 144 135 129 128 124 120 130 123 DLC v5.1 Premium DSX1 Performance •MORE LUMENS -New P9 package will provide 23% increase in max lumens vs. legacy DSX1 •LESS ENGERGY –Choose new P8 package and save 25W vs. legacy DSX1 at same light output •DLC v5.1 premium (varies by CCT, CRI and optic type) 155 Power Package P1 P2 P3 P4 P5 P6 P7 P8 Lumens (4000K, T3M)19,480 24,924 29,423 35,040 40,187 44,894 51,461 56,314 Watts 135W 179W 219W 273W 327W 342W 409W 462W LPW 145 139 134 129 123 131 126 122 DLC v5.1 Premium DSX2 Performance •MORE LUMENS -New P8 package will provide 14% increase in max lumens vs. legacy DSX2 •LESS ENERGY -Or move down to new P7 package and save 39W vs. legacy DSX2 •DLC v5.1 premium (varies by CCT, CRI and optic type) 156 Optics (15) New optics •Standard optics •Low G optics •Corner & backlight control optics New Silicone lens material •Not affected by temperature •Durable –will not crack •Stable –will not yellow Engineering Excellence •Specialized designs (undercuts) •More precise beam shaping •IP66 rated Features and Benefits 157 (8) Standard Optics •Improved forward and lateral distributions •Wider distributions allow greater pole spacing Optical Distributions T2M AFRT1ST3M T4M TFTM T5M T5W 158 CompetitorNew Lithonia D-Series DSX T3M 25ft MH Calc Grid: 180ft X 60ftCompetitive Comparison New Lithonia DSX T3M Competitor T3 25,000 Lumens 25,000 1.7 Avg fc 1.7 4.1 Max fc 5.7 0.5 Min fc 0.3 8.2 Max/Min 19 3.4 Avg/Min 5.7 Identical lumen output and Avg. fc 66% higher minimum fc Wasteful hot spot Dangerously low footcandle levels Poor uniformity Superior uniformity 159 To maintain 0.5 fc, the Competitor can only be spaced at 140’ while the new DSX T3M can reach 180’ spacing BENEFITS OF USING THE NEW DSX:•One pole/fixture combo eliminated every 720ft•Less trenching, wiring and concrete bases = huge cost savings•Energy reduced by ~20% Competitor 5 poles –only 140ft spacing on center New DSX T3M 4 poles -180ft spacing on center Scaled to 25,000 lumens 25ft MH Wider Pole Spacing = Fewer Poles Required 140’ 180’ 160 (3) Low-G Optics •Reduces high angle light minimizing BUG –“G rating” •Increased light levels within distribution •1 –2 G ratings below the similar distribution type from competitors T4LGT3LG T5LG Optical Distributions 161 (2) Backlight Control Optics •New BLC optics provide only 0.5% of total light behind pole •Maintain B0 up to 43,000 lumens •Shortest distance to zero foot-candles behind pole •Additional forward and lateral throw •Absolute BEST backlight control in the business! (2) Corner Control Optics •New corner optics help supplement hard to light areas with improved cutoff control and further corner reach towards center Optical Distributions BLC4BLC3 LCCO RCCO 162 New BLC3 / BLC4 Optics Close Up As viewed from front As viewed from rear 163 New BLC3 / BLC4 Optics “Black-out” technology•Reduces aperture brightness•Redirects light forward and lateral•Complete back light control Close Up As viewed from front As viewed from rear 164 With BLC BLC4 Standard T3M T3M Precise cutoff under pole and at boundary line Shortest distance to ZERO foot-candles behind pole Complete zonal backlight control BLC in Application 165 Qty (2) DSX with new BLC4 State-of-the-Art Backlight Control…In Application! Drone Shot from Above BLC4 BLC4 Optics with Industry-Leading Backlight Control Superior backlight control Optimized forward and lateral throw 166 Proprietary & Confidential New DSX with BLC4 Competitor DCompetitor B Competitor CCompetitor A Scaled to 20,000 lumens 20ft MH New DSX with BLC4 Competitor A Competitor B Competitor C Competitor D 167 More Shielding Solutions •For optimal results, choose the best optic specific to application •House side shield (HS) –factory or field installed •External glare shield (EGS) –field installed and reversable to face front or back Field Accessories to Address Glare and Other Light Trespass Challenges 168 More Mountings •Square and Round Pole Mounting •Wall Bracket •Mast Arm Adapter 169 Mountings –Standard Arm SPA & RPA Mounting Details for Standard Pole Mount SPA -Standard integral arm Fits min. 3.5” square poles SPA8N (adapter) For narrow square poles (min. 3”) RPA (adapter) Fits min. 3” round poles DSX Standard #8 Pole Drilling Fits pole drillings 2.41” to 3.16” on center Ships standard with sliding nut bracket New DSX use #8 drilling (standard template) 170 Ordering Information New Features: •New DSX requires CRI in the description •Expanded CCT’s and CRI’s 171 Ordering Information New Features: •Option PIR sensor has improved detection pattern and mounting height range •Bi-level dimming device is UVOLT and allows secondary control circuit to dim light engines •New coastal construction option for added corrosion protection •External glare shield is now reversible in the field (can be forward or backward facing) 172 •Site-wide controls solution •Motion sensing with dusk-to-dawn photocontrol •Ready at install with out-of-box default settings or •Commission with smartphone for grouping the site •nLight Eclypse is not needed unless scheduled dimming required nLight AIR™Controls 173 Access and Maintenance Access to mounting compartment is via splice cover door using a single screw It is not necessary to open the driver compartment when installing the new D- Series All doors are tethered All screws are captive 174 NEW DSX Refresh The Legacy Version Will Continue to be Available! Website –Different Product Pages for Each Series Legacy DSX LEGACY D-SERIES AREA SIZE 1 Legacy DSX1 LED Area Luminaire Legacy DSX (G1) •Available for coming six plus months •Availability for limited time during ramp down New DSX Refresh •Available now! 175 Product Information Available on D-Series Product Pages Proprietary & Confidential Imagery Standard Product Renderings 360°Product Renderings Application Images Collateral Brochure Product Web Pages Product Family Page Videos Feature & Benefit Installation Technical Data Specification Sheets Installation Instructions Presentations Customer Presentation 176 Video Links Reveal Video Installation Video Feature/Benefit Video Initial Reveal, Feature/Benefit and Installation Videos 177 Thank You 178 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 1 of 10 COMMERCIAL OUTDOOR Ordering Information EXAMPLE: DSX1 LED P7 40K 70CRI T3M MVOLT SPA NLTAIR2 PIRHN DDBXD DSX1 LED Series LEDs Color temperature 2 Color Rendering Index 2 Distribution Voltage Mounting DSX1 LED Forward optics P1 P6 P2 P7 P3 P8 P4 P9 P5 Rotated optics P10 1 P12 1 P11 1 P13 1 (this section 70CRI only) 30K 3000K 40K 4000K 50K 5000K (this section 80CRI only, extended lead times apply) 27K 2700K 30K 3000K 35K 3500K 40K 4000K 50K 5000K 70CRI 70CRI 70CRI 80CRI 80CRI 80CRI 80CRI 80CRI AFR Automotive front row T1S Type I short T2M Type II medium T3M Type III medium T3LG Type III low glare 3 T4M Type IV medium T4LG Type IV low glare 3 TFTM Forward throw medium T5M Type V medium T5LG Type V low glare T5W Type V wide BLC3 Type III backlight control 3 BLC4 Type IV backlight control 3 LCCO Left corner cutoff 3 RCCO Right corner cutoff 3 MVOLT (120V-277V) 4 HVOLT (347V-480V) 5,6 XVOLT (277V - 480V) 7,8 120 16, 26 208 16, 26 240 16, 26 277 16, 26 347 16, 26 480 16, 26 Shipped included SPA Square pole mounting (#8 drilling) RPA Round pole mounting (#8 drilling) SPA5 Square pole mounting #5 drilling 9 RPA5 Round pole mounting #5 drilling 9 SPA8N Square narrow pole mounting #8 drilling WBA Wall bracket 10 MA Mast arm adapter (mounts on 2 3/8" OD horizontal tenon) Control options Other options Finish (required) Shipped installed NLTAIR2 PIRHN nLight AIR gen 2 enabled with bi-level motion / ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc. 11, 12, 20, 21 PIR High/low, motion/ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc 13, 20, 21 PER NEMA twist-lock receptacle only (controls ordered separate) 14 PER5 Five-pin receptacle only (controls ordered separate)14, 21 PER7 Seven-pin receptacle only (controls ordered separate) 14, 21 FAO Field adjustable output 15, 21 BL30 Bi-level switched dimming, 30% 16, 21 BL50 Bi-level switched dimming, 50% 16, 21 DMG 0-10v dimming wires pulled outside fixture (for use with an external control, ordered separately) 17 DS Dual switching 18, 19, 21 Shipped installed SPD20KV 20KV surge protection HS Houseside shield (black finish standard) 22 L90 Left rotated optics 1 R90 Right rotated optics 1 CCE Coastal Construction 23 HA 50°C ambient operation 24 BAA Buy America(n) Act Compliant SF Single fuse (120, 277, 347V) 26 DF Double fuse (208, 240, 480V) 26 Shipped separately EGSR External Glare Shield (reversible, field install required, matches housing finish) BSDB Bird Spikes (field install required) DDBXD Dark Bronze DBLXD Black DNAXD Natural Aluminum DWHXD White DDBTXD Textured dark bronze DBLBXD Textured black DNATXD Textured natural aluminum DWHGXD Textured white D-Series Size 1LED Area Luminaire Catalog Number Notes Type Introduction The modern styling of the D-Series features a highly refined aesthetic that blends seamlessly with its environment. The D-Series offers the benefits of the latest in LED technology into a high performance, high efficacy, long-life luminaire. The photometric performance results in sites with excellent uniformity, greater pole spacing and lower power density. D-Series outstand- ing photometry aids in reducing the number of poles required in area lighting applications with typical energy savings of 65% and expected service life of over 100,000 hours. Hit the Tab key or mouse over the page to see all interactive elements. H2 L W H1 Specifications EPA:0.69 ft2 (0.06 m2) Length:32.71" (83.1 cm) Width:14.26"(36.2 cm) Height H1:7.88"(20.0 cm) Height H2:2.73"(6.9 cm) Weight:34 lbs(15.4 kg) 179 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 2 of 10 COMMERCIAL OUTDOOR Accessories Ordered and shipped separately. DLL127F 1.5 JU Photocell - SSL twist-lock (120-277V) 25 DLL347F 1.5 CUL JU Photocell - SSL twist-lock (347V) 25 DLL480F 1.5 CUL JU Photocell - SSL twist-lock (480V) 25 DSHORT SBK Shorting cap 25 DSX1HS P# House-side shield (enter package number 1-13 in place of #) DSXRPA (FINISH) Round pole adapter (#8 drilling, specify finish) DSXSPA5 (FINISH) Square pole adapter #5 drilling (specify finish) DSXRPA5 (FINISH) Round pole adapter #5 drilling (specify finish) DSX1EGSR (FINISH) External glare shield (specify finish) DSX1BSDB (FINISH) Bird spike deterrent bracket (specify finish) Shield Accessories External Glare Shield (EGSR) Tenon O.D. Mounting Single Unit 2 @ 180 2 @ 90 3 @ 90 3 @120 4 @ 90 2-3/8"RPA AS3-5 190 AS3-5 280 AS3-5 290 AS3-5 390 AS3-5 320 AS3-5 490 2-7/8"RPA AST25-190 AST25-280 AST25-290 AST25-390 AST25-320 AST25-490 4"RPA AST35-190 AST35-280 AST35-290 AST35-390 AST35-320 AST35-490 Tenon Mounting SlipfitterDrilling Top of Pole 0.563" 2.650" 1.325"0.400"(2 PLCS) Template #8 Ordering Information NOTES 1 Rotated optics available with packages P10, P11, P12 and P13. Must be combined with option L90 or R90.2 30K, 40K, and 50K available in 70CRI and 80CRI. 27K and 35K only available with 80CRI. Contact Technical Support for other possible combinations. 3 T3LG, T4LG, BLC3, BLC4, LCCO, RCCO not available with option HS.4 MVOLT driver operates on any line voltage from 120-277V (50/60 Hz). 5 HVOLT driver operates on any line voltage from 347-480V (50/60 Hz).6 HVOLT not available with package P1 and P10 when combined with option NLTAIR2 PIRHN or option PIR. 7 XVOLT operates with any voltage between 277V and 480V (50/60 Hz).8 XVOLT not available in packages P1 or P10. XVOLT not available with fusing (SF or DF). 9 SPA5 and RPA5 for use with #5 drilling only (Not for use with #8 drilling).10 WBA cannot be combined with Type 5 distributions plus photocell (PER). 11 NLTAIR2 and PIRHN must be ordered together. For more information on nLight AIR2 visit this link12 NLTAIR2 PIRHN not available with other controls including PIR, PER, PER5, PER7, FAO, BL30, BL50, DMG and DS. NLTAIR2 PIRHN not available with P1 and P10 using HVOLT. NLTAIR2 PIRHN not available with P1 and P10 using XVOLT. 13 PIR not available with NLTAIR2 PIRHN, PER, PER5, PER7, FAO BL30, BL50, DMG and DS. PIR not available with P1 and P10 using HVOLT. PIR not avail-able with P1 and P10 using XVOLT.14 PER/PER5/PER7 not available with NLTAIR2 PIRHN, PIR, BL30, BL50, FAO, DMG and DS. Photocell ordered and shipped as a separate line item from Acuity Brands Controls. See accessories. Shorting Cap included.15 FAO not available with other dimming control options NLTAIR2 PIRHN, PIR, PER5, PER7, BL30, BL50, DMG and DS. 16 BL30 and BL50 are not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, FAO, DMG and DS. BL30 or BL50 must specify 120, 277 or 347V. Consult tech support for 208, 240 or 480V. 17 DMG not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DS.18 DS not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DMG. 19 DS requires (2) separately switched circuits. DS provides 50/50 fixture operation via (2) different sets of leads using (2) drivers. DS only available with packages P8, P9, P10, P11, P12 and P13. 20 Reference Motion Sensor Default Settings table on page 4 to see functionality.21 Reference Controls Options table on page 4. 22 HS not available with T3LG, T4LG, BLC3, BLC4, LCCO and RCCO distribution. Also available as a separate accessory; see Accessories information.23 CCE option not available with option BS and EGSR. Contact Technical Support for availability. 24 Option HA not available with performance packages P4, P5, P7, P8, P9 and P13.25 Requires luminaire to be specified with PER, PER5 or PER7 option. See Controls Table on page 4. 26 Single fuse (SF) requires 120V, 277V, or 347V. Double fuse (DF) requires 208V, 240V or 480V. XVOLT not available with fusing (SF or DF). HANDHOLE ORIENTATION AHandhole B C D 1.75" for aluminum poles2.75" for other pole types Fixture Quantity & Mounting Configuration Single DM19 2 @ 180 DM28 2 @ 90 DM29 3 @ 90 DM39 3 @ 120 DM32 4 @ 90 DM49 Mounting Type DSX1 with SPA 0.69 1.38 1.23 1.54 ---1.58 DSX1 with SPA5, SPA8N 0.70 1.40 1.30 1.66 ---1.68 DSX1 with RPA, RPA5 0.70 1.40 1.30 1.66 1.60 1.68 DSX1 with MA 0.83 1.66 1.50 2.09 2.09 2.09 DSX1 Area Luminaire - EPA *Includes luminaire and integral mounting arm. Other tenons, arms, brackets or other accessories are not included in this EPA data. House Side Shield (HS) Minimum Acceptable Outside Pole Dimension SPA #8 3.5"3.5"3.5"3.5"3.5" RPA #8 3" 3" 3"3"3" 3" SPA5 #5 3" 3" 3"3"3" RPA5 #5 3" 3"3"3"3"3" SPA8N #8 3"3"3"3"3" Mounting Option Drilling Template Single 2 @ 180 2 @ 90 3 @ 90 3 @ 120 4 @ 90 Head Location Side B Side B & D Side B & C Side B, C & D Round Pole Only Side A, B, C & D Drill Nomenclature #8 DM19AS DM28AS DM29AS DM39AS DM32AS DM49AS 180 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 3 of 10 COMMERCIAL OUTDOOR To see complete photometric reports or download .ies files for this product, visit Lithonia Lighting’s homepage. Photometric Diagrams Isofootcandle plots for the DSX1 LED P9 40K 70CRI. Distances are in units of mounting height (25’). LEGEND 0.1 fc 0.5 fc 1.0 fc T1S T2M T3M 4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T3LG T4M TFTM T4LG T5M T5W T5LG AFR BLC3 BLC4 LCCO RCCO 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 181 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 4 of 10 COMMERCIAL OUTDOOR Performance Data Current (A) Performance Package LED Count Drive Current (mA)Wattage 120V 208V 240V 277V 347V 480V Forward Optics (Non-Rotated) P1 30 530 51 0.42 0.24 0.21 0.18 0.15 0.11 P2 30 700 68 0.56 0.33 0.28 0.24 0.20 0.14 P3 30 1050 104 0.85 0.49 0.43 0.37 0.29 0.21 P4 30 1250 125 1.03 0.60 0.52 0.45 0.36 0.26 P5 30 1400 142 1.15 0.66 0.58 0.50 0.40 0.29 P6 40 1250 167 1.38 0.79 0.69 0.60 0.48 0.34 P7 40 1400 188 1.54 0.89 0.77 0.67 0.53 0.38 P8 60 1100 216 1.80 1.04 0.90 0.78 0.62 0.45 P9 60 1400 279 2.31 1.33 1.15 1.00 0.80 0.58 Rotated Optics (Requires L90 or R90) P10 60 530 101 0.84 0.49 0.42 0.37 0.29 0.21 P11 60 700 135 1.12 0.65 0.56 0.49 0.39 0.28 P12 60 1050 206 1.72 0.99 0.86 0.74 0.59 0.43 P13 60 1400 279 2.30 1.33 1.15 1.00 0.79 0.57 Electrical Load Motion Sensor Default Settings Option Unoccupied Dimmed Level High Level (when occupied)Phototcell Operation Dwell Time Ramp-up Time Dimming Fade Rate PIR 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min NLTAIR2 PIRHN 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min Lumen Ambient Temperature (LAT) Multipliers Use these factors to determine relative lumen output for average ambient temperatures from 0-40°C (32-104°F). Ambient Lumen Multiplier 0°C 32°F 1.04 5°C 41°F 1.04 10°C 50°F 1.03 15°C 50°F 1.02 20°C 68°F 1.01 25°C 77°C 1.00 30°C 86°F 0.99 35°C 95°F 0.98 40°C 104°F 0.97 Projected LED Lumen Maintenance Data references the extrapolated performance projections for the platforms noted in a 25°C ambient, based on 10,000 hours of LED testing (tested per IESNA LM-80-08 and projected per IESNA TM-21-11). To calculate LLF, use the lumen maintenance factor that corresponds to the desired number of operating hours below. For other lumen maintenance values, contact factory. Operating Hours Lumen Maintenance Factor 0 1.00 25,000 0.95 50,000 0.90 100,000 0.81 Controls Options Nomenclature Description Functionality Primary control device Notes FAO Field adjustable output device installed inside the luminaire; wired to the driver dimming leads.Allows the luminaire to be manually dimmed, effectively trimming the light output.FAO device Cannot be used with other controls options that need the 0-10V leads DS (not available on DSX0)Drivers wired independently for 50/50 luminaire operation The luminaire is wired to two separate circuits, allowing for 50/50 operation.Independently wired drivers Requires two separately switched circuits. Consider nLight AIR as a more cost effective alternative. PER5 or PER7 Twist-lock photocell receptacle Compatible with standard twist-lock photocells for dusk to dawn operation, or advanced control nodes that provide 0-10V dimming signals. Twist-lock photocells such as DLL Elite or advanced control nodes such as ROAM.Pins 4 & 5 to dimming leads on driver, Pins 6 & 7 are capped inside luminaire. Cannot be used with other controls options that need the 0-10V leads. PIR Motion sensor with integral photocell. Sensor suitable for 8' to 40' mounting height.Luminaires dim when no occupancy is detected.Acuity Controls rSBG Cannot be used with other controls options that need the 0-10V leads. NLTAIR2 PIRHN nLight AIR enabled luminaire for motion sensing, photocell and wireless communication.Motion and ambient light sensing with group response. Scheduled dimming with motion sensor over-ride when wirelessly connected to the nLight Eclypse. nLight Air rSBG nLight AIR sensors can be programmed and commissioned from the ground using the ClAIRity Pro app. Cannot be used with other controls options that need the 0-10V leads. BL30 or BL50 Integrated bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output BLC device provides input to 0-10V dimming leads on all drivers providing either 100% or dimmed (30% or 50%) control by a secondary circuit BLC UVOLT1 BLC device is powered off the 0-10V dimming leads, thus can be used with any input voltage from 120 to 480V 70 CRI 80CRI 90CRI Lumen Multiplier Availability Lumen Multiplier Availability Lumen Multiplier Availability 5000K 102%Standard 92%Extended lead-time 71%(see note) 4000K 100%Standard 92%Extended lead-time 67%(see note) 3500K 100%(see note)90%Extended lead-time 63%(see note) 3000K 96%Standard 87%Extended lead-time 61%(see note) 2700K 94%(see note)85%Extended lead-time 57%(see note) LED Color Temperature / Color Rendering Multipliers Note: Some LED types are available as per special request. Contact Technical Support for more information.*Note: Calculated values are based on original performance package data. When calculating new values for given FAO position, use maximum published values by package listed on specification sheet (input watts and lumens by optic type). FAO Position % Wattage % Lumen Output 8 100%100% 7 93%95% 6 80%85% 5 66%73% 4 54%61% 3 41%49% 2 29%36% 1 15%20% FAO Dimming Settings 182 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 5 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P1 51W 30 530 T1S 7,776 1 0 2 153 8,104 1 0 2 159 8,262 1 0 2 162 T2M 7,203 1 0 3 142 7,507 2 0 3 147 7,653 2 0 3 150 T3M 7,287 1 0 3 143 7,594 1 0 3 149 7,742 1 0 3 152 T3LG 6,509 1 0 1 128 6,783 1 0 1 133 6,916 1 0 1 136 T4M 7,395 1 0 3 145 7,707 1 0 3 151 7,857 1 0 3 154 T4LG 6,726 1 0 1 132 7,010 1 0 1 138 7,146 1 0 1 140 TFTM 7,446 1 0 3 146 7,760 1 0 3 152 7,912 1 0 3 155 T5M 7,609 3 0 2 149 7,930 3 0 2 156 8,084 3 0 2 159 T5W 7,732 3 0 2 152 8,058 4 0 2 158 8,215 4 0 2 161 T5LG 7,631 3 0 1 150 7,953 3 0 1 156 8,108 3 0 1 159 BLC3 5,300 0 0 2 104 5,524 0 0 2 109 5,631 0 0 2 111 BLC4 5,474 0 0 3 108 5,705 0 0 3 112 5,816 0 0 3 114 RCCO 5,348 0 0 2 105 5,573 0 0 2 109 5,682 0 0 2 112 LCCO 5,348 0 0 2 105 5,573 0 0 2 109 5,682 0 0 2 112 AFR 7,776 1 0 2 153 8,104 1 0 2 159 8,262 1 0 2 162 P2 68W 30 700 T1S 9,997 1 0 2 147 10,418 1 0 2 154 10,621 1 0 2 157 T2M 9,260 2 0 3 137 9,651 2 0 3 142 9,839 2 0 3 145 T3M 9,368 2 0 3 138 9,763 2 0 3 144 9,953 2 0 3 147 T3LG 8,368 1 0 2 123 8,721 1 0 2 129 8,891 1 0 2 131 T4M 9,507 2 0 3 140 9,909 2 0 3 146 10,102 2 0 3 149 T4LG 8,647 1 0 2 128 9,012 1 0 2 133 9,187 1 0 2 136 TFTM 9,573 2 0 3 141 9,977 2 0 3 147 10,172 2 0 3 150 T5M 9,782 4 0 2 144 10,195 4 0 2 150 10,393 4 0 2 153 T5W 9,940 4 0 2 147 10,360 4 0 2 153 10,562 4 0 2 156 T5LG 9,810 3 0 1 145 10,224 3 0 1 151 10,423 3 0 1 154 BLC3 6,814 0 0 2 101 7,101 0 0 2 105 7,240 0 0 2 107 BLC4 7,038 0 0 3 104 7,334 0 0 3 108 7,477 0 0 3 110 RCCO 6,875 1 0 2 101 7,165 1 0 2 106 7,305 1 0 2 108 LCCO 6,875 1 0 2 101 7,165 1 0 2 106 7,305 1 0 2 108 AFR 9,997 1 0 2 147 10,418 1 0 2 154 10,621 1 0 2 157 P3 102W 30 1050 T1S 14,093 2 0 2 138 14,687 2 0 2 144 14,973 2 0 2 147 T2M 13,055 2 0 3 128 13,605 2 0 3 133 13,871 2 0 3 136 T3M 13,206 2 0 4 129 13,763 2 0 4 135 14,031 2 0 4 137 T3LG 11,797 2 0 2 115 12,294 2 0 2 120 12,534 2 0 2 123 T4M 13,403 2 0 4 131 13,968 2 0 4 137 14,241 2 0 4 139 T4LG 12,190 2 0 2 119 12,704 2 0 2 124 12,952 2 0 2 127 TFTM 13,496 2 0 4 132 14,065 2 0 4 138 14,339 2 0 4 140 T5M 13,790 4 0 2 135 14,371 4 0 2 141 14,652 4 0 2 143 T5W 14,013 4 0 3 137 14,605 4 0 3 143 14,889 4 0 3 146 T5LG 13,830 3 0 2 135 14,413 3 0 2 141 14,694 3 0 2 144 BLC3 9,606 0 0 2 94 10,011 0 0 2 98 10,206 0 0 2 100 BLC4 9,921 0 0 3 97 10,340 0 0 3 101 10,541 0 0 3 103 RCCO 9,692 1 0 2 95 10,101 1 0 2 99 10,298 1 0 2 101 LCCO 9,692 1 0 2 95 10,101 1 0 2 99 10,298 1 0 2 101 AFR 14,093 2 0 2 138 14,687 2 0 2 144 14,973 2 0 2 147 Lumen Output 183 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 6 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P4 124W 30 1250 T1S 16,416 2 0 3 132 17,109 2 0 3 138 17,442 2 0 3 141 T2M 15,207 3 0 4 123 15,849 3 0 4 128 16,158 3 0 4 130 T3M 15,383 2 0 4 124 16,032 2 0 4 129 16,345 2 0 4 132 T3LG 13,742 2 0 2 111 14,321 2 0 2 116 14,600 2 0 2 118 T4M 15,613 2 0 4 126 16,272 2 0 4 131 16,589 2 0 4 134 T4LG 14,200 2 0 2 115 14,799 2 0 2 119 15,087 2 0 2 122 TFTM 15,721 2 0 4 127 16,384 2 0 4 132 16,703 2 0 4 135 T5M 16,063 4 0 2 130 16,741 4 0 2 135 17,067 4 0 2 138 T5W 16,324 5 0 3 132 17,013 5 0 3 137 17,344 5 0 3 140 T5LG 16,110 3 0 2 130 16,790 4 0 2 135 17,117 4 0 2 138 BLC3 11,190 0 0 3 90 11,662 0 0 3 94 11,889 0 0 3 96 BLC4 11,557 0 0 3 93 12,044 0 0 3 97 12,279 0 0 4 99 RCCO 11,291 1 0 3 91 11,767 1 0 3 95 11,996 1 0 3 97 LCCO 11,291 1 0 3 91 11,767 1 0 3 95 11,996 1 0 3 97 AFR 16,416 2 0 3 132 17,109 2 0 3 138 17,442 2 0 3 141 P5 138W 30 1400 T1S 18,052 2 0 3 131 18,814 2 0 3 136 19,180 2 0 3 139 T2M 16,723 3 0 4 121 17,428 3 0 4 126 17,768 3 0 4 129 T3M 16,917 3 0 4 122 17,630 3 0 4 128 17,974 3 0 4 130 T3LG 15,111 2 0 2 109 15,749 2 0 2 114 16,055 2 0 2 116 T4M 17,169 3 0 5 124 17,893 3 0 5 130 18,242 3 0 5 132 T4LG 15,615 2 0 2 113 16,274 2 0 2 118 16,591 2 0 2 120 TFTM 17,288 2 0 4 125 18,017 2 0 5 130 18,368 3 0 5 133 T5M 17,664 5 0 3 128 18,410 5 0 3 133 18,768 5 0 3 136 T5W 17,951 5 0 3 130 18,708 5 0 3 135 19,073 5 0 3 138 T5LG 17,716 4 0 2 128 18,463 4 0 2 134 18,823 4 0 2 136 BLC3 12,305 0 0 3 89 12,824 0 0 3 93 13,074 0 0 3 95 BLC4 12,709 0 0 4 92 13,245 0 0 4 96 13,503 0 0 4 98 RCCO 12,416 1 0 3 90 12,940 1 0 3 94 13,192 1 0 3 95 LCCO 12,416 1 0 3 90 12,940 1 0 3 94 13,192 1 0 3 95 AFR 18,052 2 0 3 131 18,814 2 0 3 136 19,180 2 0 3 139 P6 165W 40 1250 T1S 21,031 2 0 3 127 21,918 2 0 3 133 22,345 2 0 3 135 T2M 19,482 3 0 4 118 20,303 3 0 4 123 20,699 3 0 4 125 T3M 19,708 3 0 5 119 20,539 3 0 5 124 20,939 3 0 5 127 T3LG 17,604 2 0 2 107 18,347 2 0 2 111 18,704 2 0 2 113 T4M 20,001 3 0 5 121 20,845 3 0 5 126 21,251 3 0 5 129 T4LG 18,191 2 0 2 110 18,959 2 0 2 115 19,328 2 0 2 117 TFTM 20,140 3 0 5 122 20,989 3 0 5 127 21,398 3 0 5 129 T5M 20,579 5 0 3 125 21,447 5 0 3 130 21,865 5 0 3 132 T5W 20,912 5 0 3 127 21,795 5 0 3 132 22,219 5 0 3 134 T5LG 20,638 4 0 2 125 21,509 4 0 2 130 21,928 4 0 2 133 BLC3 14,335 0 0 3 87 14,940 0 0 3 90 15,231 0 0 3 92 BLC4 14,805 0 0 4 90 15,430 0 0 4 93 15,731 0 0 4 95 RCCO 14,464 1 0 3 88 15,074 1 0 3 91 15,368 1 0 3 93 LCCO 14,464 1 0 3 88 15,074 1 0 3 91 15,368 1 0 3 93 AFR 21,031 2 0 3 127 21,918 2 0 3 133 22,345 2 0 3 135 Lumen Output 184 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 7 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P7 184W 40 1400 T1S 22,741 2 0 3 123 23,700 2 0 3 129 24,162 3 0 3 131 T2M 21,066 3 0 4 114 21,955 3 0 4 119 22,383 3 0 4 121 T3M 21,311 3 0 5 116 22,210 3 0 5 120 22,642 3 0 5 123 T3LG 19,036 2 0 2 103 19,839 2 0 3 108 20,226 2 0 3 110 T4M 21,628 3 0 5 117 22,541 3 0 5 122 22,980 3 0 5 125 T4LG 19,671 2 0 2 107 20,501 2 0 3 111 20,900 2 0 3 113 TFTM 21,778 3 0 5 118 22,697 3 0 5 123 23,139 3 0 5 125 T5M 22,252 5 0 3 121 23,191 5 0 3 126 23,643 5 0 3 128 T5W 22,613 5 0 3 123 23,567 5 0 4 128 24,027 5 0 4 130 T5LG 22,317 4 0 2 121 23,258 4 0 2 126 23,712 4 0 2 129 BLC3 15,501 0 0 3 84 16,155 0 0 4 88 16,470 0 0 4 89 BLC4 16,010 0 0 4 87 16,685 0 0 4 90 17,010 0 0 4 92 RCCO 15,641 1 0 3 85 16,301 1 0 3 89 16,619 1 0 3 90 LCCO 15,641 1 0 3 85 16,301 1 0 3 89 16,619 1 0 3 90 AFR 22,741 2 0 3 123 23,700 2 0 3 129 24,162 3 0 3 131 P8 216W 60 1100 T1S 28,701 3 0 3 133 29,912 3 0 4 139 30,495 3 0 4 141 T2M 26,587 3 0 5 123 27,709 3 0 5 128 28,249 3 0 5 131 T3M 26,895 3 0 5 125 28,030 3 0 5 130 28,576 3 0 5 132 T3LG 24,025 3 0 3 111 25,038 3 0 3 116 25,526 3 0 3 118 T4M 27,296 3 0 5 127 28,448 3 0 5 132 29,002 3 0 5 134 T4LG 24,826 3 0 3 115 25,873 3 0 3 120 26,378 3 0 3 122 TFTM 27,485 3 0 5 127 28,645 3 0 5 133 29,203 3 0 5 135 T5M 28,084 5 0 4 130 29,269 5 0 4 136 29,839 5 0 4 138 T5W 28,539 5 0 4 132 29,743 5 0 4 138 30,323 5 0 4 141 T5LG 28,165 4 0 2 131 29,354 4 0 2 136 29,926 4 0 2 139 BLC3 19,563 0 0 4 91 20,388 0 0 4 94 20,786 0 0 4 96 BLC4 20,205 0 0 5 94 21,057 0 0 5 98 21,468 0 0 5 99 RCCO 19,740 1 0 4 91 20,572 1 0 4 95 20,973 1 0 4 97 LCCO 19,740 1 0 4 91 20,572 1 0 4 95 20,973 1 0 4 97 AFR 28,701 3 0 3 133 29,912 3 0 4 139 30,495 3 0 4 141 P9 277W 60 1400 T1S 34,819 3 0 4 126 36,288 3 0 4 131 36,996 3 0 4 134 T2M 32,255 3 0 5 116 33,616 3 0 5 121 34,271 3 0 5 124 T3M 32,629 3 0 5 118 34,006 3 0 5 123 34,668 3 0 5 125 T3LG 29,146 3 0 3 105 30,376 3 0 4 110 30,968 3 0 4 112 T4M 33,116 3 0 5 120 34,513 3 0 5 125 35,185 3 0 5 127 T4LG 30,119 3 0 3 109 31,389 3 0 4 113 32,001 3 0 4 116 TFTM 33,345 3 0 5 120 34,751 3 0 5 125 35,429 3 0 5 128 T5M 34,071 5 0 4 123 35,509 5 0 4 128 36,201 5 0 4 131 T5W 34,624 5 0 4 125 36,084 5 0 4 130 36,788 5 0 4 133 T5LG 34,170 5 0 3 123 35,612 5 0 3 129 36,306 5 0 3 131 BLC3 23,734 0 0 4 86 24,735 0 0 4 89 25,217 0 0 4 91 BLC4 24,513 0 0 5 88 25,547 0 0 5 92 26,045 0 0 5 94 RCCO 23,948 1 0 4 86 24,958 1 0 4 90 25,445 1 0 4 92 LCCO 23,948 1 0 4 86 24,958 1 0 4 90 25,445 1 0 4 92 AFR 34,819 3 0 4 126 36,288 3 0 4 131 36,996 3 0 4 134 Lumen Output 185 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 8 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P10 101W 60 530 T1S 15,164 3 0 3 150 15,803 3 0 3 156 16,112 3 0 3 159 T2M 14,047 4 0 4 139 14,640 4 0 4 145 14,925 4 0 4 147 T3M 14,208 4 0 4 140 14,807 4 0 4 146 15,096 4 0 4 149 T3LG 12,693 3 0 3 125 13,229 3 0 3 131 13,487 3 0 3 133 T4M 14,420 4 0 4 142 15,028 4 0 4 148 15,321 4 0 4 151 T4LG 13,115 3 0 3 129 13,668 3 0 3 135 13,934 3 0 3 138 TFTM 14,522 4 0 4 143 15,134 4 0 4 149 15,429 4 0 4 152 T5M 14,836 4 0 2 146 15,462 4 0 2 153 15,763 4 0 2 156 T5W 15,076 4 0 3 149 15,712 5 0 3 155 16,019 5 0 3 158 T5LG 14,879 3 0 2 147 15,507 3 0 2 153 15,809 3 0 2 156 BLC3 10,335 3 0 3 102 10,771 4 0 4 106 10,981 4 0 4 108 BLC4 10,674 4 0 4 105 11,124 4 0 4 110 11,341 4 0 4 112 RCCO 10,429 1 0 2 103 10,869 1 0 2 107 11,080 1 0 2 109 LCCO 10,429 1 0 2 103 10,869 1 0 2 107 11,080 1 0 2 109 AFR 15,164 3 0 3 150 15,803 3 0 3 156 16,112 3 0 3 159 P11 135W 60 700 T1S 19,437 4 0 4 144 20,257 4 0 4 150 20,651 4 0 4 153 T2M 18,005 4 0 4 133 18,765 4 0 4 139 19,131 4 0 4 142 T3M 18,211 4 0 4 135 18,980 4 0 4 141 19,350 4 0 4 143 T3LG 16,270 3 0 3 121 16,957 3 0 3 126 17,287 4 0 4 128 T4M 18,483 4 0 4 137 19,263 5 0 5 143 19,638 5 0 5 146 T4LG 16,810 3 0 3 125 17,519 3 0 3 130 17,861 3 0 3 132 TFTM 18,614 4 0 4 138 19,399 4 0 4 144 19,777 5 0 5 147 T5M 19,017 5 0 3 141 19,819 5 0 3 147 20,205 5 0 3 150 T5W 19,325 5 0 3 143 20,140 5 0 3 149 20,533 5 0 3 152 T5LG 19,072 4 0 2 141 19,876 4 0 2 147 20,264 4 0 2 150 BLC3 13,247 4 0 4 98 13,806 4 0 4 102 14,075 4 0 4 104 BLC4 13,682 4 0 4 101 14,259 4 0 4 106 14,537 4 0 4 108 RCCO 13,367 1 0 3 99 13,931 1 0 3 103 14,203 1 0 3 105 LCCO 13,367 1 0 3 99 13,931 1 0 3 103 14,203 1 0 3 105 AFR 19,437 4 0 4 144 20,257 4 0 4 150 20,651 4 0 4 153 P12 206W 60 1050 T1S 27,457 4 0 4 133 28,616 4 0 4 139 29,174 4 0 4 142 T2M 25,436 5 0 5 124 26,509 5 0 5 129 27,025 5 0 5 131 T3M 25,727 5 0 5 125 26,812 5 0 5 130 27,335 5 0 5 133 T3LG 22,984 4 0 4 112 23,954 4 0 4 116 24,421 4 0 4 119 T4M 26,110 5 0 5 127 27,212 5 0 5 132 27,742 5 0 5 135 T4LG 23,747 4 0 4 115 24,749 4 0 4 120 25,231 4 0 4 123 TFTM 26,295 5 0 5 128 27,404 5 0 5 133 27,938 5 0 5 136 T5M 26,864 5 0 4 130 27,997 5 0 4 136 28,543 5 0 4 139 T5W 27,299 5 0 4 133 28,451 5 0 4 138 29,006 5 0 4 141 T5LG 26,942 4 0 2 131 28,078 4 0 2 136 28,626 4 0 2 139 BLC3 18,714 4 0 4 91 19,504 4 0 4 95 19,884 4 0 4 97 BLC4 19,327 5 0 5 94 20,143 5 0 5 98 20,535 5 0 5 100 RCCO 18,883 1 0 4 92 19,680 1 0 4 96 20,064 1 0 4 97 LCCO 18,883 1 0 4 92 19,680 1 0 4 96 20,064 1 0 4 97 AFR 27,457 4 0 4 133 28,616 4 0 4 139 29,174 4 0 4 142 P13 276W 60 1400 T1S 34,436 5 0 5 125 35,889 5 0 5 130 36,588 5 0 5 133 T2M 31,900 5 0 5 116 33,246 5 0 5 121 33,894 5 0 5 123 T3M 32,265 5 0 5 117 33,626 5 0 5 122 34,282 5 0 5 124 T3LG 28,826 4 0 4 105 30,042 4 0 4 109 30,628 4 0 4 111 T4M 32,746 5 0 5 119 34,128 5 0 5 124 34,793 5 0 5 126 T4LG 29,782 4 0 4 108 31,039 4 0 4 113 31,644 5 0 4 115 TFTM 32,978 5 0 5 120 34,369 5 0 5 125 35,039 5 0 5 127 T5M 33,692 5 0 4 122 35,113 5 0 4 127 35,797 5 0 4 130 T5W 34,238 5 0 4 124 35,682 5 0 4 129 36,378 5 0 4 132 T5LG 33,789 5 0 3 122 35,215 5 0 3 128 35,901 5 0 3 130 BLC3 23,471 5 0 5 85 24,461 5 0 5 89 24,937 5 0 5 90 BLC4 24,240 5 0 5 88 25,262 5 0 5 92 25,755 5 0 5 93 RCCO 23,683 1 0 4 86 24,682 1 0 4 89 25,163 1 0 4 91 LCCO 23,683 1 0 4 86 24,682 1 0 4 89 25,163 1 0 4 91 AFR 34,436 5 0 5 125 35,889 5 0 5 130 36,588 5 0 5 133 Lumen Output 186 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 9 of 10 COMMERCIAL OUTDOOR 2.73" 34.23" 14.26" 8.21" 2.73" 34.53" 14.26" 8.90" 2.73" 38.71" 14.26" 7.88" Dimensions DSX1 with RPA, RPA5, SPA5, SPA8N mount Weight: 36 lbs DSX1 with WBA mount Weight: 38 lbs DSX1 with MA mount Weight: 39 lbs 2.41" 3.16" SPA (STANDARD ARM) 2.41"3.16" RPA 2.41" 3.16" SPA8N 4.25" RPA5 4.25" SPA5 187 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 10 of 10 COMMERCIAL OUTDOOR nLight Control - Sensor Coverage and Settings nLight Sensor Coverage Pattern NLTAIR2 PIRHN Top Side FEATURES & SPECIFICATIONS INTENDED USE The sleek design of the D-Series Size 1 reflects the embedded high performance LED technology. It is ideal for many commercial and municipal applications, such as parking lots, plazas, campuses, and streetscapes. CONSTRUCTION Single-piece die-cast aluminum housing has integral heat sink fins to optimize thermal management through conductive and convective cooling. Modular design allows for ease of maintenance and future light engine upgrades. The LED drivers are mounted in direct contact with the casting to promote low operating temperature and long life. Housing driver compartment is completely sealed against moisture and environmental contaminants (IP66). Vibration rated per ANSI C136.31 for 3G for SPA and MA. 1.5G for mountings RPA, RPA5, SPA5 and SPA8N. Low EPA (0.69 ft2) for optimized pole wind loading. FINISH Exterior parts are protected by a zinc-infused Super Durable TGIC thermoset powder coat finish that provides superior resistance to corrosion and weather- ing. A tightly controlled multi-stage process ensures a minimum 3 mils thickness for a finish that can withstand extreme climate changes without cracking or peel- ing. Available in both textured and non-textured finishes. Coastal Construction (CCE) Optional corrosion resistant construction is engineered with added corrosion protection in materials and/or pre-treatment of base material under super durable paint. Provides additional corrosion protection for applications near coastal areas. Finish is salt spray tested to over 5,000 hours per ASTM B117 with scribe rating of 10. Additional lead-times may apply. OPTICS Precision-molded proprietary silicone lenses are engineered for superior area lighting distribution, uniformity, and pole spacing. Light engines are available in standard 3000 K, 4000 K and 5000 K (70 CRI) configurations. 80CRI configura- tions are also available. The D-Series Size 1 has zero uplight and qualifies as a Nighttime Friendly™ product, meaning it is consistent with the LEED® and Green Globes™ criteria for eliminating wasteful uplight. ELECTRICAL Light engine configurations consist of high-efficacy LEDs mounted to metal- core circuit boards to maximize heat dissipation and promote long life (up to L81/100,000 hours at 25°C). Class 1 electronic drivers are designed to have a power factor >90%, THD <20%, and an expected life of 100,000 hours with <1% failure rate. Easily serviceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). STANDARD CONTROLS The DSX1 LED area luminaire has a number of control options. DSX Size 1, comes standard with 0-10V dimming drivers. Dusk to dawn controls can be utilized via optional NEMA twist-lock photocell receptacles. Integrated motion sensor with on-board photocells feature field-adjustable programing and are suitable for mounting heights up to 40 feet. Control option BL features a bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output. nLIGHT AIR CONTROLS The DSX1 LED area luminaire is also available with nLight® AIR for the ultimate in wireless control. This powerful controls platform provides out-of-the-box basic motion sensing and photocontrol functionality and is suitable for mounting heights up to 40 feet. Once commissioned using a smartphone and the easy-to- use CLAIRITY app, nLight AIR equipped luminaries can be grouped, resulting in motion sensor and photocell group response without the need for additional equipment. Scheduled dimming with motion sensor over-ride can be achieved when used with the nLight Eclypse. Additional information about nLight Air can be found here. INSTALLATION Integral mounting arm allows for fast mounting using Lithonia standard #8 drill- ing and accommodates pole drilling's from 2.41 to 3.12" on center. The standard “SPA” option for square poles and the “RPA” option for round poles use the #8 drilling. For #5 pole drillings, use SPA5 or RPA5. Additional mountings are available including a wall bracket (WBA) and mast arm (MA) option that allows luminaire attachment to a 2 3/8” horizontal mast arm. LISTINGS UL listed to meet U.S. and Canadian standards. UL Listed for wet locations. Light engines are IP66 rated; luminaire is IP66 rated. Rated for -40°C minimum ambient. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/ QPL to confirm which versions are qualified. International Dark-Sky Association (IDA) Fixture Seal of Approval (FSA) is available for all products on this page utilizing 3000K color temperature only. BUY AMERICAN ACT Product with the BAA option is assembled in the USA and meets the Buy America(n) government procurement requirements under FAR, DFARS and DOT regulations. Please refer to www.acuitybrands.com/buy-american for additional information. WARRANTY 5-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. 188 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 1 of 10 COMMERCIAL OUTDOOR D-Series Size 2 LED Area Luminaire Specifications Catalog Number Notes Type Introduction The modern styling of the D-Series features a highly refined aesthetic that blends seamlessly with its environment. The D-Series offers the benefits of the latest in LED technology into a high performance, high efficacy, long-life luminaire. The outstanding photometric performance results in sites with excellent uniformity, greater pole spacing and lower power density. D-Series outstanding photometry aids in reducing the number of poles required in area lighting applications with typical energy savings of up to 80% vs. 1000W HID and expected service life of over 100,000 hours. EPA:1.06 ft2 (0.10 m2) Length:40.59"(103.1 cm) Width:16.76"(42.6 cm) Height H1:8.11"(20.6 cm) Height H2:3.96"(10.1 cm) Weight: 46 lbs (20.9 kg) Hit the Tab key or mouse over the page to see all interactive elements. Ordering Information EXAMPLE: DSX2 LED P7 40K 70CRI T3M MVOLT SPA NLTAIR2 PIRHN DDBXD DSX2 LED Series LEDs Color temperature 2 Color Rendering Index 2 Distribution Voltage Mounting DSX2 LED Forward optics P1 P5 P2 P6 P3 P7 P4 P8 Rotated optics P10 1 P13 1 P11 1 P14 1 P12 1 (this section 70CRI only) 30K 3000K 40K 4000K 50K 5000K (this section 80CRI only, extended lead times apply) 27K 2700K 30K 3000K 35K 3500K 40K 4000K 50K 5000K 70CRI 70CRI 70CRI 80CRI 80CRI 80CRI 80CRI 80CRI AFR Automotive front row T1S Type I short T2M Type II medium T3M Type III medium T3LG Type III low glare 3 T4M Type IV medium T4LG Type IV low glare 3 TFTM Forward throw medium T5M Type V medium T5LG Type V low glare T5W Type V wide BLC3 Type III backlight control 3 BLC4 Type IV backlight control 3 LCCO Left corner cutoff 3 RCCO Right corner cutoff 3 MVOLT (120V-277V) 4 HVOLT (347V-480V) 5,6 XVOLT (277V - 480V) 7,8 120 16, 26 208 16, 26 240 16, 26 277 16, 26 347 16, 26 480 16, 26 Shipped included SPA Square pole mounting (#8 drilling) RPA Round pole mounting (#8 drilling) SPA5 Square pole mounting #5 drilling 9 RPA5 Round pole mounting #5 drilling 9 SPA8N Square narrow pole mounting #8 drilling WBA Wall bracket 10 MA Mast arm adapter (mounts on 2 3/8" OD horizontal tenon) Control options Other options Finish (required) Shipped installed NLTAIR2 PIRHN nLight AIR gen 2 enabled with bi-level motion / ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc. 11, 12, 20, 21 PIR High/low, motion/ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc 13, 20, 21 PER NEMA twist-lock receptacle only (controls ordered separate) 14 PER5 Five-pin receptacle only (controls ordered separate) 14, 21 PER7 Seven-pin receptacle only (controls ordered separate) 14, 21 FAO Field adjustable output 15, 21 BL30 Bi-level switched dimming, 30% 16, 21 BL50 Bi-level switched dimming, 50% 16, 21 DMG 0-10v dimming wires pulled outside fixture (for use with an external control, ordered separately) 17 DS Dual switching 18, 19, 21 Shipped installed SPD20KV 20KV surge protection HS Houseside shield (black finish standard) 22 L90 Left rotated optics 1 R90 Right rotated optics 1 CCE Coastal Construction 23 HA 50°C ambient operation 24 BAA Buy America(n) Act Compliant SF Single fuse (120, 277, 347V) 26 DF Double fuse (208, 240, 480V) 26 3G Vibration rated for 3G 27 Shipped separately EGSR External Glare Shield (reversible, field install required, matches housing finish) BSDB Bird Spikes (field install required) DDBXD Dark Bronze DBLXD Black DNAXD Natural Aluminum DWHXD White DDBTXD Textured dark bronze DBLBXD Textured black DNATXD Textured natural aluminum DWHGXD Textured white L H2 H1 W Items marked by a shaded background qualify for the Design Select program and ship in 15 days or less. To learn more about Design Select, visit www.acuitybrands.com/designselect. *See ordering tree for detailsDesign Select options indicated by this color background. L H2 H1 W 189 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 2 of 10 COMMERCIAL OUTDOOR Drilling Top of Pole 0.563" 2.650" 1.325"0.400"(2 PLCS) Template #8 Tenon O.D. Mounting Single Unit 2 @ 180 2 @ 90 3 @ 90 3 @120 4 @ 90 2-3/8"RPA AS3-5 190 AS3-5 280 AS3-5 290 AS3-5 390 AS3-5 320 AS3-5 490 2-7/8"RPA AST25-190 AST25-280 AST25-290 AST25-390 AST25-320 AST25-490 4"RPA AST35-190 AST35-280 AST35-290 AST35-390 AST35-320 AST35-490 Tenon Mounting Slipfitter Ordering Information NOTES 1 Rotated optics available with packages P10, P11, P12, P13 and P14. Must be combined with option L90 or R90. 2 30K, 40K, and 50K available in 70CRI and 80CRI. 27K and 35K only available with 80CRI. Contact Technical Support for other possible combinations. 3 T3LG, T4LG, BLC3, BLC4, LCCO, RCCO not available with option HS. 4 MVOLT driver operates on any line voltage from 120-277V (50/60 Hz). 5 HVOLT driver operates on any line voltage from 347-480V (50/60 Hz). 6 HVOLT not available with package P10 when combined with option NLTAIR2 PIRHN or option PIR. 7 XVOLT operates with any voltage between 277V and 480V (50/60 Hz). 8 XVOLT not available in package P10. XVOLT not available with fusing (SF or DF). 9 SPA5 and RPA5 for use with #5 drilling only (Not for use with #8 drilling). 10 WBA cannot be combined with Type 5 distributions plus photocell (PER). 11 NLTAIR2 and PIRHN must be ordered together. For more information on nLight AIR2 visit this link 12 NLTAIR2 PIRHN not available with other controls including PIR, PER, PER5, PER7, FAO, BL30, BL50, DMG and DS. NLTAIR2 PIRHN not available with P10 using HVOLT. NLTAIR2 PIRHN not available with P10 using XVOLT. 13 PIR not available with NLTAIR2 PIRHN, PER, PER5, PER7, FAO BL30, BL50, DMG and DS. PIR not available with P10 using HVOLT. PIR not available with P10 using XVOLT. 14 14) PER/PER5/PER7 not available with NLTAIR2 PIRHN, PIR, BL30, BL50, FAO, DMG and DS. Photocell ordered and shipped as a separate line item from Acuity Brands Controls. See accessories. Shorting Cap included. 15 FAO not available with other dimming control options NLTAIR2 PIRHN, PIR, PER5, PER7, BL30, BL50, DMG and DS. 16 BL30 and BL50 are not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, FAO, DMG and DS. BL30 or BL50 must specify 120, 277 or 347V. Consult tech support for 208, 240 or 480V. 17 DMG not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DS. 18 DS not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DMG. 19 DS requires (2) separately switched circuits. DS provides 50/50 fixture operation via (2) different sets of leads on P1, P2, P3, P4, P5 (2 drivers). Note: Provides 60/40 operation using (2) different sets of leads on P6, P7, P8, P9, P10, P11, P12, P13, P14 (3 drivers). 20 Reference Motion Sensor Default Settings table on page 4 to see functionality. 21 Reference Controls Options table on page 4. 22 HS not available with T3LG, T4LG, BLC3, BLC4, LCCO and RCCO distribution. Also available as a separate accessory; see Accessories information. 23 CCE option not available with option BS and EGSR. Contact Technical Support for availability. 24 Option HA not available with performance packages P5, P6, P7, P8, P13 and P14. 25 Requires luminaire to be specified with PER, PER5 or PER7 option. See Controls Table on page 4. 26 Single fuse (SF) requires 120V, 277V, or 347V. Double fuse (DF) requires 208V, 240V or 480V. XVOLT not available with fusing (SF or DF). 27 Option 3G for use with (MA) mast arm mount only when 3G vibration is required. HANDHOLE ORIENTATION AHandhole B C D Fixture Quantity & Mounting Configuration Single DM19 2 @ 180 DM28 2 @ 90 DM29 3 @ 90 DM39 3 @ 120 DM32 4 @ 90 DM49 Mounting Type DSX2 with SPA 1.06 2.12 1.84 2.32 ---2.33 DSX2 with SPA5, SPA8N 1.07 2.14 1.90 2.43 ---2.44 DSX2 with RPA, RPA5 1.07 2.14 1.90 2.43 2.31 2.44 DSX2 with MA 1.20 2.40 2.12 3.00 2.92 3.00 DSX2 Area Luminaire - EPA *Includes luminaire and integral mounting arm. Other tenons, arms, brackets or other accessories are not included in this EPA data. Accessories Ordered and shipped separately. DLL127F 1.5 JU Photocell - SSL twist-lock (120-277V) 25 DLL347F 1.5 CUL JU Photocell - SSL twist-lock (347V) 25 DLL480F 1.5 CUL JU Photocell - SSL twist-lock (480V) 25 DSHORT SBK Shorting cap 25 DSX2HS P# House-side shield (enter package number 1-13 in place of #) DSXRPA (FINISH) Round pole adapter (#8 drilling, specify finish) DSXSPA5 (FINISH) Square pole adapter #5 drilling (specify finish) DSXRPA5 (FINISH) Round pole adapter #5 drilling (specify finish) DSX1EGSR (FINISH) External glare shield (specify finish) DSX2BSDB (FINISH) Bird spike deterrent bracket (specify finish) Shield Accessories External Glare Shield (EGSR)House Side Shield (HS) Minimum Acceptable Outside Pole Dimension SPA #8 3.5"3.5"3.5"3.5"3.5" RPA #8 3" 3" 3"3"3" 3" SPA5 #5 3" 3" 3"3"3" RPA5 #5 3" 3"3"3"3"3" SPA8N #8 3"3"3"3"3" Mounting Option Drilling Template Single 2 @ 180 2 @ 90 3 @ 90 3 @ 120 4 @ 90 Head Location Side B Side B & D Side B & C Side B, C & D Round Pole Only Side A, B, C & D Drill Nomenclature #8 DM19AS DM28AS DM29AS DM39AS DM32AS DM49AS 190 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 3 of 10 COMMERCIAL OUTDOOR To see complete photometric reports or download .ies files for this product, visit Lithonia Lighting’s homepage. Photometric Diagrams Isofootcandle plots for the DSX2 LED P8 40K 70CRI. Distances are in units of mounting height (40’). LEGEND 0.1 fc 0.5 fc 1.0 fc T1S T2M T3M 4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T3LG T4M TFTM T4LG T5M T5W T5LG AFR BLC3 BLC4 LCCO RCCO 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 191 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 4 of 10 COMMERCIAL OUTDOOR Performance Data Use these factors to determine relative lumen output for average ambient temperatures from 0-40°C (32-104°F). Lumen Ambient Temperature (LAT) Multipliers Ambient Lumen Multiplier 0°C 32°F 1.04 5°C 41°F 1.03 10°C 50°F 1.03 15°C 50°F 1.02 20°C 68°F 1.01 25°C 77°F 1.00 30°C 86°F 0.99 35°C 95°F 0.98 40°C 104°F 0.97 Current (A) Performance Package LED Count Drive Current (mA)Wattage 120V 208V 240V 277V 347V 480V Forward Optics (Non-Rotated) P1 80 530 135 1.12 0.65 0.56 0.49 0.39 0.28 P2 80 700 181 1.49 0.86 0.75 0.65 0.52 0.37 P3 80 850 222 1.83 1.05 0.91 0.79 0.63 0.46 P4 80 1050 277 2.27 1.31 1.14 0.98 0.79 0.57 P5 80 1250 333 2.72 1.57 1.36 1.18 0.94 0.68 P6 100 1050 345 2.85 1.64 1.42 1.23 0.98 0.71 P7 100 1250 414 3.41 1.97 1.70 1.48 1.18 0.85 P8 100 1400 466 3.85 2.22 1.93 1.67 1.33 0.96 Rotated Optics (Requires L90 or R90) P10 90 530 152 1.27 0.73 0.63 0.55 0.44 0.32 P11 90 700 203 1.69 0.97 0.84 0.73 0.58 0.42 P12 90 850 249 2.06 1.19 1.03 0.89 0.71 0.52 P13 90 1200 358 2.95 1.70 1.47 1.28 1.02 0.74 P14 90 1400 421 3.46 2.00 1.73 1.50 1.20 0.87 Electrical Load Motion Sensor Default Settings Option Unoccupied Dimmed Level High Level (when occupied)Phototcell Operation Dwell Time Ramp-up Time Dimming Fade Rate PIR 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min PIRHN 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min Controls Options Nomenclature Description Functionality Primary control device Notes FAO Field adjustable output device installed inside the luminaire; wired to the driver dimming leads.Allows the luminaire to be manually dimmed, effectively trimming the light output.FAO device Cannot be used with other controls options that need the 0-10V leads DS (not available on DSX0)Drivers wired independently for 50/50 luminaire operation The luminaire is wired to two separate circuits, allowing for 50/50 operation.Independently wired drivers Requires two separately switched circuits. Consider nLight AIR as a more cost effective alternative. PER5 or PER7 Twist-lock photocell receptacle Compatible with standard twist-lock photocells for dusk to dawn operation, or advanced control nodes that provide 0-10V dimming signals. Twist-lock photocells such as DLL Elite or advanced control nodes such as ROAM.Pins 4 & 5 to dimming leads on driver, Pins 6 & 7 are capped inside luminaire. Cannot be used with other controls options that need the 0-10V leads. PIR Motion sensor with integral photocell. Sensor suitable for 8’ to 40’ mounting height.Luminaires dim when no occupancy is detected.Acuity Controls rSBG Cannot be used with other controls options that need the 0-10V leads. NLTAIR2 PIRHN nLight AIR enabled luminaire for motion sensing, photocell and wireless communication.Motion and ambient light sensing with group response. Scheduled dimming with motion sensor over-ride when wirelessly connected to the nLight Eclypse. nLight Air rSBG nLight AIR sensors can be programmed and commissioned from the ground using the ClAIRity Pro app. Cannot be used with other controls options that need the 0-10V leads. BL30 or BL50 Integrated bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output BLC device provides input to 0-10V dimming leads on all drivers providing either 100% or dimmed (30% or 50%) control by a secondary circuit BLC UVOLT1 BLC device is powered off the 0-10V dimming leads, thus can be used with any input voltage from 120 to 480V 70 CRI 80CRI 90CRI Lumen Multiplier Availability Lumen Multiplier Availability Lumen Multiplier Availability 5000K 102%Standard 92%Extended lead-time 71%(see note) 4000K 100%Standard 92%Extended lead-time 67%(see note) 3500K 100%(see note)90%Extended lead-time 63%(see note) 3000K 96%Standard 87%Extended lead-time 61%(see note) 2700K 94%(see note)85%Extended lead-time 57%(see note) LED Color Temperature / Color Rendering Multipliers Note: Some LED types are available as per special request. Contact Technical Support for more information. Projected LED Lumen Maintenance Data references the extrapolated performance projections for the platforms noted in a 25°C ambient, based on 10,000 hours of LED testing (tested per IESNA LM-80-08 and projected per IESNA TM-21-11). To calculate LLF, use the lumen maintenance factor that corresponds to the desired number of operating hours below. For other lumen maintenance values, contact factory. Operating Hours Lumen Maintenance Factor 0 1.0025,000 0.95 50,000 0.90 100,000 0.82 *Note: Calculated values are based on original performance package data. When calculating new values for given FAO position, use published values for each package based on input watts and lumens by optic type. FAO Position % Wattage % Lumen Output 8 100%100% 7 93%95% 6 80%85% 5 66%73% 4 54%61% 3 41%49% 2 29%36% 1 15%20% FAO Dimming Settings 192 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 5 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P1 135W 80 530 T1S 19,946 2 0 3 148 20,787 2 0 3 155 21,192 2 0 3 158 T2M 18,477 3 0 4 137 19,256 3 0 4 143 19,632 3 0 4 146 T3M 18,691 3 0 5 139 19,480 3 0 5 145 19,859 3 0 5 148 T3LG 16,696 2 0 2 124 17,400 2 0 2 129 17,740 2 0 2 132 T4M 18,970 3 0 5 141 19,770 3 0 5 147 20,155 3 0 5 150 T4LG 17,253 2 0 2 128 17,981 2 0 2 134 18,331 2 0 2 136 TFTM 19,101 3 0 5 142 19,907 3 0 5 148 20,295 3 0 5 151 T5M 19,517 5 0 3 145 20,341 5 0 3 151 20,737 5 0 3 154 T5W 19,834 5 0 3 147 20,670 5 0 3 154 21,073 5 0 3 157 T5LG 19,574 4 0 2 146 20,400 4 0 2 152 20,797 4 0 2 155 BLC3 13,595 0 0 3 101 14,169 0 0 3 105 14,445 0 0 3 107 BLC4 14,042 0 0 4 104 14,634 0 0 4 109 14,919 0 0 4 111 RCCO 13,718 1 0 3 102 14,297 1 0 3 106 14,576 1 0 3 108 LCCO 13,718 1 0 3 102 14,297 1 0 3 106 14,576 1 0 3 108 AFR 19,946 2 0 3 148 20,787 2 0 3 155 21,192 2 0 3 158 P2 179W 80 700 T1S 25,520 3 0 3 142 26,597 3 0 3 148 27,116 3 0 3 151 T2M 23,641 3 0 5 132 24,638 3 0 5 137 25,118 3 0 5 140 T3M 23,915 3 0 5 133 24,924 3 0 5 139 25,410 3 0 5 142 T3LG 21,363 3 0 3 119 22,264 3 0 3 124 22,698 3 0 3 127 T4M 24,272 3 0 5 135 25,296 3 0 5 141 25,789 3 0 5 144 T4LG 22,075 3 0 3 123 23,006 3 0 3 128 23,455 3 0 3 131 TFTM 24,440 3 0 5 136 25,471 3 0 5 142 25,967 3 0 5 145 T5M 24,972 5 0 3 139 26,026 5 0 3 145 26,533 5 0 4 148 T5W 25,377 5 0 4 142 26,448 5 0 4 148 26,963 5 0 4 150 T5LG 25,045 4 0 2 140 26,101 4 0 2 146 26,610 4 0 2 148 BLC3 17,395 0 0 4 97 18,129 0 0 4 101 18,482 0 0 4 103 BLC4 17,966 0 0 4 100 18,724 0 0 5 104 19,089 0 0 5 107 RCCO 17,552 1 0 4 98 18,293 1 0 4 102 18,649 1 0 4 104 LCCO 17,552 1 0 4 98 18,293 1 0 4 102 18,649 1 0 4 104 AFR 25,520 3 0 3 142 26,597 3 0 3 148 27,116 3 0 3 151 P3 219W 80 850 T1S 30,127 3 0 4 137 31,398 3 0 4 143 32,010 3 0 4 146 T2M 27,908 3 0 5 127 29,085 3 0 5 133 29,652 3 0 5 135 T3M 28,232 3 0 5 129 29,423 3 0 5 134 29,996 3 0 5 137 T3LG 25,218 3 0 3 115 26,282 3 0 3 120 26,794 3 0 3 122 T4M 28,652 3 0 5 131 29,861 3 0 5 136 30,443 3 0 5 139 T4LG 26,059 3 0 3 119 27,159 3 0 3 124 27,688 3 0 3 126 TFTM 28,851 3 0 5 132 30,068 3 0 5 137 30,654 3 0 5 140 T5M 29,479 5 0 4 134 30,723 5 0 4 140 31,322 5 0 4 143 T5W 29,957 5 0 4 137 31,221 5 0 4 142 31,830 5 0 4 145 T5LG 29,565 4 0 2 135 30,812 5 0 2 140 31,413 5 0 2 143 BLC3 20,535 0 0 4 94 21,401 0 0 4 98 21,818 0 0 4 99 BLC4 21,209 0 0 5 97 22,104 0 0 5 101 22,534 0 0 5 103 RCCO 20,720 1 0 4 94 21,594 1 0 4 98 22,015 1 0 4 100 LCCO 20,720 1 0 4 94 21,594 1 0 4 98 22,015 1 0 4 100 AFR 30,127 3 0 4 137 31,398 3 0 4 143 32,010 3 0 4 146 P4 273W 80 1050 T1S 35,879 3 0 4 132 37,392 3 0 4 137 38,121 3 0 4 140 T2M 33,236 3 0 5 122 34,638 3 0 5 127 35,313 3 0 5 130 T3M 33,622 3 0 5 123 35,040 3 0 5 129 35,723 3 0 5 131 T3LG 30,033 3 0 4 110 31,300 3 0 4 115 31,910 3 0 4 117 T4M 34,123 3 0 5 125 35,562 3 0 5 130 36,255 3 0 5 133 T4LG 31,035 3 0 4 114 32,344 3 0 4 119 32,974 3 0 4 121 TFTM 34,359 3 0 5 126 35,808 3 0 5 131 36,506 3 0 5 134 T5M 35,108 5 0 4 129 36,589 5 0 4 134 37,302 5 0 4 137 T5W 35,677 5 0 4 131 37,182 5 0 5 136 37,907 5 0 5 139 T5LG 35,209 5 0 3 129 36,695 5 0 3 135 37,410 5 0 3 137 BLC3 24,456 0 0 4 90 25,487 0 0 4 93 25,984 0 0 5 95 BLC4 25,258 0 0 5 93 26,324 0 0 5 97 26,837 0 0 5 98 RCCO 24,676 1 0 4 91 25,717 1 0 4 94 26,218 1 0 4 96 LCCO 24,676 1 0 4 91 25,717 1 0 4 94 26,218 1 0 4 96 AFR 35,879 3 0 4 132 37,392 3 0 4 137 38,121 3 0 4 140 Lumen Output 193 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 6 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P5 327W 80 1250 T1S 41,149 3 0 4 126 42,885 3 0 4 131 43,721 3 0 4 134 T2M 38,118 4 0 5 117 39,727 4 0 5 122 40,501 4 0 5 124 T3M 38,561 3 0 5 118 40,187 3 0 5 123 40,971 3 0 5 125 T3LG 34,445 3 0 4 105 35,898 3 0 4 110 36,598 3 0 4 112 T4M 39,135 3 0 5 120 40,786 3 0 5 125 41,581 3 0 5 127 T4LG 35,594 3 0 4 109 37,095 3 0 4 114 37,818 3 0 4 116 TFTM 39,406 3 0 5 121 41,069 3 0 5 126 41,869 3 0 5 128 T5M 40,265 5 0 4 123 41,964 5 0 4 128 42,782 5 0 5 131 T5W 40,918 5 0 5 125 42,644 5 0 5 131 43,475 5 0 5 133 T5LG 40,382 5 0 3 124 42,085 5 0 3 129 42,906 5 0 3 131 BLC3 28,048 0 0 5 86 29,231 0 0 5 90 29,801 0 0 5 91 BLC4 28,969 0 0 5 89 30,191 0 0 5 92 30,779 0 0 5 94 RCCO 28,301 2 0 5 87 29,495 2 0 5 90 30,070 2 0 5 92 LCCO 28,301 2 0 5 87 29,495 2 0 5 90 30,070 2 0 5 92 AFR 41,149 3 0 4 126 42,885 3 0 4 131 43,721 3 0 4 134 P6 342W 100 1050 T1S 45,968 3 0 4 135 47,907 3 0 5 140 48,841 3 0 5 143 T2M 42,582 4 0 5 125 44,379 4 0 5 130 45,244 4 0 5 132 T3M 43,076 4 0 5 126 44,894 4 0 5 131 45,769 4 0 5 134 T3LG 38,479 3 0 4 113 40,102 3 0 4 117 40,884 3 0 4 120 T4M 43,719 4 0 5 128 45,563 4 0 5 133 46,451 4 0 5 136 T4LG 39,762 3 0 4 116 41,439 3 0 4 121 42,247 3 0 4 124 TFTM 44,021 3 0 5 129 45,878 4 0 5 134 46,772 4 0 5 137 T5M 44,980 5 0 5 132 46,878 5 0 5 137 47,792 5 0 5 140 T5W 45,710 5 0 5 134 47,638 5 0 5 139 48,566 5 0 5 142 T5LG 45,111 5 0 3 132 47,014 5 0 3 138 47,930 5 0 3 140 BLC3 31,333 0 0 5 92 32,655 0 0 5 96 33,291 0 0 5 97 BLC4 32,361 0 0 5 95 33,726 0 0 5 99 34,384 0 0 5 101 RCCO 31,615 2 0 5 93 32,949 2 0 5 96 33,591 2 0 5 98 LCCO 31,615 2 0 5 93 32,949 2 0 5 96 33,591 2 0 5 98 AFR 45,968 3 0 4 135 47,907 3 0 5 140 48,841 3 0 5 143 P7 409W 100 1250 T1S 52,692 3 0 5 129 54,915 3 0 5 134 55,986 3 0 5 137 T2M 48,811 4 0 5 119 50,871 4 0 5 124 51,862 4 0 5 127 T3M 49,378 4 0 5 121 51,461 4 0 5 126 52,464 4 0 5 128 T3LG 44,107 3 0 4 108 45,968 3 0 4 112 46,864 3 0 5 115 T4M 50,114 4 0 5 122 52,228 4 0 5 128 53,246 4 0 5 130 T4LG 45,579 3 0 4 111 47,501 3 0 4 116 48,427 3 0 4 118 TFTM 50,460 4 0 5 123 52,589 4 0 5 129 53,614 4 0 5 131 T5M 51,560 5 0 5 126 53,735 5 0 5 131 54,783 5 0 5 134 T5W 52,396 5 0 5 128 54,607 5 0 5 133 55,671 5 0 5 136 T5LG 51,710 5 0 4 126 53,891 5 0 4 132 54,941 5 0 4 134 BLC3 35,916 1 0 5 88 37,431 1 0 5 91 38,161 1 0 5 93 BLC4 37,095 0 0 5 91 38,660 0 0 5 94 39,413 0 0 5 96 RCCO 36,240 2 0 5 89 37,769 2 0 5 92 38,505 2 0 5 94 LCCO 36,240 2 0 5 89 37,769 2 0 5 92 38,505 2 0 5 94 AFR 52,692 3 0 5 129 54,915 3 0 5 134 55,986 3 0 5 137 P8 462W 100 1400 T1S 57,662 3 0 5 125 60,094 4 0 5 130 61,266 4 0 5 132 T2M 53,415 4 0 5 116 55,668 4 0 5 120 56,753 4 0 5 123 T3M 54,034 4 0 5 117 56,314 4 0 5 122 57,412 4 0 5 124 T3LG 48,267 3 0 5 104 50,304 3 0 5 109 51,284 4 0 5 111 T4M 54,840 4 0 5 119 57,154 4 0 5 124 58,268 4 0 5 126 T4LG 49,877 3 0 5 108 51,981 3 0 5 112 52,994 3 0 5 115 TFTM 55,219 4 0 5 119 57,549 4 0 5 124 58,671 4 0 5 127 T5M 56,423 5 0 5 122 58,803 5 0 5 127 59,949 5 0 5 130 T5W 57,338 5 0 5 124 59,757 5 0 5 129 60,921 5 0 5 132 T5LG 56,586 5 0 4 122 58,974 5 0 4 128 60,123 5 0 4 130 BLC3 39,303 1 0 5 85 40,962 1 0 5 89 41,760 1 0 5 90 BLC4 40,593 0 0 5 88 42,306 0 0 5 91 43,130 0 0 5 93 RCCO 39,658 2 0 5 86 41,331 2 0 5 89 42,137 2 0 5 91 LCCO 39,658 2 0 5 86 41,331 2 0 5 89 42,137 2 0 5 91 AFR 57,662 3 0 5 125 60,094 4 0 5 130 61,266 4 0 5 132 Lumen Output 194 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 7 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P10 152W 90 530 T1S 22,798 4 0 4 150 23,760 4 0 4 156 24,223 4 0 4 159 T2M 21,119 5 0 5 139 22,010 5 0 5 145 22,439 5 0 5 148 T3M 21,361 5 0 5 141 22,262 5 0 5 147 22,696 5 0 5 149 T3LG 19,084 4 0 4 126 19,889 4 0 4 131 20,277 4 0 4 133 T4M 21,679 5 0 5 143 22,594 5 0 5 149 23,034 5 0 5 152 T4LG 19,717 4 0 4 130 20,549 4 0 4 135 20,950 4 0 4 138 TFTM 21,833 5 0 5 144 22,754 5 0 5 150 23,197 5 0 5 153 T5M 22,305 5 0 3 147 23,246 5 0 3 153 23,699 5 0 3 156 T5W 22,667 5 0 3 149 23,623 5 0 4 155 24,084 5 0 4 158 T5LG 22,370 4 0 2 147 23,314 4 0 2 153 23,768 4 0 2 156 BLC3 15,539 4 0 4 102 16,194 4 0 4 107 16,510 4 0 4 109 BLC4 16,048 4 0 4 106 16,725 4 0 4 110 17,051 4 0 4 112 RCCO 15,679 1 0 3 103 16,340 1 0 3 108 16,659 1 0 3 110 LCCO 15,679 1 0 3 103 16,340 1 0 3 108 16,659 1 0 3 110 AFR 22,798 4 0 4 150 23,760 4 0 4 156 24,223 4 0 4 159 P11 203W 90 700 T1S 29,222 4 0 4 144 30,455 4 0 4 150 31,048 4 0 4 153 T2M 27,070 5 0 5 134 28,212 5 0 5 139 28,762 5 0 5 142 T3M 27,380 5 0 5 135 28,535 5 0 5 141 29,091 5 0 5 144 T3LG 24,462 4 0 4 121 25,493 4 0 4 126 25,990 4 0 4 128 T4M 27,788 5 0 5 137 28,960 5 0 5 143 29,525 5 0 5 146 T4LG 25,273 4 0 4 125 26,339 4 0 4 130 26,853 4 0 4 133 TFTM 27,985 5 0 5 138 29,165 5 0 5 144 29,734 5 0 5 147 T5M 28,591 5 0 4 141 29,797 5 0 4 147 30,377 5 0 4 150 T5W 29,054 5 0 4 143 30,280 5 0 4 149 30,870 5 0 4 152 T5LG 28,673 4 0 2 142 29,883 4 0 2 148 30,465 5 0 2 150 BLC3 19,917 4 0 4 98 20,757 4 0 4 102 21,162 4 0 4 104 BLC4 20,570 5 0 5 102 21,437 5 0 5 106 21,855 5 0 5 108 RCCO 20,097 1 0 4 99 20,945 1 0 4 103 21,353 1 0 4 105 LCCO 20,097 1 0 4 99 20,945 1 0 4 103 21,353 1 0 4 105 AFR 29,222 4 0 4 144 30,455 4 0 4 150 31,048 4 0 4 153 P12 248W 90 850 T1S 34,526 5 0 5 139 35,983 5 0 5 145 36,684 5 0 5 148 T2M 31,984 5 0 5 129 33,333 5 0 5 135 33,983 5 0 5 137 T3M 32,350 5 0 5 131 33,715 5 0 5 136 34,372 5 0 5 139 T3LG 28,902 4 0 4 117 30,121 4 0 4 122 30,708 4 0 4 124 T4M 32,832 5 0 5 133 34,217 5 0 5 138 34,884 5 0 5 141 T4LG 29,861 4 0 4 121 31,120 4 0 4 126 31,727 5 0 4 128 TFTM 33,064 5 0 5 134 34,459 5 0 5 139 35,131 5 0 5 142 T5M 33,780 5 0 4 136 35,205 5 0 4 142 35,891 5 0 4 145 T5W 34,327 5 0 4 139 35,776 5 0 4 145 36,473 5 0 4 147 T5LG 33,878 5 0 3 137 35,307 5 0 3 143 35,995 5 0 3 145 BLC3 23,532 5 0 5 95 24,525 5 0 5 99 25,003 5 0 5 101 BLC4 24,303 5 0 5 98 25,328 5 0 5 102 25,822 5 0 5 104 RCCO 23,745 1 0 4 96 24,747 1 0 4 100 25,229 1 0 4 102 LCCO 23,745 1 0 4 96 24,747 1 0 4 100 25,229 1 0 4 102 AFR 34,526 5 0 5 139 35,983 5 0 5 145 36,684 5 0 5 148 Lumen Output 195 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 8 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P13 354W 90 1200 T1S 45,748 5 0 5 129 47,678 5 0 5 135 48,608 5 0 5 137 T2M 42,380 5 0 5 120 44,168 5 0 5 125 45,029 5 0 5 127 T3M 42,865 5 0 5 121 44,673 5 0 5 126 45,544 5 0 5 129 T3LG 38,296 5 0 5 108 39,911 5 0 5 113 40,689 5 0 5 115 T4M 43,503 5 0 5 123 45,339 5 0 5 128 46,222 5 0 5 131 T4LG 39,566 5 0 5 112 41,235 5 0 5 117 42,039 5 0 5 119 TFTM 43,811 5 0 5 124 45,659 5 0 5 129 46,549 5 0 5 132 T5M 44,760 5 0 5 126 46,648 5 0 5 132 47,557 5 0 5 134 T5W 45,485 5 0 5 129 47,404 5 0 5 134 48,328 5 0 5 137 T5LG 44,889 5 0 3 127 46,783 5 0 3 132 47,695 5 0 3 135 BLC3 31,181 5 0 5 88 32,496 5 0 5 92 33,130 5 0 5 94 BLC4 32,202 5 0 5 91 33,561 5 0 5 95 34,215 5 0 5 97 RCCO 31,463 2 0 5 89 32,790 2 0 5 93 33,429 2 0 5 94 LCCO 31,463 2 0 5 89 32,790 2 0 5 93 33,429 2 0 5 94 AFR 45,748 5 0 5 129 47,678 5 0 5 135 48,608 5 0 5 137 P14 415W 90 1400 T1S 51,272 5 0 5 123 53,435 5 0 5 129 54,476 5 0 5 131 T2M 47,497 5 0 5 114 49,500 5 0 5 119 50,465 5 0 5 121 T3M 48,040 5 0 5 116 50,067 5 0 5 121 51,043 5 0 5 123 T3LG 42,919 5 0 5 103 44,730 5 0 5 108 45,602 5 0 5 110 T4M 48,756 5 0 5 117 50,813 5 0 5 122 51,803 5 0 5 125 T4LG 44,343 5 0 5 107 46,214 5 0 5 111 47,115 5 0 5 113 TFTM 49,101 5 0 5 118 51,172 5 0 5 123 52,169 5 0 5 126 T5M 50,164 5 0 5 121 52,280 5 0 5 126 53,299 5 0 5 128 T5W 50,977 5 0 5 123 53,127 5 0 5 128 54,163 5 0 5 130 T5LG 50,309 5 0 4 121 52,432 5 0 4 126 53,453 5 0 4 129 BLC3 34,945 5 0 5 84 36,420 5 0 5 88 37,130 5 0 5 89 BLC4 36,090 5 0 5 87 37,613 5 0 5 91 38,346 5 0 5 92 RCCO 35,261 2 0 5 85 36,749 2 0 5 88 37,465 2 0 5 90 LCCO 35,261 2 0 5 85 36,749 2 0 5 88 37,465 2 0 5 90 AFR 51,272 5 0 5 123 53,435 5 0 5 129 54,476 5 0 5 131 Lumen Output 196 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 9 of 10 COMMERCIAL OUTDOOR 42.11" 3.96" 16.76" 8.44" 42.41" 3.96" 16.75" 8.90" 46.59" 3.96" 16.76" 8.23" Dimensions DSX2 with RPA, RPA5, SPA5, SPA8N mount Weight: 48 lbs DSX2 with WBA mount Weight: 50 lbs DSX2 with MA mount Weight: 50 lbs 2.41" 3.16" SPA (STANDARD ARM) 2.41"3.16" RPA 2.41" 3.16" SPA8N 4.25" RPA5 4.25" SPA5 197 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 10 of 10 COMMERCIAL OUTDOOR FEATURES & SPECIFICATIONS INTENDED USE The sleek design of the D-Series Area Size 2 reflects the embedded high performance LED technology. It is ideal for applications like car dealerships and large parking lots adjacent to malls, transit stations, grocery stores, home centers, and other big-box retailers. CONSTRUCTION Single-piece die-cast aluminum housing has integral heat sink fins to optimize thermal management through conductive and convective cooling. Modular design allows for ease of maintenance and future light engine upgrades. The LED drivers are mounted in direct contact with the casting to promote low operating temperature and long life. Housing driver compartment is completely sealed against moisture and environmental contaminants (IP66). Vibration rated per ANSI C136.31 for 1.5G. 3G vibration rated available for (MA) mast arm mount when specifying option 3G. Low EPA (1.06 ft2) for optimized pole wind loading. FINISH Exterior parts are protected by a zinc-infused Super Durable TGIC thermoset powder coat finish that provides superior resistance to corrosion and weathering. A tightly controlled multi-stage process ensures a minimum 3 mils thickness for a finish that can withstand extreme climate changes without cracking or peeling. Available in both textured and non-textured finishes. Coastal Construction (CCE) Optional corrosion resistant construction is engineered with added corrosion protection in materials and/or pre-treatment of base material under super durable paint. Provides additional corrosion protection for applications near coastal areas. Finish is salt spray tested to over 5,000 hours per ASTM B117 with scribe rating of 10. Additional lead-times may apply. OPTICS Precision-molded proprietary silicone lenses are engineered for superior area lighting distribution, uniformity, and pole spacing. Light engines are available in 3000 K, 4000 K, or 5000 K (70 CRI) configurations. 80CRI configurations are also available. The D-Series Size 2 has zero uplight and qualifies as a Nighttime Friendly™ product, meaning it is consistent with the LEED® and Green Globes™ criteria for eliminating wasteful uplight. ELECTRICAL Light engine configurations consist of high-efficacy LEDs mounted to metal-core circuit boards to maximize heat dissipation and promote long life (up to L82/100,000 hrs at 25°C). Class 1 electronic drivers are designed to have a power factor >90%, THD <20%, and an expected life of 100,000 hours with <1% failure rate. Easily- serviceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). INSTALLATION Integral mounting arm allows for fast mounting using Lithonia standard #8 drilling and accommodates pole drilling’s from 2.41 to 3.12" on center. The standard “SPA” option for square poles and the “RPA” option for round poles use the #8 drilling. For #5 pole drillings, use SPA5 or RPA5. Additional mountings are available including a wall bracket (WBA) and mast arm (MA) option that allows luminaire attachment to a 2 3/8" horizontal mast arm. STANDARD CONTROLS The DSX2 LED area luminaire has a number of control options. DSX Size 2, comes standard with 0-10V dimming drivers. Dusk to dawn controls can be utilized via optional NEMA twist-lock photocell receptacles. Integrated motion sensor with on- board photocells feature field-adjustable programing and are suitable for mounting heights up to 40 feet. Control option BL features a bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output. nLIGHT AIR CONTROLS The DSX2 LED area luminaire is also available with nLight® AIR for the ultimate in wireless control. This powerful controls platform provides out-of-the-box basic motion sensing and photocontrol functionality and is suitable for mounting heights up to 40 feet. Once commissioned using a smartphone and the easy-to-use CLAIRITY app, nLight AIR equipped luminaries can be grouped, resulting in motion sensor and photocell group response without the need for additional equipment. Scheduled dimming with motion sensor over-ride can be achieved when used with the nLight Eclypse. Additional information about nLight Air can be found here. LISTINGS UL listed to meet U.S. and Canadian standards. UL Listed for wet locations. Light engines are IP66 rated; luminaire is IP66 rated. Rated for -40°C minimum ambient. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/ QPL to confirm which versions are qualified. International Dark-Sky Association (IDA) Fixture Seal of Approval (FSA) is available for all products on this page utilizing 3000K color temperature only. BUY AMERICAN ACT Product with the BAA option is assembled in the USA and meets the Buy America(n) government procurement requirements under FAR, DFARS and DOT regulations. Please refer to www.acuitybrands.com/buy-american for additional information. WARRANTY 5-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. nLight Control - Sensor Coverage and Settings nLight Sensor Coverage Pattern NLTAIR2 PIRHN Top Side 198 FRAME SHED 90'FRAME BUILDING METAL SILO CONC. SILO METAL SHED METAL BARN FRAME BARN METAL SHED 31' 104' 94' 184' 184' #2016 STORM INLET RIM=597.90 IE 4" CPP N=593.67 IE 12" RCP W=592.67 #2041 STORM INLET RIM=597.47 IE 4" CPP N=592.87 IE 12" RCP S=591.87 BOTTOM=589.47 #2040 STORM INLET RIM=597.42 IE 4" CPP S=UNABLE TO MEASURE IE 12" RCP N,W=591.84 BOTTOM=589.42 #2055 STORM INLET RIM=597.78 IE 4" CPP N=594.33 IE 12" RCP W=591.83 #2110 STORM INLET RIM=597.65 IE 4" CPP N=591.65 IE 12" RCP E,W=590.75 BOTTOM=590.15 #2130 STORM INLET RIM=597.00 IE 4" CPP N=593.05 IE 12" RCP W=591.95 #1240 STORM INLET RIM=596.34 NO VISIBLE PIPES ON FIELD WORK DATED 08/15/2022 #2109 INLET RIM=592.82 IE 12" RCP W=591.37 BOTTOM=590.22 #1094#1108 #1142 STORM INLET RIM=596.26 IE 4" CPP N=592.06 IE 12" RCP E=590.66 IE 12" RCP W=590.36 BOTTOM=588.01 #1261 STORM INLET RIM=596.94 IE 12" RCP W=590.44 IE 12" RCP E=591.44 IE 4" RCP N=592.14 BOTTOM=589.24 #1293 STORM MH RIM=597.81 IE 36" RCP N,S=589.01 IE 12" RCP NE=589.66 #1292 STORM INLET RIM=597.62 IE 4" CPP N=594.17 IE 12" RCP E,SW=589.78 BOTTOM=588.92 #1391 STORM INLET RIM=597.72 IE 4" CPP S=591.92 IE 12" RCP E=590.52 IE 12" RCP W=590.22 BOTTOM=588.22 #1429 STORM MH RIM=597.40 IE 12" RCP NE=589.90 IE 36" RCP N,S=589.17 BOTTOM=590.15 #1422 STORM INLET RIM=597.49 IE 4" CPP W=591.69 IE 12" RCP N=590.09 IE 12" RCP E,SW=589.69 BOTTOM=588.69 #1449 STORM INLET RIM=597.52 IE 4" CPP N=592.42 IE 4" CPP E=592.12 IE 12" RCP S=591.17 BOTTOM=589.92 #1953 STORM INLET RIM=599.15 IE 4" CPP N=595.20 IE 12" RCP W=594.10 #1883 WATER VALVE VAULT RIM=601.15 UNABLE TO OPEN ON FIELD WORK DATED 08/15/2022 #1644 STORM INLET RIM=597.90 IE 4" CPP N=UNABLE TO MEASURE IE 12" RCP E=592.10 IE 12" RCP W=590.95 BOTTOM=589.25 #2225 INLET RIM=591.85 IE 8" PVC N=587.97 IE 12" RCP S=587.87 IE 6" PVC NW=587.97 #1934 STORM INLET RIM=599.83 IE 4" CPP N=595.63 IE 12" RCP W=594.59 #1882 STORM INLET RIM=601.11 IE 4" CPP N=597.31 IE 12" RCP W=595.98 #1415 STORM INLET RIM=597.96 IE 12" RCP E,W=590.78 BOTTOM=588.36 #2237 STORM INLET RIM=598.52 IE 12" RCP W=593.42 #1902 STORM INLET RIM=600.47 IE 4" CPP N=596.37 IE 12" RCP W=595.25 #1881 WATER VALVE VAULT RIM=599.75 TP 10" WM=594.77 #1754 STORM INLET RIM=601.09 IE 4" CPP N=594.39 IE 12" RCP E,W=593.80 BOTTOM=591.54 #1545 STORM INLET RIM=599.85 IE 4" CPP N=595.10 IE 12" RCP NW=593.22 IE 12" RCP E=593.45 BOTTOM=590.65 #1592 STORM INLET RIM=599.12 IE 4" CPP NW=593.42 IE 12" RCP E=592.37 IE 12" RCP SW=591.60 BOTTOM=590.12 #1788 STORM MH RIM=602.00 IE 24" RCP N,S=594.24 IE 12" RCP NE=596.35 #1512 STORM INLET RIM=600.51 IE 4" CPP N=594.16 IE 12" RCP E=593.91 IE 12" RCP W=592.86 BOTTOM=591.01 #1542 STORM MH RIM=600.16 IE 24" RCP N,S=591.46 IE 12" RCP SE=593.11 #1627 STORM INLET RIM=598.54 IE 4" CPP N=593.19 IE 12" RCP E=592.09 IE 12" RCP W=591.84 BOTTOM=588.54 #1789 STORM INLET RIM=601.77 IE 4" CPP N=598.37 IE 12" RCP SW=596.37 IE 12" RCP E=597.47 BOTTOM=594.04 #1555 INLET RIM=600.11 IE 12" RCP E=593.96 IE 12" RCP W=593.66 BOTTOM=591.41 #1594 STORM MH RIM=599.82 IE 24" RCP N=590.82 IE 12" RCP NE=591.62 IE 36" RCP S=590.82 15" FES IE=595.46 15" FES IE=595.82 24" FES IE=598.44 24" FES IE=598.35 12" FES IE=599.03 12" FES IE=599.39 #1540 STORM INLET RIM=597.30 APPROXIMATE LINE PER ATLASEXI S T I N G BUI L D I N G EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDINGEXIS TI N G BUIL DI N G POOL CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.GRAV E L 595600594596597598599 595595595595592592 592 592593 593593593 593593594594594 594594594594596 596597 597 595600596597598599601602 602602601600601600600600600 6 0 0 6 00599599599 5996016016016016016016026025955956006006006005965965965975975975975975975975975985985985985985985985985995995995995995995955965975985955955 9 5 595595595595595594594596596596597597597598598598599599599599595595595595594594596597597597597597598595 59559559 5 595595 595592 592 593593 593 593 594594594594EDGE OF TREESFIR 5/8 FCCFCC FIP FCC FCC FIR 5/8 BENT FIR 5/8 YLW CAP FIR 5/8 CAP.YLW FIR_CAP.2IN FIR_CAP.2IN_IDOT FIR_5/8_CAP.YLW FIR_5/8_CAP.YLW FIR_5/8 FIR_5/8 BENTFIP_1.5 FCC FIR_5/8 FIR_5/8 FCC FCC_TC FIR_5/8.CAP.YLW 10' P.U.E. N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9W. LINE OF THE NW 1/4 OF SEC. 27-36-9EXCEPT I O NEXCEPTIONP.O.B. EXCEPTION 69.30' (N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)(S01° 55' 33"E)(S88°04'27"W)(S01°55'33"E)(258.88')70.99'N01°50'58"W 1313.63'(N01° 51' 07"W)(1313.81')HERETOFORE CONVEYED TO IDOT PER DOC. R20110317241.20' N & 0.18' E 0.43' SONLINEONLINE0.10' N0.91' N & 0.20' WHERETOFORE DEDICATED PER DOC. 463161AT CORNER AT CORNER 14.28' NE 14.75' SE 18.78' ELY 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'TEMPORARY CONSTRUCTION EASEMENT PER DOC. R2011-31724 21.93' SE IL RTE 59275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY AT CORNER S88°54'06"W 1248.03'N01°55'23"W 258.85'N88°04'37"E 5.00'N01°55'23"W 747.00'S88°04'37"W 5.00'N01°55'23"W 307.78'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 LOT 1 666.17' 666.17'SHEET 2SHEET 106-03-27-101-007-0000 SCHLUETER MARK W 23850 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-006-0000 SCHIMPF JAMES E KAY F 23860 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-005-0000 MOGUR CHRISTOPHER A IWONA 23910 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-004-0000 LOWE MICHAEL REV TRUST 23920 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-003-0000 OSTREGA JOSEPH MARY A 23930 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-002-0000 RAFACZ EDWARD A JR 23940 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-001-0000 BOBB ROBERT J LINDA S 23946 W PLAINSMAN CIR PLAINFIELD, IL 60586 ZONED R-1 ZONED A-1 (WILL COUNTY) 06-03-22-300-003-0000 MUNICIPAL LIMITS S01°55'23"E 1313.42'EXISTING IMPROVEMENTS TO BE DEMOLISHED EXISTING IMPROVEMENTS TO BE DEMOLISHED SHEET 2SHEET 1SCM 20' SIDE SETBACK LINE 60 FOOT TRANSITIONAL YARD30' FRONT SETBACK LINE30' REAR SETBACK LINE15' SIDE SETBACK LINE 30' FRONT SETBACK LINE30' FRONT SETBACK LINENORTHWEST CORNER OF PLAINSMAN TERRACE SUBDIVISION BLANKET SHARED ACCESS EASEMENT OVER ALL OF AREA 1 HEREBY GRANTED S89°58'36"W 128.15'N01°04'46"W 545.12'N88°55'14"E 64.00'S01°04'46"E 190.98'A=70.69' R=45.00'CB=S4 6 °0 4'51"E 58.08'STORMWATER MANAGEMENT EASEMENT HEREBY GRANTED BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANREVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4160' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 ASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. BENCHMARK SOURCE: NGS MONUMENT STATION DESIGNATION: DP5474 ESTABLISHED BY: PATRICK ENGINEERING DATE: 2013-12-13 ELEVATION: 595.99 (PUBLISHED AND HELD) DATUM: NAVD88 DESCRIPTION: TO REACH THE STATION FROM THE SOUTH JUNCTION OF US HIGHWAY 38 WITH STATE HIGHWAY 59 IN PLAINFIELD, IL, GO SOUTH ON STATE HIGHWAY 59 FOR 2.2 MI (3.5 KM)TO ROLF ROAD AND THE STATION ON THE RIGHT. THE STATION IS LOCATED 5 FT {1.5 M)WEST OF THE EDGE OF PAVEMENT OF STATE HIGHWAY 59, 298 FT (90.8 M)SOUTH OF A TELEPHONE PEDESTAL AND 215 FT (65.5 M)NORTH OF A 'SOUTH IL 59' SIGN. SITE: STATION DESIGNATION: SBM#1 ESTABLISHED BY: V3 COMPANIES DATE: 08-15-22 ELEVATION: 602.52 (MEASURED) DATUM: NAVD88 DESCRIPTION: NW TAG BOLT ON FIRE HYDRANT SOUTH OF COMED RIGHT OF WAY, NEAR NORTHWEST CORNER OF SITE. STATION DESIGNATION: SBM#2 ESTABLISHED BY: V3 COMPANIES DATE: 08-15-22 ELEVATION: 597.18 (MEASURED) DATUM: NAVD88 DESCRIPTION: FOUND CUT CROSS ON WATER VALVE VAULT LID SOUTH OF COMED ROW NEAR NORTHEAST CORNER OF SITE. THE ELEVATIONS ABOVE WERE KNOWN TO BE ACCURATE AT THE TIME THEY WERE ESTABLISHED. V3 DOES NOT CERTIFY TO THE ACCURACY THEREAFTER, NOR ASSUMES RESPONSIBILITY FOR THE MIS-USE OR MIS-INTERPRETATION OF THE INFORMATION SHOWN HEREON. IT IS ADVISED THAT ALL OF THE ABOVE ELEVATIONS BE CHECKED BETWEEN EACH OTHER AND VERIFY A MINIMUM OF 3 SURROUNDING UTILITY RIM ELEVATIONS AND ANY ADJACENT BUILDING FINISHED FLOOR OR TOP OF FOUNDATION ELEVATIONS SHOWN HEREON PRIOR TO USE OR COMMENCEMENT OF ANY CONSTRUCTION OR OTHER WORK. PERSONS USING THIS INFORMATION ARE TO CONTACT V3 IMMEDIATELY WITH ANY DISCREPANCIES FOUND PRIOR TO THE START OF ANY WORK. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; NOTES 1.THIS PROPERTY IS ZONED R-1, LOW DENSITY SINGLE-FAMILY RESIDENTIAL DISTRICT, PER 2022 VILLAGE OF PLAINFIELD ZONING MAP. 2.EXISTING IMPROVEMENTS AND TOPOGRAPHY (SHOWN IN GRAY) ARE PAR ALTA/NSPS LAND TITLE AND TOPOGRAPHY SURVEY PREPARED BY V3, DATED AUGUST 31, 2022 3.ONCE THE PLAT SHOWN HEREON IS RECORDED AND UPON COMPLETION OF CONSTRUCTION, 3/4" IRON PIPES WITH PLASTIC CAPS SHALL BE SET AT ALL LOT CORNERS AND CHANGES IN GEOMETRY, UNLESS SHOWN OTHERWISE. VICINITY MAP NOT TO SCALE SITE OWNER ENGINEER/SURVEYOR Montibus Land Partners LLC 640 Pasquinelli Dr Westmont, IL 60559 847-727-6700 V3 Companies, Ltd. 7325 Janes Avenue, Suite 100 Woodridge, Illinois 60517 630.724.9200 DEVELOPER Kelly Construction 245 E Sydney Ct Villa Park, IL 601811 sean@kelly.com c/o John Crane cranezoo@aol.com 630-833-5600 AREA LOT 1 871,200 SQ. FT. 20.0000 ACRES LOT 2 2,929,361 SQ. FT. 67.2489 ACRES TOTAL 3,800,561 SQ. FT.87.2489 ACRES 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 199 #1422 WATER VALVE VAULT RIM=595.33 TP E, W WM=589.63 UNABLE TO MEASURE SIZE ON FIELD WORK DATED 08/15/2022 18" FES IE=588.60 15" CPP IE=588.10 EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING E X I S T I N G B U I L D I N G EXISTINGBUILDINGEXISTINGBUILDINGEXISTING BUILDING POOL595 5 9 5593593594 594594592 593 594 595 59559 5 5 9 5 595595592592 593 593593593 593 594594594594 59 4 59 4 594 5 94 59459559559459559359359459459 4 595 591592592 592 593 593 593 594 594 594 590591 592 593 5905905915 9 1 591 591591591592 592 5 9 2 593593593594594591 592 592 592 593 594 594FIR_5/8 FIP_3/4 FIP_3/4 FIR_5/8 FIR_5/8 FIP_1 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8.BENT 35' DRAINAGE EASEMENT 10' UTILITY EASEMENT 20' DRAINAGE EASEMENTN. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE 1/4 OF THE NW 1/4 OF SEC. 27-36-9 EXCEPT I O N 0.35' S AT CORNERAT CORNERAT CORNERAT CORNER AT CORNER 0.13' W 0.12' N 0.06' EON LINE0.11' N0.30' S 0.11' EN01°54'18"W 328.07'N88°55'12"E 2569.29'10' UTILITY EASEMENTLOT 2 581.86' 1903.12'SHEET 2SHEET 1SHEET 3SHEET 220' DRAINAGE EASEMENT STORMWATER MANAGEMENT EASEMENT HEREBY GRANTED 06-03-27-101-017-0000 OWNER: WALDRON GARY L JANET M 16963 S PLAINSMAN CT PLAINFIELD, IL 60544 06-03-27-101-018-0000 OWNER: RICKMON LAURIE B 23648 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-019-0000 OWNER: KOZAK DONALD A CATHY L 23754 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-020-0000 OWNER: MCLAUGHLIN MICHAEL R 23744 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-021-0000 OWNER: PIRC RAYMOND LOIS 23734 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-014-0000 OWNER: SAXEN ADAM 16943 S PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-013-0000 OWNER: PANTKE DAVID 16933 S PLAINSMAN CT PLAINFIELD, IL 60586 06-03-27-101-012-0000 OWNER: GASIENCIA MARCIN K 16923 S PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-011-0000 OWNER: OKREY TIMOTHY W SHERRIL 23810W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-010-0000 OWNER: HAMBURG FREDERIC S 23830 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-009-0000 MCNAMARA THOMAS J MCNAMARA CHRISTINE 23834 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-008-0000 WINTER CHARLES R JR 23840 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-007-0000 SCHLUETER MARK W 23850 W PLAINSMAN CIR PLAINFIELD, IL 60586 ZONED R-1 SHEET 2SHEET 1275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYZONED A-1 (WILL COUNTY) 06-03-22-300-004-0000 06-03-22-300-003-0000 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 MUNICIPAL LIMITS SHEET 3SHEET 2N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9 ZONED R-1 15' SIDE SETBACK LINE 20' SIDE SETBACK LINE 20' SIDE SETBACK LINEA NORTHEAST CORNER OF PLAINSMAN TERRACE SUBDIVISION PROPOSED DETENTION BASIN HWL 595.3 NWL 590.3 AREA 6.72 ACRES VOLUME 30.08 AC-FT N88°56'29"E 1041.49'S00°02'46"E59.05'S62°4 7' 0 6 " W 5 9 2. 7 4' S89°58'36"W 489.25' REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4260' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 200 597.18 FCC WVV EDGE OF TREES#1024 WATER VALVE VAULT RIM=597.18 TP 12" WM=591.53 EXISTINGBUILDING590590590595595589591591591592592592593593593594594594 596596596 596590590590590595595595588588588588589589589589591591591591592592 5 9 2 592 592592592593593 593593593593593 594 594594594 5945945945 9 6 596590 590589589589589591592593594590590 590590595595591591592592593593594594596596596596590 590 591592597 597591591 592593594590589589591592593594590595591592593594596FIR_5/8.CAP.ORG 27NQX FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 STORMWATER RETENTION & DRAINAGE EASEMENT DRAINAGE EASEMENT E. LINE OF THE NW 1/4 OF SEC. 27-36-9AT CORNER 0.18' W 2.98' W AT CORNER AT CORNER AT CORNER AT CORNERLIMITS OF "ZONE A" AS SCALED FROMFIRM MAP PANEL NO. 17197C0130GLIMITS OF 0.2% ANNUAL CHANCE FLOOD HAZARD N. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE 1/4 OF THE NW 1/4 OF SEC. 27-36-9 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY S88°52'50"W 1318.30'S01°49'00"E 1640.35'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 LOT 2SHEET 3SHEET 2 06-03-27-200-014-0010OWNER: PLAINFIELD TWP PRK DIST 23729 W OTTAWA ST PLAINFIELD, IL 60544 06-03-27-200-015-0000OWNER: LOKE WAI LENG VANCINA GUY 16850 S LILY CACHE RD PLAINFIELD, IL 60586 06-03-27-200-013-0000 OWNER: HAYES BERNARD ROSEMARY 14501 MERCURY DR GRAND HAVEN, MI 49417 768.41' 06-03-27-101-024-0000 OWNER: NARINE SUKHRAM DEBORAH 23630 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-023-0000 OWNER: RIOLA DALE J 23644 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-033-0000 OWNER: BOISDORF DAVID JUDITH 23710 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-032-0000 OWNER: RIOLA DALE J 23644 W ROLF RD PLAINFIELD, IL 60586 ZONED R-1 ZONED R-1 ZONED A-1 (WILL COUNTY) 06-03-22-300-004-0000 MUNICIPAL LIMITS SHEET 3SHEET 2EXCEPT I O N SCM 15' SIDE SETBACK LINE 20' SIDE SETBACK LINE 30' REAR SETBACK LINENORTHEAST CORNER OF PLAINSMAN TERRACE SUBDIVISION REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4360' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 201 CHRIS T O PHER D. BA R T OSZWOODR I DGE , I L L INOIS#3189 PROFESSIONAL LAND SURVEYOR STATE OF ILLINOIS CERTIFICATE AS TO SPECIAL ASSESSMENTS STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) , ______________________________, TREASURER OF THE VILLAGE OF PLAINFIELD DO HEREBY CERTIFY THAT THERE ARE NO DELINQUENT OR UNPAID CURRENT OR FORFEITED SPECIAL ASSESSMENTS OR ANY DEFERRED INSTALLMENTS THEREOF THAT HAVE BEEN APPORTIONED AGAINST THE TRACT OF LAND INCLUDED IN THE PLAT. DATED IN PLAINFIELD, WILL COUNTY, ILLINOIS, THIS _____ DAY OF _________________, 20____. ______________________________ (TREASURER) PLANNING COMMISSION CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) I, _____________________________, CHAIRMAN OF THE VILLAGE OF PLAINFIELD PLAN COMMISSION DO HEREBY CERTIFY THAT ON THIS ____ DAY OF _________________A.D., _______, THIS PLAT OF SUBDIVISION WAS DULY APPROVED BY THE PLAN COMMISSION OF THE VILLAGE OF PLAINFIELD. ______________________________ (CHAIRMAN) BOARD OF TRUSTEES CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) APPROVED AND ACCEPTED BY THE BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL COUNTY, ILLINOIS. THIS ____ DAY OF ________________ A.D., ________. ATTEST: ______________________ BY: ________________________ (VILLAGE PRESIDENT) WILL COUNTY RECORDER'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) THIS INSTRUMENT ________________________________, WAS FILED FOR RECORD IN THE RECORDER'S OFFICE OF WILL COUNTY, ILLINOIS, ON THE _____ DAY OF _______________ A.D., _______________, AT ________ O'CLOCK __.M., AND WAS RECORDED IN BOOK ______ OF PLATS ON PAGE _______. ________________________________ (RECORDER OF DEEDS) WILL COUNTY CLERK'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) I, ___________________________________, COUNTY CLERK OF WILL COUNTY, ILLINOIS, DO HEREBY CERTIFY THAT THERE ARE NO DELINQUENT GENERAL TAXES, NO UNPAID CURRENT TAXES, NO UNPAID FORFEITED TAXES, AND NO REDEEMABLE TAX SALES AGAINST ANY OF THE LAND INCLUDED IN THE ANNEXED PLAT. I FURTHER CERTIFY THAT I HAVE RECEIVED ALL STATUTORY FEES IN CONNECTION WITH THE ANNEXED PLAT. THIS _____ DAY OF ______________ A.D., ________, _________________________________ (COUNTY CLERK) WILL COUNTY TAX MAPPING CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) I, _______________________________, DIRECTOR OF TAX MAPPING AND PLATTING OFFICE DO HEREBY CERTIFY THAT I HAVE CHECKED THE PROPERTY DESCRIPTION ON THIS PLAT AGAINST AVAILABLE COUNTY RECORDS AND FIND SAID DESCRIPTION TO BE TRUE AND CORRECT. THERE PROPERTY HEREIN DESCRIBED IS LOCATED ON TAX MAP # ________________ AND IS IDENTIFIED AS PERMANENT REAL ESTATES TAX INDEX NUMBER (PIN): _______________ DATED THIS _____ DAY OF _____________ A.D., _________. _________________________________ (DIRECTOR) SURVEYOR'S CERTIFICATE CERTIFICATE OF COUNTY HIGHWAY STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) APPROVED THIS _______ DAY OF ___________________ A.D., 20____ AS TO ROADWAY ACCESS TO COUNTY HIGHWAY _________________________________ ALSO KNOWN AS _________________________________. ____________________________________ WILL COUNTY ENGINEER PART OF SECTION 9, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, NORTH OF THE INDIAN BOUNDARY LINE, IN WILL COUNTY, ILLINOIS. STATE OF ILLINOIS ) ) SS COUNTY OF DUPAGE ) THIS IS TO CERTIFY THAT I, CHRISTOPHER D. BARTOSZ, ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 3188, HAVE SURVEYED AND SUBDIVIDED THE FOLLOWING DESCRIBED PROPERTY: THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, EXCEPTING THEREFROM THAT PART FALLING SOUTH OF THE NORTH LINE OF LOTS 14 THROUGH 24, AND SAID LINE EXTENDED WEST TO THE SECTION LINE, AND LYING SOUTH OF THE NORTH LINE OF LOTS 8 THROUGH 1, AND SAID LINE EXTENDED EAST TO THE QUARTER SECTION LINE, SAID LOTS FALLING IN PLAINSMAN TERRACE, A SUBDIVISION IN PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED NOVEMBER 26, 1975 AS DOCUMENT NO. R75-32760 AND ALSO EXCEPT THAT PART OF ILLINOIS ROUTE 59 DEDICATED AND CONVEYED PER DOCUMENT NO. 463161, BOOK 776, PAGE 343, IN WILL COUNTY, ILLINOIS; EXCEPT THAT PART CONVEYED TO THE DEPARTMENT OF TRANSPORTATION OF THE STATE OF ILLINOIS, FOR AND ON BEHALF OF THE PEOPLE OF THE STATE OF ILLINOIS, BY AGREED FINAL JUDGMENT ORDER FILED UNDER CASE NO. 06ED38, RECORDED MARCH 28, 2011 AS DOCUMENT NO. R2011031724, DESCRIBED AS FOLLOWS: THAT PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN WILL COUNTY, ILLINOIS, DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHWEST CORNER OF THE NORTHWEST QUARTER OF SAID SECTION 27; THENCE ON AN ASSUMED BEARING OF NORTH 88 DEGREES 55 MINUTES 06 SECONDS EAST ALONG THE NORTH LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27, A DISTANCE OF 69.30 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 307.91 FEET; THENCE NORTH 88 DEGREES 04 MINUTES 27 SECONDS EAST, A DISTANCE OF 5.00 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 747.00 FEET; THENCE SOUTH 88 DEGREES 04 MINUTES 27 SECONDS WEST, A DISTANCE OF 5.00 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 258.88 FEET TO THE NORTH LINE OF LOT 24 IN PLAINSMAN TERRACE, BEING A SUBDIVISION OF PART OF THE NORTHWEST QUARTER OF SAID SECTION 27, ACCORDING TO THE PLAT THEREOF RECORDED NOVEMBER 26, 1975 AS DOCUMENT NUMBER R75-32760; THENCE SOUTH 88 DEGREES 53 MINUTES 19 SECONDS WEST ALONG THE NORTH LINE OF LOT 24 IN SAID PLAINSMAN TERRACE AND THE WESTERLY EXTENSION THEREOF, A DISTANCE OF 70.99 FEET TO THE WEST LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27; THENCE NORTH 1 DEGREE 51 MINUTES 07 SECONDS WEST ALONG THE WEST LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27, A DISTANCE OF 1313.81 FEET TO THE POINT OF BEGINNING. I FURTHER CERTIFY THAT THIS LAND IS WITHIN THE CORPORATE LIMITS OF A MUNICIPALITY WHICH HAS AUTHORIZED A COMPREHENSIVE PLAN AND IS EXERCISING THE SPECIAL POWERS AUTHORIZED BY DIVISION 12 OF ARTICLE 11 OF THE ILLINOIS MUNICIPAL CODE, AS NOW OR HEREAFTER AMENDED. I FURTHER CERTIFY THAT THE ANNEXED PLAT IS A CORRECT REPRESENTATION OF SAID SURVEY AND SUBDIVISION. ALL DISTANCES ARE SHOWN IN FEET AND DECIMALS THEREOF. PERMANENT MONUMENTS WILL BE SET AT ALL LOT CORNERS, EXCEPT WHERE CONCRETE MONUMENTS ARE INDICATED. I FURTHER CERTIFY THAT PART OF THIS PROPERTY IS IN AN AREA OF MINIMAL FLOODING (ZONE X), PART IS IN SPECIAL FLOOD HAZARD (ZONE A) AND PART IS IN 0.2% ANNUAL CHANCE FLOOD HAZARD (ZONE X) AS DEFINED BY AS DEFINED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY'S FLOOD INSURANCE RATE MAP OF WILL COUNTY, ILLINOIS COMMUNITY PANEL NO. 17197C0130G, EFFECTIVE DATE 02/15/2019. DATED THIS 27TH DAY OF FEBRUARY , A.D., 2023 . ________________________________________________ CHRISTOPHER D. BARTOSZ ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 35-3189 MY LICENSE EXPIRES ON NOVEMBER 30, 2024. V3 COMPANIES OF ILLINOIS, LTD. PROFESSIONAL DESIGN FIRM NO. 184000902 THIS DESIGN FIRM NUMBER EXPIRES APRIL 30, 2025. cdbartosz@v3co.com DESIGNATION TO RECORD STATE OF ILLINOIS ) ) SS COUNTY OF DUPAGE ) I, CHRISTOPHER D. BARTOSZ, AN ILLINOIS PROFESSION LAND SURVEYOR, IN ACCORDANCE WITH THE PLAT ACT (765ICLS205/2) DO HEREBY DESIGNATE THE VILLAGE CLERK OF THE VILLAGE OF PLAINFIELD TO RECORD THIS PLAT. THE REPRESENTATIVE SHALL PROVIDE THE SURVEYOR WITH A RECORDED COPY OF THIS PLAT. THIS 27TH DAY OF FEBRUARY , A.D., 2023 . ______________________________________ CHRISTOPHER D. BARTOSZ ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 035-003188 MY LICENSE EXPIRES ON NOVEMBER 30, 2024. OWNER'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF ________ ) THIS IS TO CERTIFY THAT THE UNDERSIGNED IS THE OWNER OF THE LAND DESCRIBED IN THE ANNEXED PLAT, AND HAS CAUSED THE SAME TO BE SURVEYED AND SUBDIVIDED, AS INDICATED THEREON, FOR THE USES AND PURPOSES THEREIN SET FORTH, AND DOES HEREBY ACKNOWLEDGE AND ADOPT THE SAME UNDER THE STYLE AND TITLE THEREON INDICATED. DATED THIS _____ DAY OF ______________, 20____. ___________________________________ ___________________________________ (TITLE) __________________________________ (ADDRESS) NOTARY CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________) I, _________________________, A NOTARY PUBLIC IN AND FOR SAID COUNTY, IN THE STATE AFORESAID, DO HEREBY CERTIFY THAT ________________________________, IS PERSONALLY KNOWN TO ME TO BE THE SAME PERSONS WHOSE NAMES ARE SUBSCRIBED TO THE FOREGOING INSTRUMENT AS SUCH OWNERS, APPEARED BEFORE ME THIS DAY IN PERSON AND ACKNOWLEDGED THAT THEY SIGN THE ANNEXED PLAT AS THEIR OWN FREE AND VOLUNTARY ACT FOR USES AND PURPOSES THEREIN SET FORTH. GIVEN UNDER MY HAND AND NOTARIAL SEAL THIS _____ DAY OF _____________, 20____. _______________________________________ (NOTARY PUBLIC) MY COMMISSION EXPIRES _______________ I.D.O.T. CERTIFICATE THIS PLAT HAS BEEN APPROVED BY THE ILLINOIS DEPARTMENT OF TRANSPORTATION WITH RESPECT TO ROADWAY ACCESS PURSUANT TO SECTION 2 OF "AN ACT TO REVISE THE LAW IN RELATION TO PLATS," AS AMENDED. A PLAN THAT MEETS THE REQUIREMENTS CONTAINED IN THE DEPARTMENT'S "POLICY ON PERMITS FOR ACCESS DRIVEWAYS TO STATE HIGHWAYS" WILL BE REQUIRED BY THE DEPARTMENT. ________________________________________________________________ DISTRICT ENGINEER DATE REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 44N/A HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2CHRISTOPHER D. BA R T OSZWOODRIDGE , I L LINOIS#3189 PROFESSIONAL LAND SURVEYOR STATE OF ILLINOIS STORMWATER MANAGEMENT EASEMENT PROVISIONS A NON-EXCLUSIVE EASEMENT IS HEREBY RESERVED FOR AND GRANTED WITHIN THE AREAS SO DESIGNATED ON THE PLAT AND MARKED STORMWATER MANAGEMENT EASEMENT (SME) FOR THE COLLECTION CONVEYANCE AND STORAGE OF STORMWATER IN AREAS TO BE MAINTAINED BY THE OWNER OF THE LOT(S) OR OUTLOT(S) ON WHICH THE FACILITIES EXIST IN ACCORDANCE WITH MUNICIPAL ORDINANCES AND THE APPROVED FINAL ENGINEERING IMPROVEMENT PLANS. TOGETHER WITH THE RIGHT OF ACCESS THERETO FOR THE PERSONNEL AND EQUIPMENT NECESSARY AND REQUIRED FOR SUCH USES AND PURPOSES, AND TOGETHER WITH THE RIGHT TO CUT, TRIM, OR REMOVE TREES, BUSHES AND ROOTS AS MAY BE REASONABLY REQUIRED INCIDENTAL TO THE RIGHTS HEREIN GIVEN, AND THE RIGHT TO ENTER UPON THE HOME FOR ALL SUCH PURPOSES. ENCROACHMENT OF ANY KIND INCLUDING LANDSCAPING, FENCES, SHEDS OR ACCESSORY STRUCTURES WITHIN SAID EASEMENT IS PROHIBITED UNLESS THE MUNICIPAL ENGINEER HAS DETERMINED SAID ENCROACHMENT WILL NOT INTERFERE WITH THE PROPER FUNCTION OF SAID FACILITIES. THE VILLAGE SHALL HAVE THE RIGHT, BUT NOT THE OBLIGATION, TO ENTER WITH PERSONNEL AND EQUIPMENT UPON SAID EASEMENT AT ANY TIME FOR THE PURPOSES OF ACCESS TO AND INSPECTION OF THE STORMWATER MANAGEMENT FACILITIES LOCATED WITHIN SAID EASEMENT. IF THE OWNER FAILS TO MAINTAIN SAID FACILITIES AND, AFTER RECEIPT OF NOTICE FROM THE VILLAGE OF SAID FAILURE, THE OWNER FAILS TO MAKE REQUIRED REPAIRS IN A REASONABLE PERIOD OF TIME, THE VILLAGE MAY MAKE THE REQUIRED REPAIRS AND SEEK REIMBURSEMENT FROM THE OWNER FOR THE COSTS INCURRED BY THE VILLAGE TO MAKE THE REPAIR AND/OR FILE A LIEN ON THE HOME. SURFACE WATER STATEMENT STATE OF ILLINOIS ) ) SS COUNTY OF _________) TO THE BEST OF OUR KNOWLEDGE AND BELIEF THE DRAINAGE OF SURFACE WATERS WILL NOT BE CHANGED BY THE CONSTRUCTION OF SUCH SUBDIVISION OR ANY PART THEREOF, OR, THAT IF SUCH SURFACE WATER DRAINAGE WILL BE CHANGED, ADEQUATE PROVISION HAS BEEN MADE FOR COLLECTION AND DIVERSION OF SUCH SURFACE WATERS INTO PUBLIC AREAS, OR DRAINS WHICH THE SUBDIVISION HAS A RIGHT TO USE, AND THAT SUCH SURFACE WATERS WILL NOT BE DEPOSITED ON THE PROPERTY OF ADJOINING LAND OWNERS IN SUCH CONCENTRATIONS AS MAY CAUSE DAMAGE TO THE ADJOINING PROPERTY BECAUSE OF THE CONSTRUCTION OF THE SUBDIVISION. DATED THIS ______ DAY OF _______________, 20___. ______________________________________ _______________________________________ IL REGISTERED PROFESSIONAL ENGINEER OWNER BY: ____________________________________ ITS: ____________________________________ MORTGAGEE'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________ ) ________________________________________________________________ AS MORTGAGEE OF THE ABOVE DESCRIBED PROPERTY, HEREBY CERTIFIES THAT IT GRANTS APPROVAL FOR SAID PROPERTY TO BE SURVEYED AND SUBDIVIDED AS SHOWN HEREON. DATED THIS ________ DAY OF ____________________ A.D., 20____. ATTEST: ______________________________BY: ______________________________ NOTARY CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________ ) I, _________________________, A NOTARY PUBLIC IN AND FOR SAID COUNTY, IN THE STATE AFORESAID, DO HEREBY CERTIFY THAT ____________________ AND ____________________ OF SAID CORPORATION, PERSONALLY KNOWN TO ME TO BE THE SAME PERSONS WHOSE NAMES ARE SUBSCRIBED TO THE FOREGOING INSTRUMENT, APPEARED BEFORE ME THIS DAY IN PERSON AND ACKNOWLEDGED THAT THEY SIGNED AND DELIVERED THIS INSTRUMENT AS THEIR OWN FREE AND VOLUNTARY ACT AND AS THE FREE AND VOLUNTARY ACT OF SAID CORPORATION, AS GIVEN UNDER MY HAND AND NOTARIAL SEAL, THIS ________ DAY OF ____________________ A.D., 20____. MY COMMISSION EXPIRES. ________________ ________________________________________ NOTARY EASEMENT PROVISION AN EASEMENT FOR SERVING THE SUBDIVISION AND OTHER PROPERTY WITH ELECTRIC AND COMMUNICATIONS SERVICE IS HEREBY RESERVED FOR AND GRANTED TO COMMONWEALTH EDISON COMPANY AND ILLINOIS BELL TELEPHONE COMPANY (AT&T), GRANTEES, THEIR RESPECTIVE SUCCESSORS AND ASSIGNS, JOINTLY AND SEVERALLY, TO INSTALL, OPERATE, MAINTAIN AND REMOVE, FROM TIME TO TIME, FACILITIES USED IN CONNECTION WITH OVERHEAD AND UNDERGROUND TRANSMISSION AND DISTRIBUTION OF ELECTRICITY AND SOUNDS AND SIGNALS IN, OVER, UNDER, ACROSS, ALONG AND UPON THE SURFACE OF THE PROPERTY SHOWN WITHIN THE DOTTED LINES ON THE PLAT AND MARKED "EASEMENT". THE PROPERTY DESIGNATED IN THE DECLARATION OF CONDOMINIUM AND/OR ON THIS PLAT AS "COMMON ELEMENTS," AND THE PROPERTY DESIGNATED ON THE PLAT AS A "COMMON AREA OR AREAS," AND THE PROPERTY DESIGNATED ON THE PLAT FOR STREETS AND ALLEYS, WHETHER PUBLIC OR PRIVATE, TOGETHER WITH THE RIGHT TO INSTALL REQUIRED SERVICE CONNECTIONS OVER OR UNDER THE SURFACE OF EACH LOT AND COMMON AREA OR AREAS TO SERVE IMPROVEMENTS THEREON, OR ON ADJACENT LOTS, AND COMMON AREA OR AREAS, THE RIGHT TO CUT, TRIM OR REMOVE TREES, BUSHES AND ROOTS AS MAY BE REASONABLE REQUIRED INCIDENT TO THE RIGHTS HEREIN GIVE, AND THE RIGHT TO ENTER UPON THE SUBDIVIDED PROPERTY FOR ALL SUCH PURPOSES. OBSTRUCTIONS SHALL NOT BE PLACED OVER GRANTEES' FACILITIES OR IN, UPON OR OVER THE PROPERTY WITHIN THE DOTTED LINES MARKED "EASEMENT" WITHOUT THE PRIOR WRITTEN CONSENT OF GRANTEES. AFTER INSTALLATION OF ANY SUCH FACILITIES, THE GRADE OF THE SUBDIVIDED PROPERTY SHALL NOT BE ALTERED IN A MANNER SO AS TO INTERFERE WITH THE PROPER OPERATION AND MAINTENANCE THEREOF. THE TERM "COMMON ELEMENTS" SHALL HAVE THE MEANING SET FORTH FOR SUCH TERM IN THE "CONDOMINIUM PROPERTY", CHAPTER 765 ILCS 605/2(E), AS AMENDED FROM TIME TO TIME. THE TERM "COMMON AREA OR AREAS" IS DEFINED AS A LOT, PARCEL OR AREA OF REAL PROPERTY, THE BENEFICIAL USE AND ENJOYMENT OF WHICH IS RESERVED IN WHOLE AS AN APPURTENANCE TO THE SEPARATELY OWNED LOTS, PARCELS OR AREAS WITHIN THE PLANNED DEVELOPMENT, EVEN THOUGH SUCH BE OTHERWISE DESIGNATED ON THE LOT BY TERMS SUCH AS, "OUTLOTS", "COMMON ELEMENTS", "OPEN SPACE", "OPEN AREA," "COMMON GROUND," "PARKING AND COMMON AREA". THE TERMS "COMMON AREA OR AREAS" AND "COMMON ELEMENTS" INCLUDES REAL PROPERTY SURFACED WITH INTERIOR DRIVEWAYS AND WALKWAYS, BUT EXCLUDES REAL PROPERTY PHYSICALLY OCCUPIED BY A BUILDING, SERVICE BUSINESS DISTRICT OR STRUCTURES SUCH AS A POOL OR RETENTION POND, OR MECHANICAL EQUIPMENT.RELOCATION OF FACILITIES WILL BE DONE BY GRANTEES AT COST OF GRANTOR/LOT OWNER, UPON WRITTEN REQUEST. AN EASEMENT IS HEREBY RESERVED FOR AND GRANTED TO THE NORTHERN ILLINOIS GAS COMPANY, ITS SUCCESSORS AND ASSIGNS ("NI-GAS") TO INSTALL, OPERATE, MAINTAIN, REPAIR, REPLACE AND REMOVE, FACILITIES USED IN CONNECTION WITH THE TRANSMISSION AND DISTRIBUTION OF NATURAL GAS IN, OVER, UNDER, ACROSS, ALONG AND UPON THE SURFACE OF THE PROPERTY SHOWN ON THIS PLAT MARKED "EASEMENT", "COMMON AREA OR AREAS" AND STREETS AND ALLEYS, WHETHER PUBLIC OR PRIVATE, AND THE PROPERTY DESIGNATED IN THE DECLARATION OF CONDOMINIUM AND/OR ON THIS PLAT AS "COMMON ELEMENTS", TOGETHER WITH THE RIGHT TO INSTALL REQUIRED SERVICE CONNECTIONS OVER OR UNDER THE SURFACE OF EACH LOT AND COMMON AREA OR AREAS TO SERVE IMPROVEMENTS THEREON, OR ON ADJACENT LOTS, AND COMMON AREA OR AREAS, AND TO SERVE OTHER PROPERTY, ADJACENT OR OTHERWISE, AND THE RIGHT TO REMOVE OBSTRUCTIONS, INCLUDING BUT NOT LIMITED TO, TREES, BUSHES, ROOTS AND FENCES, AS MAY BE REASONABLY REQUIRED INCIDENT TO THE RIGHTS HEREIN GIVEN, AND THE RIGHT TO ENTER UPON THE PROPERTY FOR ALL SUCH PURPOSES. OBSTRUCTIONS SHALL NOT BE PLACED OVER NI-GAS' FACILITIES OR IN, UPON OR OVER THE PROPERTY IDENTIFIED ON THIS PLAT FOR UTILITY PURPOSES WITHOUT THE PRIOR WRITTEN CONSENT OF NI-GAS. AFTER INSTALLATION OF ANY SUCH FACILITIES, THE GRADE OF THE PROPERTY SHALL NOT BE ALTERED IN A MANNER SO AS TO INTERFERE WITH THE PROPER OPERATION AND MAINTENANCE THEREOF. THE TERM "COMMON ELEMENTS" SHALL HAVE THAT MEANING SET FORTH FOR SUCH TERM IN SECTION 605/2(E) OF THE "CONDOMINIUM PROPERTY ACT" (ILLINOIS COMPILED STATUTES, CH. 765, SEC. 605/2(E)), AS AMENDED FROM TIME TO TIME. THE TERM "COMMON AREA OR AREAS" IS DEFINED AS A LOT, PARCEL OR AREA OF REAL PROPERTY, INCLUDING REAL PROPERTY SURFACED WITH INTERIOR DRIVEWAYS AND WALKWAYS, THE BENEFICIAL USE AND ENJOYMENT OF WHICH IS RESERVED IN WHOLE AS AN APPURTENANCE TO THE SEPARATELY OWNED LOTS, PARCELS OR AREAS WITHIN THE PROPERTY, EVEN THOUGH SUCH AREAS MAY BE DESIGNATED ON THIS PLAT BY OTHER TERMS. A PERMANENT NONEXCLUSIVE EASEMENT IS HEREBY RESERVED FOR AND GRANTED TO THE VILLAGE OF PLAINFIELD, ILLINOIS AND TO ITS SUCCESSORS AND ASSIGNS, IN, UPON, ACROSS, OVER, UNDER, AND THROUGH THE AREAS SHOWN BY DASHED LINES AND LABELED "EASEMENTS" ON THE ATTACHED PLAT OF SUBDIVISION FOR THE PURPOSE OF INSTALLING, CONSTRUCTING, INSPECTING, OPERATING, REPLACING, RENEWING, ALTERING, ENLARGING, REMOVING, REPAIRING, CLEANING AND MAINTAINING STORM AND FLOOD WATER CHANNELS, BASINS, SEWERS, STORM SEWERS AND SANITARY SEWERS, WATER TRANSMISSION MAINS AND LINES, VALVE VAULTS AND HYDRANTS, AND ANY AND ALL MANHOLES, HYDRANTS, PIPES, CONNECTIONS, CATCH BASINS, BUFFALO BOXES AND WITHOUT LIMITATION, SUCH OTHER STRUCTURES AND APPURTENANCES AS MAY BE NECESSARY FOR CONVENIENT FOR THE FURNISHING OF PUBLIC UTILITY SERVICES, TOGETHER WITH THE RIGHT OF INGRESS AND EGRESS ACROSS AND THROUGH THE EASEMENTS FOR PERSONS AND EQUIPMENT TO DO ANY OR ALL OF THE ABOVE WORK. THE RIGHT IS ALSO HEREBY GRANTED TO THE VILLAGE TO CUT DOWN, TRIM OR REMOVE ANY TREES, SHRUBS OR OTHER PLANTS ON THE EASEMENTS AS WELL AS REMOVE ANY OTHER FENCE OR STRUCTURE THAT INTERFERE WITH THE OPERATION OF THE ABOVE OR WITH THE EXERCISE OF ANY RIGHTS UNDER THIS PARAGRAPH. ALL THE EASEMENTS INDICATED SHALL BE PERPETUAL, EXCEPT THOSE IDENTIFIED AS "TEMPORARY." THE EASEMENT AREAS SHOWN AS DETENTION OR RETENTION EASEMENTS SHALL INCLUDE, IN ADDITION TO THE ABOVE RIGHTS, THE RIGHT TO FLOOD SUCH AREA WITH STORM WATERS, AND SHALL ALSO INCLUDE THE RIGHT TO INSTALL AND MAINTAIN STORM WATER DETENTION AND RETENTION STRUCTURES. NO FENCES, STRUCTURES OR TREES SHALL BE PLACED IN EASEMENTS LABELED "EMERGENCY OVERLAND RELEASE ROUTES." SCHOOL DISTRICT BOUNDARY STATEMENT BEING DULY SWORN, UPON HIS/HER OATH DEPOSES AND STATES AS FOLLOWS: 1. THE OWNER OF THE PROPERTY LEGALLY DESCRIBED ON THIS PLAT OF SUBDIVISION, WHICH HAS BEEN SUBMITTED TO THE VILLAGE OF PLAINFIELD FOR APPROVAL, WHICH LEGAL DESCRIPTION IS INCORPORATED HEREIN BY REFERENCE AND 2. TO THE BEST OF THE OWNER'S KNOWLEDGE, THE SCHOOL DISTRICT IN WHICH TRACT, PARCEL, LOT OR BLOCK OF THE PROPOSED SUBDIVISION LIES IS LOCATED IN: PLAINFIELD COMMUNITY CONSOLIDATED SCHOOL DISTRICT 202 500 W. FORT BEGGS DRIVE PLAINFIELD, ILLINOIS 60544 DATED THIS ______ DAY OF _______________ A.D., 20____. BY: ______________________________ATTEST: ___________________________ (SIGNATURE)(SIGNATURE} TITLE: ____________________________TITLE: ______________________________ PRINT TITLE PRINT TITLE SUBSCRIBED AND SWORN BEFORE ME THIS ______ DAY OF ________________ A.D., 20____. _________________________________ NOTARY PUBLIC 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT TRANSITIONAL YARD PROVISION -NO BUILDINGS OR STRCUTURES ARE PERMITTED. -SHALL NOT BE USED FOR PARKING, LOADING, SERVICING, OR STORAGE. -SHALL BE LANDSCAPED AND INCLUDE A MINIMUM 4' IN HEIGHT OPAQUE FENCE. BERMING SHOULD BE CONSIDERED FOR ADDITIONAL SCREENING. 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT SHALL BE LANDSCAPED AND INCLUDE A MINIMUM 4' IN HEIGHT BERM FOR ADDITIONAL SCREENING. 202 TO: PRESIDENT ARGOUDELIS and BOARD OF TRUSTEES FROM: BASMAH NADEEM, ASSOCIATE PLANNER MEETING DATE: MARCH 4, 2024 SUBJECT: REPORT TO THE BOARD OF TRUSTEES TERRABIS (ADULT-USE CANNABIS DISPENSARY) CASE # 2040-010424.SU REQUEST: Special Use for Adult-Use Cannabis Dispensary (Public Hearing) PETITIONER(S): Terrabis (Nicholas Liaromatis) LOCATION: 16020 S. Route 59 ZONING: B-3 Highway Business District COMP. PLAN: General Commercial DISCUSSION The petitioner, Terrabis, is seeking a recommendation of approval for a special use to permit an Adult-Use Cannabis Dispensary at 16020 S. Route 59. The applicant will be preserving the existing 3,140 square foot structure on the lot as well as maintaining the current general site layout. Per the Plainfield Municipal Code (Sec. 9-37), “… there are certain uses that, because of their unique characteristics, cannot be properly classified in any particular district or districts, without consideration in each case of the impact of those uses on adjacent properties and of the public need for the particular use in the particular location.” Due to this, the petitioner is applying for a special use intended for the cannabis dispensary as it is a use with unique characteristics and circumstances. Existing Conditions/ Site Context The subject site has been vacant since the departure of the Hardee’s establishment. The property is located in the Vintage Harvest Commercial subdivision, located on Route 59, and is adjacent to other B-3 Commercial uses. The adjacent land uses, zoning and street classifications are as follows: John F. Argoudelis PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally Larson Tom Ruane Brian Wojowski 203 REPORT TO THE BOARD OF TRUSTEES Page #2 of 3 2040-010424.SU 03/04/2024 TERRABIS (ADULT-USE CANNABIS DISPENSARY) North: B-3 Highway Business District East: B-3 Highway Business District S. Route 59 (Major Arterial) South: B-3 Highway Business District West: B-3 Highway Business District ANALYSIS The applicant is seeking approval for a special use permit for an Adult-Use Cannabis Dispensary establishment. The petitioner is requesting this use for a lot located in the B-3 Highway Business District which is the sole zoning district this particular business establishment is permitted, through a special use. If granted, the subject site will be the first cannabis dispensary permitted in the Village. The operation will fulfill the standard for permitting one (1) cannabis dispensary south of Lockport Street and one (1) out of two (2) dispensary establishments permitted for the Village as a whole. If approved, subsequent prospective applicants will be precluded from applying for a cannabis dispensary positioned south of Lockport Street. Therefore, the use follows the code requirement in regards to location and the permittable amount of cannabis dispensary establishments. Per Sec. 9-78, one (1) parking stall is required per 200 square feet for Adult-Use Cannabis Dispensaries. As the existing structure will not be expanded, the current 3,140 square foot structure requires sixteen (16) parking stalls. The provided and extant 42 stalls, two (2) of which are ADA compliant, are well above the minimum standards. In order for the Board of Trustees to recommend approval of a special use, it must make two findings of fact, as follows: a.) The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor substantially diminish property values within the neighborhood; and Staff finds that the special use will not be injurious to the use and enjoyment of other properties, nor will it diminish property values in the immediate area. Traffic for dispensaries is considered equal to the generation of Quick Service Restaurants (QSR), which is what this building previously was. A QSR is considered a permitted use in the subject zoning district. Furthermore, the subject site is surrounded by commercial properties, ensuring that it meets the standards for the neighborhood. Specifically, the proposed operation’s site is positioned further than the minimum 250 feet from schools, day care centers or homes, and residential parcels, ensuring a buffer. Additionally, the structure adheres to the standard of maintaining a distance of at least 1,500 feet from another adult-use cannabis facility as this would be the first one permitted thus far. The lot has been vacant since the departure of the Hardee’s establishment and has incurred over twenty (20) visits from the Village Code Enforcement department for its maintenance, causing issues that has the potential to being resolved with the proposed use. Instead of diminishing property values, the dilapidated structure can potentially 204 REPORT TO THE BOARD OF TRUSTEES Page #3 of 3 2040-010424.SU 03/04/2024 TERRABIS (ADULT-USE CANNABIS DISPENSARY) improve the existing circumstances with the proposed use and drive new traffic to the center. b.) The establishment of the special use will not impede the normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff submits that the proposed cannabis establishment will not impose on the normal and orderly development for adjacent properties in the subject zoning district. The site layout will be similar as to what is proposed. The positioning of the subject site adjacent to Route 59 – a major arterial – and the provided parking stalls and ingress/egress, ensures that the site, and the adjacent properties are accustomed to the use. Public Notice Feedback Staff received two (2) phone calls in regard to the case, one requesting information pertaining to the special use request and one speaking in support. One resident spoke about concerns for security purposes and staff has outlined that the dispensary stock items will be secured with restricted and limited access. In addition, staff received three (3) letters of support which are enclosed as exhibits. PLAN COMMISSION Plan Commission heard this case at their February 6, 2024 meeting. There were a few public comments and these commenters asked questions pertaining to the buffer and security. Commissioner comments were in relation to security and traffic. Staff and the applicant expressed that the petitioner meets and exceeds the minimum buffer requirements, proper measures will be taken regarding security, and that the traffic generated will be similar to a QSR which is what the establishment was previously used for. The request received a unanimous positive recommendation (vote: 4-0). CONCLUSION/ RECOMMENDATION In conclusion, staff submits that the presented Adult-Use Cannabis Dispensary meets the findings of fact for the special use provisions. The lot has been sitting dilapidated since it’s vacancy and can offer a more pragmatic use with the cannabis dispensary that meets all the standards for special use and dispensaries. Based on the foregoing analysis, prior to any public comment or discussion by the Board of Trustees, staff and the Plan Commission recommends approval. Should the Board of Trustees concur, the following motion is offered for your consideration: I move we adopt Ordinance ______ to authorize the issuance of a special use permit for an Adult-Use Cannabis Dispensary for the property located at 16020 S. Route 59, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District; 3. Compliance with the requirements of the Village’s administrative site plan review. 205 ORDINANCE NO. AN ORDINANCE AUTHORIZING THE ISSUANCE OF A SPECIAL USE PERMIT TO OPERATE AN ADULT-USE CANNABIS DISPENSARYAT 16020 S. ROUTE 59, IN THE VILLAGE OF PLAINFIELD, WILL COUNTY,ILLINOIS WHEREAS, the Village of Plainfield has considered an application for a special use permit to operate an Adult-Use Cannabis Dispensary, on property located at 16020S. Route 59, and the Plainfield Plan Commission has held the required public hearing on February 6, 2024 and made certain findings based on the evidence presented in said case that: a.The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor substantially diminish property values within the neighborhood; and b.The establishment of the special use will not impede the normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. NOW, THEREFORE, BE IT ORDAINED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL AND KENDALL COUNTIES,ILLINOIS AS FOLLOWS: Section 1: Recitals - The President and Board of Trustees of the Village of Plainfield hereby adopt and incorporate as their own, the above findings recited. Section 2: Approval – The President and Board of Trustees of the Village of Plainfield hereby approve the application for a special use permit to operate an Adult-Use Cannabis Dispensary on property located at 16020 S. Route 59, legally describedas follows: LOT 1 IN VINTAGE HARVEST COMMERCIAL SUB, BEING A SUB OF PRT OF THE NE1/4 OF SEC. 21, T36N-R9E. (EX THAT PRT TAKENFOR RD WIDENING PER 07ED9). REVISED LEGAL DESCRIPTION/ACREAGE CHANGE FOR ROAD WIDENING PER 07 ED9. THIS PIN STAYS THE SAME, (WAS 0.792 ACRES) REF#12289 6/16/2008 DLO. PIN: 06-03-21-201-019-0000 Property Address: 16020 S. Route 59, Plainfield, Illinois 60586 206 Section 3: Conditions – That said special use permit shall be subject to the following conditions: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District; 3. Compliance with the requirements of the Village’s administrative site plan review. Section 4: Severability - The various portions of this Ordinance are hereby expressly declared to be severable, and the invalidity of any such portion of this Ordinance shall not affect the validity of any other portions of this Ordinance, which shall be enforced to the fullest extent possible. Section 5: Repealer - All ordinances or portions of ordinances previously passed or adopted by the Village of Plainfield that conflict with or are inconsistent with the provisions of this Ordinance are hereby repealed. Section 6: Effective Date – This Ordinance shall be in full force and effect from and after its passage and approval. PASSED THIS ______ DAY OF ____________, 2024. AYES: NAYS: ABSENT: APPROVED THIS ______ DAY OF ____________, 2024. VILLAGE PRESIDENT ATTEST: VILLAGE CLERK 207 16020 S RT 59 County of Will, Maxar, Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Utility Addresses Village Address Points Development Site Proposed Approved Parcels Plainfield Municipal Boundary 1/8/2024, 9:12:52 AM 0 0.1 0.20.05 mi 0 0.15 0.30.07 km 1:9,028 Plainfield Staff County of Will, Esri, HERE, Garmin, INCREMENT P, USGS, EPA, USDA | Plainfield GIS | NPMS National Repository | Will County GIS | Will County Clerk Tax Extension | Will County Supervisor of Assessments Office, Bureau of Land Management | County of Will,208 209 153 SF SECURED ENTRY 104 961 SF DISPENSING FLOOR 105 181 SF POS 106 175 SF DAY STORAGE 107 247 SF VAULT 108 383 SF BREAK AREA 109 8 SF JAN 110 87 SF MEN 111 80 SF WOMEN 112 59 SF SERVER 113 38 SF MECH 114 145 SF EXIT VESTIBULE 115 8'-1" 24'-8" 8'-7"15'-2"18'-6"4'-2"6'-0" 2'-1"3'-0"10'-8"7'-11" 36'-3" 8'-0" 6'-9"5'-6"1'-6"5'-11"10'-0" 24'-11"9'-11"10'-8"16'-6"22'-7"ADA STATION15'-2"2'-8" 8'-3" 3'-10"11'-2"7'-10" 12'-8"6'-7"4'-2"4'-8" 10'-6"14'-9"4'-0"153 SF SECURED ENTRY 104 961 SF DISPENSING FLOOR 105 181 SF POS 106 175 SF DAY STORAGE 107 247 SF VAULT 108 383 SF BREAK AREA 109 8 SF JAN 110 87 SF MEN 111 80 SF WOMEN 112 59 SF SERVER 113 38 SF MECH 114 145 SF EXIT VESTIBULE 115 0024 ACCESS LEGEND RESTRICTED ACCESS LIMITED ACCESS PUBLIC ACCESS BLDG. DEPT. APPROVAL 1242 MONTEGUT STREET NEW ORLEANS, LA 70117 SEAL DATE SCALE DRAWN CHECKED PROJECT NO. © 2023 FLEX DESIGN STUDIO, LLC.All rights reserved. No part of this document may be reproduced or utilized in any form, without prior written authorization by Flex Design Studio, LLC.4201 LAKE COOK ROAD, SUITE 102 NORTHBROOK, IL 60062 3/16" = 1'-0"12/27/2023 3:18:56 PMINTERIOR REMODEL OF EXISTING RETAIL SPACE 16020 S ROUTE 59 PLAINFIELD, IL 60544 NOT FOR CONSTRUCTION FLOORPLAN 001 12/27/23 AAF JHB #2.1.012 8'16'4'2'0 N SCALE: 3/16" = 1'-0"1 LEVEL 01 - FLOORPLAN SCALE: 3/16" = 1'-0"2 LEVEL 01 - ACCESS PLAN # DESCRIPTION DATE 210 1'-8" 6'-8" 2'-8" 3'-0" NEW LOGO EXISTING DOOR AND WINDOWS TO REMAIN EXISTING AWNING TO REMAIN. PAINT. EXISTING BRICK FACADE TO REMAIN. PAINT. EXISTING LIGHTING TO REMAIN EXISTING WINDOWS AND AWNING TO REMAIN NEW LOGO EXISTING BRICK FACADE TO REMAIN. PAINT. EXISTING WINDOW FILLED IN. PAINT.3'-0"3'-0"8'-0"11'-0" EXISTING TRASH ENCLOSURE TO REMAIN. PAINT. EXISTING LIGHTING TO REMAIN 3'-0"2'-8"6'-8"EXISTING DOOR AND WINDOWS TO REMAIN EXISTING BRICK FACADE TO REMAIN. PANT. NEW LOGO 1'-8"EXISTING TRASH ENCLOSURE EXISTING BRICK FACADE TO REMAIN. PAINT. EXISTING DOOR TO REMAIN. PAINT.3'-0"11'-0"EXISTING LIGHT OVER DOOR TO REMAIN. ADD 2 MATCHING LIGHTS ON EITHER SIDE OF DOOR. BLDG. DEPT. APPROVAL 1242 MONTEGUT STREET NEW ORLEANS, LA 70117 SEAL DATE SCALE DRAWN CHECKED PROJECT NO. © 2023 FLEX DESIGN STUDIO, LLC.All rights reserved. No part of this document may be reproduced or utilized in any form, without prior written authorization by Flex Design Studio, LLC.4201 LAKE COOK ROAD, SUITE 102 NORTHBROOK, IL 60062 1/4" = 1'-0"12/27/2023 3:19:07 PMINTERIOR REMODEL OF EXISTING RETAIL SPACE 16020 S ROUTE 59 PLAINFIELD, IL 60544 NOT FOR CONSTRUCTION EXTERIOR ELEVATIONS 002 12/27/23 AAF JHB #2.1.012 SCALE: 1/4" = 1'-0"1 NORTH SIDE - RETAIL EXIT SCALE: 1/4" = 1'-0"2 SOUTH SIDE SCALE: 1/4" = 1'-0"01 EAST SIDE - RETAIL ENTRY SCALE: 1/4" = 1'-0"4 WEST SIDE - DELIVERY ENTRY # DESCRIPTION DATE 211 BLDG. DEPT. APPROVAL 1242 MONTEGUT STREET NEW ORLEANS, LA 70117 SEAL DATE SCALE DRAWN CHECKED PROJECT NO. © 2023 FLEX DESIGN STUDIO, LLC.All rights reserved. No part of this document may be reproduced or utilized in any form, without prior written authorization by Flex Design Studio, LLC.4201 LAKE COOK ROAD, SUITE 102 NORTHBROOK, IL 6006212/27/2023 3:19:07 PMINTERIOR REMODEL OF EXISTING RETAIL SPACE 16020 S ROUTE 59 PLAINFIELD, IL 60544 NOT FOR CONSTRUCTION EXTERIOR RENDERINGS 003 12/27/23 Author Checker #2.1.012 # DESCRIPTION DATE 212 213 214 February 2, 2024 Village of Plainfield Attn: Village Board 24401 W. Lockport Street Plainfield, IL 60544 Subject: Letter Recommending Terrabis Dear Village Board: As the O’Fallon Economic Development Director, I am writing regarding your consideration of a potential partnership between the Village of Plainfield & Terrabis for the development of a cannabis dispensary. The City of O’Fallon has had the privilege of working with Terrabis since 2021. Throughout this time, we have benefited from their professionalism, expertise, and commitment to creating a well-regulated and safe environment for the cannabis industry to operate in our city. Allow me to highlight a few other benefits we have experienced through our collaboration with Terrabis: 1. Economic Boost: Since its opening, Terrabis has consistently contributed to the economic growth of our city. Their cannabis dispensary in O’Fallon has resulted in the creation of new job opportunities, increased tax revenue, and customer activity. The Village of Plainfield should anticipate similar benefits, including the potential reinvestment by nearby businesses. 2. Safety Measures: Terrabis is committed to operating a secure and safe environment while working cooperatively with local law enforcement. They have implemented rigorous security protocols, including 24/7 surveillance systems and strict identification verification processes. Their focus on safety has significantly minimized concerns in our community and has been no reported incidents at their location since it opened 3 years ago. 3. Ease of Communication: Terrabis is always responsive to any inquiries, transparent in their communication, and has, simply put, upheld their end of the bargain. Their vigilance in adhering to state and local regulations has ensured a responsible and ethical operation within our city. Based on O’Fallon’s own experiences and the benefits we received from working with Terrabis, I highly recommend your full consideration of developing a similar dispensary in your locality. Their commitment to economic growth, safety, regulatory compliance, community engagement, and education aligns with the values and objectives of our community – which I am sure we both share. Please do not hesitate to reach out to me if you require any additional information. Sincerely, Patrick McKeehan Economic Development Director 100 NORTH MAIN STREET O’FALLON, MO 63366 636.240.2000 FACISMILE 636.978.4144 215 John F. Argoudelis PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally Larson Tom Ruane Brian Wojowski TO: PRESIDENT ARGOUDELIS and BOARD OF TRUSTEES FROM: BASMAH NADEEM, ASSOCIATE PLANNER JAKE MELROSE, AICP, DEVELOPMENT DIRECTOR MEETING DATE: MARCH 4, 2024 SUBJECT: REPORT TO THE BOARD OF TRUSTEES WOODMAN’S FOOD MARKET CASE NUMBER 2041-010724.AA.REZ.SU.SPR.PP REQUEST: Annexation by Annexation Agreement (Public Hearing) Rezoning Special Use for Planned Development Site Plan Review Preliminary Plat LOCATION: NEC of S. Route 59 and W. 119th Street APPLICANT: Woodman’s Food Market (Bret Backus) ZONING: Will County A-1 Agricultural COMP. PLAN: General Commercial DISCUSSION The applicant, Woodman’s Market, is requesting annexation by annexation agreement, as well as rezoning from R-1 to B-3, a special use for a planned development (PD), site plan review, and preliminary plat of subdivision review to permit the construction of a Woodman’s grocery store with a gas station, car wash and oil change center along with 7 other outlots on approximately 36 acres at the northeast corner of S. Route 59 and W. 119th Street. The commercial development consists of nine (9) lots, landscaping buffers, stormwater detention, and accesses via S. Route 59 and W. 119th Street. A significant portion of the development includes the Woodman’s Food Market store, fuel station, convenience store, car wash, and oil change center, compromising of 27.3 acres. Woodman’s Food Market is an employee-owned company that presently manages and oversees operations across 19 establishments in Wisconsin and Illinois. Woodman’s offers an extensive array of grocery selections, alongside supplementary services including fuel stations. The Woodman’s development will act as a retail anchor for the seven (7) outlots. These outlots will be developed in forthcoming phases and will be considered for future site plan reviews. 216 REPORT TO THE BOARD OF TRUSTEES Page #2 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET The subject site had previously been considered for a more expansive development known as “Shops at the Polo Club,” which included nearly 500,000 square feet of commercial space. This project consisted of a shopping center that would service the Village with various shops, large anchor tenants, movie theater restaurants, pedestrian amenities, etc. The plans were presented between 2006 and 2008, but ultimately did not move forward due to the economic downturn. The site is now proposed for the Woodman’s project, which has taken the layout and conceptual plan of the “Shops at the Polo Club” into consideration and has incorporated a few of the same details in the master site plan. These changes for the proposed new development will reflect the current economic and retail landscape. Existing Conditions/Site Context The subject property is approximately 36 acres and is unincorporated agricultural land. Currently, the property is vacant with a one-story metal building at the southeast corner of the lot on W. 119th Street. Existing vegetation buffers the subject site from the adjacent property directly east. The adjacent land uses, zoning, and functional street classifications are identified below: North: Naperville R1A Low Density Single-Family Residence District East: Will County A-1 Agricultural South: Will County I-1 Limited Industrial W. 119th Street (Major Arterial) (IDOT Strategic Regional Arterial) West: B-3 Highway Business District PUD – Plainfield Retail Center R-1 Low Density Single-Family Residential – Champion Creek S. Route 59 (Major Arterial) (IDOT Strategic Regional Arterial) ECONOMIC IMPACT The applicant has completed an economic impact analysis associated with the development. The Woodman’s operations would represent over 300 new, permanent jobs with 124 of the jobs being full-time and 186 part-time jobs. The construction of the store will account for 210 temporary construction jobs. Due to 119th St and IL Route 59 both being IDOT strategic regional arterials, the demand for infrastructure improvements is very high. Woodman’s will be seeking an incentive of $12 million to offset the costs associated with these improvements. The average annual sales tax generated over 15 years is projected to be $1.2 million to the Village. Please note this is an average and the structure of the incentive will vary the annual output of sales tax. The outlot area once fully developed could produce between $500,000 to $1 million in sales tax. The proposed project will also produce a large amount of property taxes. The project is not located in a TIF district so all property taxes will go directly to the local taxing bodies. The Woodman’s store alone will produce $360,000 to $450,000 in property taxes (~$21,000 annually to the Village) and the outlots once fully developed will produce approximately $250,000 to $350,000 in property taxes as well. The Plainfield School District 202 should see approximately $486,000 or higher in annual property taxes once the development is fully built out. To help the Board gage the proposed incentive request, below are comparative incentives that have been approved in the Chicago suburb region over recent years: • Buffalo Grove – Woodman’s $7 million over 20 years (2016) • Naperville – Heritage Square Shopping Center Redevelopment $13.4 million • Crystal Lake – Crystal Court Shopping Center $14 million 217 REPORT TO THE BOARD OF TRUSTEES Page #3 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET • Niles – Golf Mill Shopping Center Redevelopment $96 million • Vernon Hills – Mellody Farm project $20 million ANALYSIS Annexation The applicant is seeking approval from the Board of Trustees in order to annex into the Village of Plainfield by annexation agreement. A draft agreement has been provided to the Board for review and is relatively straight forward. The only outside taxing body collecting impact fees for commercial projects is the Plainfield Fire Protection District, which the applicant is or will be in communication with. Any reference to design standards, temporary uses or other such zoning mechanisms are consistent with Village code at a minimum basis. The applicant and staff are still working through a potential recapture agreement for properties that could benefit from the water and sewer extension along 119th Street. The economic incentive agreement will also be considered as part of the annexation agreement approval where a $12 million incentive is being sought with a current payout of 65% of all sales tax generated from the Woodman’s operations for a 10-year term. The subject property is contiguous to the Village’s municipal boundary, located directly west of the site. As shown on the "Future Land Use Plan" of the Village's Comprehensive Plan, the subject site is included in the Village's boundaries as well as the Village’s Planning Area. Therefore, staff submits that the annexation of the property would be a logical extension of the Village's boundaries. Rezoning Upon annexation, the subject property is given a R-1 (Low Density Single-Family) zoning designation. The petitioner is seeking rezoning to B-3 Highway Business District to facilitate the development of the proposed Woodman’s project alongside the outlots. In order for the Board of Trustees to approve of the requested map amendment, they must make the following findings of fact based on the evidence presented. a. That the rezoning promotes the public health, safety, comfort, convenience, and general welfare, and complies with the polices and plans of the Village; The proposed B-3 zoning complies with the future land use designation (General Commercial) in the Village’s Comprehensive Plan. It will promote commercial development, which will help diversify the Village’s property tax base, provide opportunities for shopping and employment, and generate sales tax revenue. A fiscal impact study conducted for the project estimates that it would yield over 500 employment opportunities, generate sales tax revenue on the order of $41 million, and an estimated $6 million in property taxes during a 15-year duration. The project would achieve an improvement in the diversification of the Village’s property tax base, shifting more property tax burden away from homeowners. The development will also be required to provide all necessary road improvements to accommodate the traffic generated from the project, which is extrapolated to exceed $10 million in improvements. All of these are advantages that are conducive to enhancing the public health, safety and general welfare of the community in furtherance of implementation of the Village’s Comprehensive Plan. b. That the trend of development in the area is consistent with the requested rezoning; 218 REPORT TO THE BOARD OF TRUSTEES Page #4 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET The requested zoning is consistent with the B-3 zoning in the immediate vicinity, which includes B-3 commercial areas west of S. Route 59 and unincorporated non-residential at the SEC of S. Route 59 and W. 119th Street. c. That the new zoning requested allows uses that are more suitable than those allowed under the existing zoning; Staff maintains that the proposed B-3 commercial use is more appropriate than the default R-1 zoning that would be established following annexation. The subject property is adjacent to two major arterials – Route 59 and 119th Street – both designated by the Illinois Department of Transportation as a strategic regional arterial; and the property is westerly adjacent to existing B-3 commercial developments. These commercial developments can benefit from the increased traffic and would not be negatively impacted by the noise and other aspects of this highly trafficked locale. d. That the property cannot yield a reasonable use under the existing zoning; and As stated above, staff observes that the location adjacent to major arterial roadways, in proximity to commercial and industrial uses, corroborates the subject site as untenable for single-family development and the highest/best use of the proposed property is B-3 as planned by the Village for numerous years. This position is further supported by considering the ample alternative locations available for single-family development and the limited (i.e., not infinite) housing demand. e. That the rezoning would not alter the essential character of the neighborhood, nor would it be a substantial detriment to adjacent properties. The rezoning would facilitate a continuation of the Route 59 commercial corridor. It would further support the commercial developments adjacent to the subject site and is projected to create employment opportunities as well as generate tax revenue. Staff maintains that the rezoning would not alter the essential character of the neighborhood, instead it would bolster the opportunities for the neighboring adjacent properties. Special Use for Planned Development The petitioner is seeking a special use permit for a planned development to allow for drive-thru operations for the proposed car wash operation and future outlot development in Lots 2, 3, 4, 5, 7, and 8, as well as zoning flexibility outlined below. Planned Development (PD) Drive-Thru Staff presents that the drive-thru uses are appropriate for the Route 59 corridor. Per Sec. 9-78, the Woodman’s car wash positioned south of the gas station site will include three (3) washing bays that meet and exceed the required stacking standard of six (6) spaces per washing bay. As for the future drive-thrus, the petitioner is requesting entitlements for drive-thru operations for all outlots positioned towards the southern boundary of the subject site, as well as two (2) outlots adjacent to the western boundary. These will still require site plan approval that will give the Village ample opportunity to enforce screening and orientation requirements for the drive-thrus on the outlots. Considering the size of the development and the numerous access points throughout, staff finds the proposed uses acceptable. In order for the Board of Trustees to approve a special use for the drive-thru operation, they must make two findings of fact based on the specific circumstances of this project as follows: 219 REPORT TO THE BOARD OF TRUSTEES Page #5 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET a. The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor would it substantially diminish property values within the neighborhood; and Staff finds that the special use will not be injurious to the use and enjoyment of other properties, nor will it diminish property values in the immediate area. The subject site is surrounded by commercial properties, ensuring that it meets the standards for the neighborhood. Specifically, the petitioner is implementing a landscape buffer surrounding the fuel station site which will aid in preventing any potential unsightly views or noises from adjacent properties and roadways. b. The establishment of the special use will not impede normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff submits that the proposed drive-thru operations will not impose on the normal and orderly development for adjacent properties in the subject zoning district and can instead spur additional development for the outlots. Planned Development (PD) Zoning Flexibility The planned development approach provides the flexibility needed to promote innovative and creative land development that achieves the community vision outlined in the Comprehensive Plan. The planned development will provide for a coordinated development plan with consistent and compatible architectural design and landscaping throughout the subject site. The applicant will provide more information pertaining to the planned development agreement as the project progresses. Staff submits that the requested zoning reliefs from the Village Zoning Ordinance are appropriate and beneficial to the area, playing a pivotal role in sustaining the project’s future development endeavors. The applicant has proposed relief from the following: Section 9-121. – Lighting Per code, the light levels at the lot lines, with the exception of ingress and egress points, should be a maximum of 0.5 footcandles. The lighting spillover in proximity to the lot boundaries on the southwest corner of the designated site (up to 1.5 footcandles) arises from the presence of the fuel station, a common occurrence in gas dispensary developments and alongside the Route 59 commercial corridor. Staff deems that the landscape area oriented on the southwest corner of the subject property is sufficient to minimize the lighting from affecting adjacent roadways or properties. Section 9-116. – Design requirements As outlined in the code, if there were to be a façade that exceeds 100 feet, it shall incorporate some horizontal architectural relief. The Village requires this so as to amplify the existing architectural amenities. An uninterrupted façade exceeding 100 feet (approximately 142 feet) west of the food market’s parcel pick- up and east of the secondary Woodman’s signage does not include the required architectural relief. Staff contends that this aspect is not imperative for the architectural enhancement of the façade, given that the applicant has sufficiently incorporated features throughout other sections of the structure and Woodman’s is unique in its size comparatively to other commercial users. The petitioner is proposing another relief from the design standards, in regard to integrating sidewalks no less than eight (8) feet in width along the full length of any building façade featuring a customer entrance and abutting a public parking area. The sidewalk width adjacent to the Woodman’s grocery store structure is diminished in various strategic places on the site plan so as to aid in the aforementioned architectural 220 REPORT TO THE BOARD OF TRUSTEES Page #6 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET enhancements, provide wider drive aisles, and create accessible parking stalls. The narrowest width on the main façade measures at 6.5 feet, a dimension deemed ample by staff for private sidewalk requirements. For main entrances, more space is provided that generally meets or exceeds the eight (8) foot standard. In addition, the applicant is requesting relief from the standard to include a public space within the vicinity of the grocery store structure’s main pedestrian entrance. The applicant is already implementing one such feature, exemplified by seasonal plantings, in the vicinity of the main entrance. However, the other features as required by the code are mostly in relation to larger retail developments where pedestrian amenities are also enhanced, such as shopping centers. As this is a retail anchor located in the B-3 Highway Business District, staff maintains that this is not a necessary requirement for this project as the definition of this district calls for customers arriving mostly through automobile use. Other pedestrian features will be added to enhance the user experience, such as connecting walkways to paths oriented on arterial roads. Future outlot development can potentially aid in providing more of these features. The last design guideline the applicant is requesting relief from is in relation to the maximum height of the Woodman’s food market structure. A commercial structure with a flat roof design, as is the Woodman’s Food Market, shall incorporate a parapet that provides for 100 percent screening of HVAC or mechanical equipment for public view. The height shall not exceed one-third of the height of the supporting wall. The height of the parapet is 51 feet whereas the height of the supporting wall is at an estimated 30 feet. Based on this, the height should not exceed 40 feet. The applicant is requesting this relief so as to aid in screening of HVAC and mechanical equipment located on the roof. Additionally, staff asserts that the Woodman’s parapet is integral to the project’s character and development, given its widespread use across various Woodman’s locations. Section. 9-78. – Schedule of off-street parking requirements Per code, the amount of parking stalls provided at minimum for the Woodman’s Food Market shall be one (1) space per 200 square foot of gross floor area. Based on this guideline, the required amount would be 1,218 stalls. The project has provided 613 stalls. Staff submits that this is a sufficient amount as the proposed Woodman’s Food Market will have 136,000 square feet of selling area and the remainder of the building, approximately 107,500 square feet, will be warehouse/storage space. This holds considerable importance regarding parking for consumers, as the parking demand is primarily contingent upon the square footage of the sales area, rather than storage space. This would result in a reduction of the requirement to 680 stalls, a figure much closer to the proposed quantity. Staff supports the parking relief as the required amount would be excessive for this project and would ultimately create parking that remains unused. In exchange for the relief identified above, the developer commits to exceeding the Village's Zoning Code requirements as follows: • Enhanced corner-lot and buffer landscaping • Off-site street improvements • Ample amount of stacking for drive-thru operations In order for the Board of Trustees to approve of a special use for a planned development and the deviations associated with the specific case, the applicant must demonstrate additional findings per the below. The findings of fact associated with the planned development are applied to the requests from the PD (i.e. zoning variations, special use requests) and not the development as a whole. a. The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor would it substantially diminish property values; 221 REPORT TO THE BOARD OF TRUSTEES Page #7 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET Staff deems that the planned development requests would not be detrimental to adjacent properties nor would it diminish property values. Staff submits that this development is compatible and consistent with the planning of the area for nearly 20 years and the requests are reasonable. b. The establishment of the special use will not impede normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff maintains that the proposed plan is compatible with adjacent commercial projects and will be consistent with the trend of development in the area. Indeed, the implementation of offsite roadway enhancements will foster additional improvements and developments in the surrounding areas contiguous to the subject site. The requested relief would also enhance the character and compatibility of the site with adjacent properties. c. The planned development fulfills the objectives of the comprehensive plan and the land use policies of the Village and presents an innovative and creative approach to the development of land and living environments; The proposed project would fulfill the intent of the Comprehensive Plan’s future land use designation as “General Commercial” for the subject property. The proposed relief granted by the planned development will further achieve objectives and goals as outlined in the Village’s Comprehensive Plan including, “Foster a wide-ranging tax base that increases employment opportunities within Plainfield” and “Strategically provide convenient business locations to provide residents with desired access to goods and services.” d. The proposed land uses fulfill, or can reasonably be expected to fulfill, a need or demand for such uses within the Village; Staff finds that the requested planned development fulfills a demand for an additional affordable grocery store option within the Village, filling the role after Walmart’s departure. Woodman’s products and services can supply a more cost-effective alternative for both Plainfield and Naperville residents. Staff also deems that a flexible nature to a project of this magnitude is of the utmost importance as the Village seeks to recruit more retail development for this endeavor and further diversify the local tax base. e. The physical design of the planned development efficiently utilizes the land, adequately provides for transportation and public facilities, and preserves natural features of the site, and that the property is suitable for the proposed purposes and land uses; Staff deems that the requested site plan and parking relief adequately provides for the subject property. In addition, the projected offsite street improvements will garner enhancements for transportation efforts on these major arterial roads. As for preservation, there are no existing natural features, such as trees, located on the site. The eastside abundance of vegetation is located primarily on the adjacent property and will remain as is. Therefore, staff submits that the proposed land use plan utilizes the site efficiently and the requested relief would only further enhance the compatibility of the site as a whole. f. Any exceptions to bulk and density regulations of the underlying zoning shall be solely for the purpose of promoting an efficient and coordinated site plan, no less beneficial to the residents or occupants of such development, as well as the neighboring property, than would be obtained under the bulk and density regulations of this ordinance for buildings developed on separate zoning lots; 222 REPORT TO THE BOARD OF TRUSTEES Page #8 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET Staff asserts that the requested bulk and density relief, in regard to the building height and parking relief, are appropriate for the project and are in efforts to promote an efficient and coordinated site plan, as well as architecture, for the structure. Increasing the parking capacity will impact the overall site layout, create a desolate landscape of over abundant parking stalls particularly at non-peak hours, and is not necessary for this development as the requested amount is sufficient. Additionally, the building height request is essential to the character of the Woodman’s project and if the max building height was utilized at 35 feet, the entryway parapet would be a five (5) foot variance. Further, staff has found many communities have allowed for the proposed type of height in their intense highway zoning districts. For instance, Naperville’s comparable zoning district does not have a building height maximum but instead utilizes floor area ratio as the tool to control height within a development, which this project would comply with. If approved, the relief requests would benefit the surrounding neighborhood as it would further enhance the attributes of the site. g. The planned development meets the requirements and standards of the planned development regulations; The proposed planned development complies with the requirements of the planned development standards in the zoning code. h. Open spaces and recreational facilities are provided; The anticipated development has a proposed stormwater detention east of the subject area which could provide scenic open space. However, as mentioned above, the public facility standard is not suitable for this development as the amenities for this type of project are automobile-oriented, a difference from the shopping center or residential development this requirement is tailored towards. Instead, Woodman’s is offering improved pedestrian connectivity to the street walkways. Staff considers that the proposed features of the site remain in accordance with the required standard. i. The planned development is compatible with the adjacent properties and the neighborhood, and along the periphery of the planned development, yards or setbacks shall be provided that meet or exceed the regulations of the district in which the planned development is located; As mentioned, staff submits that the proposed planned development is compatible with adjacent commercial and industrial properties. Landscaping buffers have been proposed along the corner lot where the fuel station site is oriented, with additional dense buffers positioned north of the site separating the project from residentially zoned homes. This buffer area exceeds the required yard amount in the Village code. From this it is evident that the yard setbacks meet or exceed the required standard and provide an ample amount of space between adjacent properties and roadways. j. That the land uses permitted are necessary or desirable and are appropriate with respect to the primary purpose of the planned development; Staff submits that this project will enhance commercial and retail development within the Village, improve street connectivity, aid in traffic management for the expanding area, and efficiently utilize land. k. That the land uses are not of such a nature, or so located, as to exercise a detrimental influence on the surrounding neighborhood. 223 REPORT TO THE BOARD OF TRUSTEES Page #9 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET Staff submits that the requested planned development is appropriate and compatible with adjacent communities for the proposed land use and designs as this area has been planned for commercial development for over 20 years. Impacts are being mitigated through buffer yards and implementation of Village development standards. Site Plan Review Site Plan The overall site encompasses the Woodman’s project (food market, fuel station, convenience store, car wash, and oil change center) as well as the seven (7) outlots, proposed stormwater detention, landscaping, parking, access drives and drive aisles – totaling an estimated 36 acres. The grocery store will be centrally located within the development and occupy a significant portion of the area, with the lot itself encompassing approximately 24 acres and featuring a proposed structure spanning an estimated 243,500 square feet. The southwest corner lot of the subject site will be developed for the gas dispensers, convenience shop, car wash facility, and oil change service. The oil change center and the convenience store will share the same structure, the shop located on the east side of the building and the auto service provided on the west. All of these services in combination would relatively add up to 3.29 acres. The Woodman’s project would occupy two (2) of the total nine (9) lots in the proposed development. The seven (7) outlots and the requested drive-thru operations are to be reviewed as development occurs and site plan review will be required. It should be noted that outlot nine (9), directly adjacent to the residential area, is not proposed to include a drive-thru operation. Additionally, this lot will be required to adhere to any transitional buffer yard requirements established by the Village at that time. The overall site layout, and specifically Woodman’s project, is in compliance with the B-3 district standards as outlined below in Table 1. Table 1. B-3 Zoning District Standards Lot Standard Required Provided (Food Market – Lot 1) Provided (Gas Station – Lot 6) Minimum lot area (sq ft) 43,560 sf 1,045,847.01 sf 143,312.4 sf Minimum lot width (sq ft) 100 ft 730 ft (generally) 259.4 ft Maximum lot coverage None Complies Complies Maximum impervious area coverage (percentage) 80 64.6 70 Yard Standard Minimum front setback (feet) 30 30 30 Minimum interior side setback (feet) 15 15+ 15+ Minimum corner side setback (feet) 30 30 30+ Minimum rear setback (feet) 30 30+ 30 Access and Circulation The development is projected to provide four (4) external access points. For offsite circulation, supplementary through and turn lanes will be augmented around the site to aid with high traffic volumes for these major arterials. These offsite improvements will be developed in the initial phase. Additional details on the proposed roadway plan and access into the site are presented as follows: 224 REPORT TO THE BOARD OF TRUSTEES Page #10 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET • The full access on W. 119th Street will be positioned east of the subject site and aligns with the existing Spaulding School Drive to the south. The access drive is projected for signalization, designating additional lanes for turns. This signal should provide “breaks” in traffic for uncontrolled intersections to the east of this property that are not incorporated into the Village. • The right-in driveway on W. 119th Street will be oriented westwards of the overall site, immediately preceding the prospective fuel station. The access drive will include a right-turn lane into the site and extends further along the road to the intersection of S. Route 59 and W. 119th Street. • The Right-in/Right-out access from S. Route 59 will be located towards the center of the subject property. • The full access on S. Route 59 will be stationed north of the site, situated evenly with the north Kohl’s driveway across S. Route 59. This access drive is also anticipated for signalization, adjoining supplemental lanes on S. Route 59; however, this will require IDOT approval. Due to the signal that was implemented at Champion Drive just to the north of this property for the Champion Creek subdivision (Plainfield incorporated) and South Pointe subdivisions (Naperville subdivision), a traffic signal for the Woodman’s site may not be feasible due to spacing criteria. These roadway plans and access drives are similar as to what was proposed by the previously propositioned development “Shops at the Polo Club” and have been carefully considered for the submitted project, aiding circulation for a highly trafficked area. Although not depicted in the site plan, the applicant will be required to extend a bike path for a recently approved residential development within the City of Naperville, known as “Polo Club”, directly east of the subject property. The multi-use path will be positioned on the north side of W. 119th Street. An additional path, a sidewalk, will be supplied on the south side of W. 119th Street. Crossings are anticipated to occur on the signalized intersection of W. 119th Street and Spaulding School Drive. Parking and Loading The applicant has allocated parking stalls for both the grocery store and the convenience store on the gas station site. The applicant will also provide a sufficient amount of stacking for the car wash as seen in the table below. Table 2. Provided Car and Bike Spaces Based on Use Use Car Bike Grocery store, liquor store, supermarket 613 31 Convenience store 6 N/A Car wash 6+ spaces for stacking N/A As mentioned in the special use section above, per Sec. 9-78, grocery stores are to provide one (1) parking space per 200 square feet of gross floor area. The required amount for the food market would be 1,218 parking stalls; however, staff has established that a large portion of the food market structure will be utilized for warehouse and storage space. The parking relief is requested to be included in the planned development. The provided amount is adequate and the proposed parking lot ensures an efficient site layout. Per code, the convenience store is to supply one (1) parking space per 300 square feet of gross floor area. This structure is generally 1,500 square feet and would require five (5) stalls. The petitioner has provided six (6) parking spaces, exceeding the standard. 225 REPORT TO THE BOARD OF TRUSTEES Page #11 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET The standard amount of bike spaces for grocery and convenience stores is one (1) space per 20 vehicle stalls. Given the parking spaces supplied for the convenience store, this is not required for this particular structure. For the grocery market, the structure meets this standard with 31 bike spaces. Additionally, each of the car wash bays meet or exceed the required six (6) stacking spaces. Although not implemented in the Village’s code, staff requested stacking specifics in regards to the fuel station to ensure the provided amount is sufficient. The petitioner is proposing 96 stacking spaces in total for the fuel station which staff deems is an ample amount. Architecture and Elevations The submitted building elevations for the grocery store predominantly consist of pre-cast concrete panels with architectural enhancements laced throughout the facades. The proposal includes prominent cornices along the rooflines, as well as complementary parapet walls and pillars to provide relief along the facades. The entrance has a prominent parapet that enhances the main entry-way and is predominant for the Woodman’s Food Market architecture, reaching to an estimated 51 feet. This is above the allowable height for the B-3 district and can be considered in the PD along with the other standards requested for variation i.e., the architecture and public space amenity requirements. The dimensions conform to other standards as outlined in the table below. Table 3 – B-3 Zoning District Building Standards Building Standard Required Provided (Food Market – Lot 1) Maximum Building Height (feet) 35 51 Maximum Floor Area Ratio 0.4 0.15 Maximum Floor Area Per Dwelling Unit (sf) N/A Complies The gas dispensary, oil change service, convenience store, and car wash have similar architectural features as the food market. Landscape Plan The applicant has submitted an overall landscape plan for the project. The plan includes parkway tree plantings, landscaped buffers, corner-lot landscaping, and internal parking lot plantings. There is an existing buffer for the adjacent property east of the site, with tall trees lining the neighboring site. The stormwater detention positioned near the east boundary of the subject property will add to the buffer from the building to the eastern unincorporated property. A transitional yard/landscaped buffer is provided on the north side of the subject property, adjacent to the Naperville South Pointe subdivision. This area includes a five (5) foot berm over 400 feet long with dense landscaping mixed with evergreen trees for seasonal screening. The transitional buffer area is positioned with a separation of over 100 feet from the parking lot and over 160 feet from the building, ensuring ample space and distance between each component. A landscape buffer or transitional yard will need to be implemented at the time of development for the outlot adjacent to South Pointe. 226 REPORT TO THE BOARD OF TRUSTEES Page #12 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET The parkway tree plantings and shrubs on the corner lot – the location of the gas station site – also has an attractive cluster of plantings fronting Route 59 and 119th Street. Internally, the food market development’s central parking lot has varying plantings spaced proportionately throughout the site. Trash Enclosure Trash compactors are presented east of the grocery store, in the rear of the food market structure, as well as the south side of the convenience store. The trash enclosure for both structures will be constructed with similar materials utilized on the primary structure. Lighting In most cases, the proposed photometric plan conforms to the zoning code (Sec. 9-121), which indicates that no more than 0.5 footcandles can spill onto adjacent properties other than for ingress/egress. The notable exception to this is that the spillage on the southwest side of the property is as high as 1.5 footcandles. As suggested in the special use section above, staff proposes its inclusion in the PD. The spillage extends onto the right-of-way but does not impact adjacent commercial properties. The light fixtures conform to the code. The light fixtures utilized around the primary Woodman’s structure are predominantly ornamental in design and add to the character and enhancement of the project. Per staff’s suggestion, the applicant has revised the photometric plan to replace the ornamental fixtures on the northside wall, facing the residential subdivision, to a more compact and downlit fixture so as to avoid light exposure. Engineering/Stormwater Management Final engineering approval is not required during consideration of the zoning entitlements; however, Woodman’s has been coordinating with the Village engineering department for months prior to this meeting. The applicant has proposed stormwater detention area on the east side of the property and extensive improvements to the surrounding street network. Specifically, the applicant is projected to widen and improve W. 119th Street and S. Route 59 near the subject site. These improvements will serve and benefit the surrounding commercial, industrial, and residential areas. Separately, the applicant will dedicate sufficient right-of-way at the southern boundary of the site onto W. 119th Street for additional right-turn improvements to this intersection. A traffic impact study has been under IDOT review, and the applicant and Village staff has also been coordinating with Pulte’s engineering group as it relates to the W. 119th Street improvements. Preliminary Plat The petitioner has submitted a preliminary plat of subdivision with two (2) lots proposed for development, one of which would encompass stormwater detention, and seven (7) outlots for future development. Each lot conforms to the minimum zoning requirements in regards to lot and setback standards. The applicant is proposing dedicating right-of-way on the southside boundary of the subject site. Staff notes that this may require further coordination in the final engineering phase as well as other utilities that will be evaluated during the final engineering review. Public Notice Feedback Staff has received feedback from the general public in relation to the proposed development. One common question residents raised pertained to the Walmart vacancy and the rationale behind Woodman’s inability to fill the vacant structure. Staff has explained, as directed by the Village’s press release on the matter, that the applicant and the Village did collaborate with Walmart in efforts to redevelop the vacant storefront. Ultimately, the combined efforts were unsuccessful and instead the subject site is being proposed for the 227 REPORT TO THE BOARD OF TRUSTEES Page #13 of 13 2041-010724.AA.REZ.SU.SPR.PP 03/04/2024 WOODMAN’S FOOD MARKET Woodman’ development as it holds for a more efficient site layout. Other concerns were in relation to traffic which staff has addressed that the petitioner is providing offsite improvements to aid in this matter. Residents expressing support for the development conveyed enthusiasm regarding the potential employment opportunities, the extensive array of affordable products the market could offer, and the projected roadway improvements for the major arterial roads. PLAN COMMISSION Plan Commission heard this case at their February 6, 2024 meeting. There were a few public comments and these commenters asked questions pertaining to the traffic and landscape buffering. Commissioner comments were in relation to traffic, circulation, and lighting. The petitioner explained there is substantial plantings for screening purposes that meet village standards. Additionally, staff and the applicant expressed that proper measures will be taken with IDOT and village coordination regarding traffic and circulation. As for lighting, the applicant has noted the suggestion for dimmer lighting, although the applicant has expressed the need for higher luminosity for security purposes. All requests received a unanimous positive recommendation (vote: 4-0). CONCLUSION/RECOMMENDATION In summary, staff submits that the proposed project represents a logical extension of the Village's boundaries, with a development that complies to the standards of the Village’s Zoning Code as shown in the applicant’s site plan and preliminary plat. The proposed use is appropriate at the subject location and staff supports the relief requested from the Zoning Ordinance. Staff maintains that the findings of fact have been demonstrated to support the annexation, proposed map amendment (rezoning), and special use for planned development. Based on the foregoing analysis, prior to any public or Trustee comments, staff and Plan Commission recommends approval. The following motion is offered for consideration: I move we direct the Village Attorney to prepare the necessary ordinances granting approval of the annexation agreement and annexation for the project known as the Woodman’s Food Market development. I move we adopt the findings of fact of the Plan Commission as the findings of fact of the Board of Trustees and, furthermore, to direct the Village Attorney to prepare the necessary ordinances granting approval of the requested map amendment (re-zoning) from R-1 to B-3 and approval of the requested special use for planned development, for the project known as the Woodman’s Food Market development. 228 Woodman's Aerial County of Will, Maxar, Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), (c) OpenStreetMap contributors, and the GIS User Community, Will County GIS, Plainfield GIS Village Address Points Development Site Proposed Parcels Plainfield Municipal Boundary 2/6/2024, 11:37:41 AM 0 0.15 0.30.07 mi 0 0.25 0.50.13 km 1:9,028 Plainfield Staff County of Will, Esri, HERE, Garmin, INCREMENT P, Intermap, USGS, METI/NASA, EPA, USDA | Plainfield GIS | NPMS National Repository | Will County GIS | Will County Clerk Tax Extension | Will County Supervisor of Assessments Office, Bureau of Land Management | County of Will, Maxar | 229 © 2023 Microsoft Corporation © 2023 TomTom FSTSTSTSFSTSTSTSFSTSTSTS WOODMAN'S FOOD MARKETPLAINFIELD, ILTITLE SHEET SHEET NUMBER %URRNILHOG:,_0LOZDXNHH:,_$SSOHWRQ:,_0DGLVRQ:,&HGDUEXUJ:,_1DSHUYLOOH,/_,UYLQH&$Know what's below. before you dig.Call 5 PRELI MI N A R Y NOT F O R CONS T R U C TI O N 3/$1,1'(; S+((T12'(S&5,3T,21 3/$1'$T( 35(/,0,1$5<S,T( /$1'S&$3(3/$1S F25 :22'0$1 SF22'0$5.(T 3/$,1F,(/',/ N OWNER: :22'0$1 SF22'0$5.(T,1& /,%(5T</$1( -$1(S9,//(:, DESIGN-BUILDER/ CONSTRUCTION MANAGER: CIVIL ENGINEER & LANDSCAPE ARCHITECT: APPROVAL AGENCY: 9,//$*(2F3/$,1F,(/' :/2&.325TST5((T 3/$,1F,(/',/ 3+ 352-(&T0$1$*(5 3$8/0&,/+(5$13( 352-(&T(1*,1((5 $1'5(:ST$S,8.(9,&,8S3(P:\3230075\Dwg\Sheets\3230075-TS01.dwg, Cover Sheet, 1/29/2024 11:35:29 AM, ajs3230 FS TS TS TS FS TS TS TS FS TS TS TS STATE ROUTE "59"W. 119TH ST.AERO DR.SPAULDINGSCHOOL DR.WOODMAN'S FOOD MARKETPLAINFIELD, ILOVERALL SITE PLAN SHEET NUMBER %URRNILHOG:,_0LOZDXNHH:,_$SSOHWRQ:,_0DGLVRQ:,&HGDUEXUJ:,_1DSHUYLOOH,/_,UYLQH&$N ,1F((T *5$3+,&S&$/( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP01.dwg, SITE PLAN, 1/29/2024 11:35:45 AM, ajs3231 WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN NORTHWEST SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAN IN )((7 *5A3+IC 6CAL( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-NW, 1/29/2024 11:35:56 AM, ajs3232 WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN NORTHEAST SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAN IN )((7 *5A3+IC 6CAL( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-NE, 1/29/2024 11:35:59 AM, ajs3233 STATE ROUTE "59"WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN WEST SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAN IN )((7 *5A3+IC 6CAL( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-WEST, 1/29/2024 11:36:04 AM, ajs3234 FS TSTS TS FS TSTS TS FS TSTS TS WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN EAST SHEET NUMBER %URRNILHOG:,_0LOZDXNHH:,_$SSOHWRQ:,_0DGLVRQ:,&HGDUEXUJ:,_1DSHUYLOOH,/_,UYLQH&$N ,1F((T *5$3+,&S&$/( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-EAST, 1/29/2024 11:36:09 AM, ajs3235 W. 119TH ST.AERO DR.WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN SOUTHWEST SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAN IN )((7 *5A3+IC 6CAL( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-SW, 1/29/2024 11:36:14 AM, ajs3236 SPAULDINGSCHOOL DR.WOODMAN'S FOOD MARKETPLAINFIELD, ILDETAILED SITE PLAN SOUTHEAST SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAN IN )((7 *5A3+IC 6CAL( illinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\3230075-SP02.dwg, SITE PLAN-SE, 1/29/2024 11:36:19 AM, ajs3237 CONCEPT TYPICAL SECTION 119TH STREET AT STATION 64+00 CONCEPT TYPICAL SECTION 119TH STREET AT STATION 73+00 WOODMAN'S FOOD MARKETPLAINFIELD, ILCONCEPT SECTIONS - 119TH STREET SHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 P:\3230075\Dwg\Sheets\Offsite\3230075-TS01-OS.dwg, Typical Sections, 1/26/2024 3:09:41 PM, ajs3TYPICAL SECTION A-A (SEE SHEET C205) TYPICAL SECTION B-B (SEE SHEET C206) C207 01/29/2024 238 FS TS TS TS FS TS TS TS FS TS TS TS / / / / / / 35232S(' :22'0$1 S F22'0$5.(T 28T/2T $& 28T/2T $& 28T/2T $& 35232S(' ST250:$T(5 28T/2T $& 28T/2T $& 28T/2T $& 28T/2T $& (;,ST,1* 9(*(T$T,21 T2 5(0$,1 &$5 :$S+ &ST25( F8(/ST$T,21ST$T(528T( : T+ST T$//%(50/$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 /$:1 9,//$*(2F3/$,1F,(/',/=21,1*&2'( $UWLFOH;,9/DQGVFDSLQJ SHFWLRQ 3$5.:$< FURQWDQGFRUQHUVLGH\DUGDGMWRYHKLFOHXVH RYHUVWRU\VKDGHRUQDPHQWDORUHYHUJUHHQWUHHVDQGVKUXEVIRU HYHU\IHHWRIIURQWDJHVKDOOEHSURYLGHG FURQWDJH /F OHQJWKRI RIIVHWIURP3/ 5(48,5(' WUHHV VKUXEV 3529,'(' T5((S VKUXEV SODQWXQLWV ODUJHVKUXEV[ SODQWXQLWV VPDOOVKUXEVSODQWXQLWV SHFWLRQ %8FF(5<$5'1RUWK:HVW FURQWDQGFRUQHUVLGH\DUGDGMDFHQWWRUHVLGHQWLDODQGYHKLFOHXVH /F[/F SF SODQWXQLWVIRUHDFKVTXDUHIHHWRIEXIIHU\DUGDUHD [ SODQWXQLWV FDQEHUHGXFHGZLWK EHUP 5(48,5(' SODQWXQLWV 3529,'(' EHUP VKDGHWUHHV [SODQWXQLWV SODQWXQLWV HYHUJUHHQWUHHV [SODQWXQLWV SODQWXQLWV ODUJHVKUXEV [SODQWXQLWV SODQWXQLWV TRWDO SODQWXQLWV SHFWLRQ %8FF(5<$5'1RUWK(DVW FURQWDQGFRUQHUVLGH\DUGDGMDFHQWWRUHVLGHQWLDO [ SF SODQWXQLWVIRUHDFKVTXDUHIHHWRIEXIIHU\DUGDUHD [ SODQWXQLWV 5(48,5(' SODQWXQLWV 3529,'(' VKDGHWUHHV [ HYHUJUHHQWUHHV [ ODUJHVKUXEV [ TRWDO SHFWLRQ F281'$T,213/$1T,1*:22'0$1S 0LQLPXPUDWLRRISODQWXQLWVIRUHYHU\VTXDUHIHHWDUHDRISODQWLQJ EHGZKLFKLVZLWKLQIHHWRIWKHIRXQGDWLRQ FRXQGDWLRQSODQWLQJDUHD SF [ 5(48,5(' SODQWXQLWV 3529,'(' SODQWXQLWV SHFWLRQ F281'$T,213/$1T,1*&ST25( 0LQLPXPUDWLRRISODQWXQLWVIRUHYHU\VTXDUHIHHWDUHDRISODQWLQJ EHGZKLFKLVZLWKLQIHHWRIWKHIRXQGDWLRQ FRXQGDWLRQSODQWLQJDUHD SF [ 5(48,5(' SODQWXQLWV 3529,'(' SODQWXQLWV SHFWLRQ ,1T(5,253$5.,1*:22'0$1 S TKHLQWHULRURIWKHSDUNLQJORWVVKDOOEHSODQWHGZLWKRYHUVWRU\VKDGHWUHHV DWDUDWLRRIWUHHIRUHYHU\SDUNLQJVSDFHV SDUNLQJVSDFHV 5(48,5(' WUHHV 3529,'(' WUHHV SHFWLRQ ,1T(5,253$5.,1*&ST25( TKHLQWHULRURIWKHSDUNLQJORWVVKDOOEHSODQWHGZLWKRYHUVWRU\VKDGHWUHHV DWDUDWLRRIWUHHIRUHYHU\SDUNLQJVSDFHV SDUNLQJVSDFHV 5(48,5(' WUHH 3529,'(' WUHH WOODMAN'S FOOD MARKETPLAINFIELD, ILOVERALLLANDSCAPE PLANSHEET NUMBER %URRNILHOG:,_0LOZDXNHH:,_$SSOHWRQ:,_0DGLVRQ:,&HGDUEXUJ:,_1DSHUYLOOH,/_,UYLQH&$illinois1call.com CALL 811 OR (800) 892-0123 *5$3+,&S&$/( 125T+ $//'(T$,/S$1'S3(&,F,&$T,21ST2%('(T(50,1('21F,1$//$1'S&$3(3/$1S $//3/$1T,1*SS+$//&203/<:,T+ST$1'$5'S$S'(S&5,%(',1$0(5,&$1 ST$1'$5'2F185S(5<ST2&.$1S,= /$T(ST9(5S,21 08/&+ $//3/$1T,1*%('ST25(&(,9('((3/$<(52FS+5(''('+$5':22' %$5.08/&+ ,1T(5,253$5.,1*,S/$1'ST25(&(,9('((3/$<(52F&58S+('*5$1,T( T85FS((' '85$%/(35(0,80&200(5&,$/%/(1' *(1(5$//$1'S&$3(12T(S P:\3230075\Dwg\Sheets\3230075-LSP01.dwg, L100 Overall Landscape Plan, 1/29/2024 11:36:34 AM, ajs3239 (1) SKH2 (1) SKH2 (3) HCB2 (3) AFM2 (1) SKH2 (2) SSL2 (2) SKH2 (5) NS (5) QFH2 (2) RO2 (3) WS (4) NBK (1) RO2 (3) NS (2) HCB2 (5) NBK (5) WS (6) GD (3) RO2 (5) NS (5) NBK (6) HO1 (4) DSY (3) BBH (3) BBH (5) HO1(7) HO1(4) BBH (7) HO1 (5) DBH (3) PJC (3) HL (3) PJC (5) DBH (1) SKH2 (3) UX2 (2) SWO (2) SKH2 (7) DBH (3) PJC (5) HL (3) PJC (5) DBH (10) GFS LAWN LAWN LAWN LAWN PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.)LAWN LAWN LAWN LAWN 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) LAWN LAWN PROPOSED WOODMAN'S FOOD MARKET 5' TALL BERM CODE QTY COMMON NAME BOTANICAL NAME SIZE ROOT REMARKS SHADE TREES AFM2 3 Autumn Fantasy Maple Acer x freemanii DTR102'2 1/2" CAL B&B Spacing as shown HCB2 5 Common Hackberry Celtis occidentalis 2 1/2" CAL B&B Spacing as shown SKH2 8 Street Keeper Honey Locust Gleditsia triacanthos `Draves`2 1/2" CAL B&B Spacing as shown SWO 2 Swamp White Oak Quercus bicolor 2 1/2" CAL B&B Spacing as shown RO2 6 Red Oak Quercus rubra 2 1/2" CAL B&B Full, matching heads SSL2 2 Sweet Street Linden Tilia americana `Kromm`2 1/2" CAL B&B Spacing as shown UX2 3 Urban Elm Ulmus x 'Urban'2 1/2" CAL B&B Spacing as shown EVERGREEN TREES NS 13 Norway Spruce Picea abies 6` HT B&B Spacing as shown WS 8 White Spruce Picea glauca 6` HT B&B Spacing as shown DECIDUOUS SHRUBS GD 6 Gray Dogwood Cornus racemosa 48" HT CONT. OR BB Spacing as shown DBH 22 Dwarf Bush Honeysuckle Diervilla lonicera 18" HT CONT Spacing as shown QFH2 5 Quick Fire Hydrangea Hydrangea paniculata `Bulk`48" HT CONT Spacing as shown BBH 10 BoBo Hydrangea Hydrangea paniculata `ILVOBO``18" HT CONT Spacing as shown HL 8 Little Quick Fire Hydrangea Hydrangea paniculata `SMHPLQF`18" HT CONT Spacing as shown NBK 14 Ninebark Physocarpus opulifolius 48" HT CONT. OR BB Spacing as shown GFS 10 Goldflame Spirea Spiraea japonica `Goldflame`24" HT CONT Spacing as shown EVERGREEN SHRUBS PJC 12 Kallay Compact Pfitzer JuniperJuniperus chinensis `Kallays Compact`18" SPD CONT Spacing as shown DSY 4 Dense Yew Taxus x media `Densiformis`18" HT B&B Spacing as shown PERENNIALS HO1 24 Francee Hosta Hosta fortunei `Francee`4 1/2"POT 24" Spacing PLANT SCHEDULE L200 WOODMAN'S FOOD MARKETPLAINFIELD, ILLANDSCAPE PLANNORTH WESTSHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 10 20 40 GRAPHIC SCALE 0 NORTH - ALL DETAILS AND SPECIFICATIONS TO BE DETERMINED ON FINAL LANDSCAPE PLANS. - ALL PLANTINGS SHALL COMPLY WITH STANDARDS AS DESCRIBED IN AMERICAN STANDARD OF NURSERY STOCK - ANSI Z60.1 (LATEST VERSION) - MULCH: ALL PLANTING BEDS TO RECEIVE 3" DEEP LAYER OF SHREDDED HARDWOOD BARK MULCH. - INTERIOR PARKING ISLANDS TO RECEIVE 3" DEEP LAYER OF CRUSHED GRANITE. - TURF SEED: DURABLE, PREMIUM COMMERCIAL BLEND. GENERAL LANDSCAPE NOTESMATCHLINE SHEET L201MATCHLINE SHEET L202 P:\3230075\Dwg\Sheets\3230075-LSP02.dwg, L200 NW Landscape Plan, 1/29/2024 11:36:50 AM, ajs3240 (2) HCB2 (3) NS (2) RO2 (5) QFH2 (3) WS (1) HCB2 (3) BC (4) UX2 (5) BC (7) BRD (6) GD (7) BRD (5) SWO (9) GD (5) DSY (7) HO1(8) BBH (8) HO1 (4) DSY (4) BBH (4) DSY (2) SWO LAWN PROPOSED STORM WATER POND LAWN PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) LAWN LAWN LAWN PROPOSED WOODMAN'S FOOD MARKET 5' TALL BERM CODE QTY COMMON NAME BOTANICAL NAME SIZE ROOT REMARKS SHADE TREES HCB2 3 Common Hackberry Celtis occidentalis 2 1/2" CAL B&B Spacing as shown SWO 7 Swamp White Oak Quercus bicolor 2 1/2" CAL B&B Spacing as shown RO2 2 Red Oak Quercus rubra 2 1/2" CAL B&B Full, matching heads UX2 4 Urban Elm Ulmus x 'Urban'2 1/2" CAL B&B Spacing as shown EVERGREEN TREES NS 3 Norway Spruce Picea abies 6` HT B&B Spacing as shown WS 3 White Spruce Picea glauca 6` HT B&B Spacing as shown DECIDUOUS CONIFER BC 8 Baldcypress Taxodium distichum 6` HT B&B Spacing as shown DECIDUOUS SHRUBS GD 15 Gray Dogwood Cornus racemosa 48" HT CONT. OR BB Spacing as shown BRD 14 Bailey Redosier DogwoodCornus sericea var. baileyi 48" HT CONT Spacing as shown QFH2 5 Quick Fire Hydrangea Hydrangea paniculata `Bulk`48" HT CONT Spacing as shown BBH 12 BoBo Hydrangea Hydrangea paniculata `ILVOBO``18" HT CONT Spacing as shown EVERGREEN SHRUBS DSY 13 Dense Yew Taxus x media `Densiformis`18" HT B&B Spacing as shown PERENNIALS HO1 15 Francee Hosta Hosta fortunei `Francee`4 1/2"POT 24" Spacing PLANT SCHEDULE L201 WOODMAN'S FOOD MARKETPLAINFIELD, ILLANDSCAPE PLANNORTH EASTSHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 10 20 40 GRAPHIC SCALE 0 NORTH - ALL DETAILS AND SPECIFICATIONS TO BE DETERMINED ON FINAL LANDSCAPE PLANS. - ALL PLANTINGS SHALL COMPLY WITH STANDARDS AS DESCRIBED IN AMERICAN STANDARD OF NURSERY STOCK - ANSI Z60.1 (LATEST VERSION) - MULCH: ALL PLANTING BEDS TO RECEIVE 3" DEEP LAYER OF SHREDDED HARDWOOD BARK MULCH. - INTERIOR PARKING ISLANDS TO RECEIVE 3" DEEP LAYER OF CRUSHED GRANITE. - TURF SEED: DURABLE, PREMIUM COMMERCIAL BLEND. GENERAL LANDSCAPE NOTES OVERALL SHEET L100MATCHLINE SHEET L200P:\3230075\Dwg\Sheets\3230075-LSP02.dwg, L201 NE Landscape Plan, 1/29/2024 11:36:55 AM, ajs3241 (2) SSL2 (4) UX2 (1) AFM2 (2) SSL2 (2) AFM2 (2) SSL2 (1) SKH2 LAWN LAWN PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) LAWN LAWN PROPOSED WOODMAN'S FOOD MARKET CODE QTY COMMON NAME BOTANICAL NAME SIZE ROOT REMARKS SHADE TREES AFM2 3 Autumn Fantasy Maple Acer x freemanii DTR102'2 1/2" CAL B&B Spacing as shown SKH2 1 Street Keeper Honey LocustGleditsia triacanthos `Draves`2 1/2" CAL B&B Spacing as shown SSL2 6 Sweet Street Linden Tilia americana `Kromm`2 1/2" CAL B&B Spacing as shown UX2 4 Urban Elm Ulmus x 'Urban'2 1/2" CAL B&B Spacing as shown PLANT SCHEDULE L202 WOODMAN'S FOOD MARKETPLAINFIELD, ILLANDSCAPE PLANWEST CENTRALSHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 10 20 40 GRAPHIC SCALE 0 NORTH- ALL DETAILS AND SPECIFICATIONS TO BE DETERMINED ON FINAL LANDSCAPE PLANS. - ALL PLANTINGS SHALL COMPLY WITH STANDARDS AS DESCRIBED IN AMERICAN STANDARD OF NURSERY STOCK - ANSI Z60.1 (LATEST VERSION) - INTERIOR PARKING ISLANDS TO RECEIVE 3" DEEP LAYER OF CRUSHED GRANITE. - TURF SEED: DURABLE, PREMIUM COMMERCIAL BLEND. GENERAL LANDSCAPE NOTES MATCHLINE SHEET L200 MATCHLINE SHEET L203 P:\3230075\Dwg\Sheets\3230075-LSP02.dwg, L202 WCentral Landscape Plan, 1/29/2024 11:37:00 AM, ajs3242 (1) AFM2 (2) AFM2 (4) AFM2 (2) HCB2 (3) HCB2 (1) SKH2 (1) SKH2 (2) SKH2 (3) SSL2 LAWNLAWN LAWN LAWN LAWN LAWN LAWN LAWN LAWN PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) PARKING ISLAND TO RECEIVE 3" DEPTH CRUSHED GRANITE (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) 3" DEPTH CRUSHED GRANITE WITH ALUMINUM EDGING (TYP.) PROPOSED WOODMAN'S FOOD MARKET CODE QTY COMMON NAME BOTANICAL NAME SIZE ROOT REMARKS SHADE TREES AFM2 7 Autumn Fantasy Maple Acer x freemanii DTR102'2 1/2" CAL B&B Spacing as shown HCB2 5 Common Hackberry Celtis occidentalis 2 1/2" CAL B&B Spacing as shown SKH2 4 Street Keeper Honey LocustGleditsia triacanthos `Draves`2 1/2" CAL B&B Spacing as shown SSL2 3 Sweet Street Linden Tilia americana `Kromm`2 1/2" CAL B&B Spacing as shown PLANT SCHEDULE L203 WOODMAN'S FOOD MARKETPLAINFIELD, ILLANDSCAPE PLANSOUTH CENTRALSHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 10 20 40 GRAPHIC SCALE 0 NORTH- ALL DETAILS AND SPECIFICATIONS TO BE DETERMINED ON FINAL LANDSCAPE PLANS. - ALL PLANTINGS SHALL COMPLY WITH STANDARDS AS DESCRIBED IN AMERICAN STANDARD OF NURSERY STOCK - ANSI Z60.1 (LATEST VERSION) - INTERIOR PARKING ISLANDS TO RECEIVE 3" DEEP LAYER OF CRUSHED GRANITE. - TURF SEED: DURABLE, PREMIUM COMMERCIAL BLEND. GENERAL LANDSCAPE NOTES MATCHLINE SHEET L202 MATCHLINE SHEET L204P:\3230075\Dwg\Sheets\3230075-LSP02.dwg, L203 SCentral Landscape Plan, 1/29/2024 11:37:05 AM, ajs3243 (1) UX (8) PJC2 (5) SF (5) PJC2 (4) BCB (8) GFS (6) PJC2 (3) FQ (7) PJC2 (1) UX (22) GFS (10) PJC2 (3) UX (5) PJC2 (5) SF (2) AFM (5) PJC2 (12) GFS (1) AFM (5) SF (3) FQ (3) RO (5) SF(3) BCB (3) BCB (9) BCB (3) AFM (5) SF (6) QFH (2) AFM (9) DJ (5) QFH (5) SF (5) BCB (5) SF (5) PJC2 (5) BCB (5) BCB (13) BCB (7) DJ (6) PJC2 (4) BBH (5) DSY (4) BBH (3) DBH (7) HL (3) DBH (1) SKH2 (1) UX (5) SF (9) PJC2(5) PJC2 (5) DJ (3) BCB (3) BBH (4) DJ (5) BBH (5) DSY (1) UX (2) RO2 (5) GFS (6) GFS (4) BBH (4) BBH LAWN LAWN LAWN LAWN PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) LAWN LAWN LAWN LAWN CAR WASH C-STORE FUEL STATION LAWN LAWN PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) (5) SKH2 (4) RO (3) SF (7) DJ (5) PJC2 (5) BCB (5) GFS (3) QFH (5) GFS (1) UX (3) BCB (5) SF (1) UX (2) BCB (5) PJC2 LAWN PLANT BED TO RECEIVE 3" DEPTH SHREDDED HARDWOOD BARK MULCH (TYP.) LAWN CODE QTY COMMON NAME BOTANICAL NAME SIZE ROOT REMARKS SHADE TREES SKH2 6 Street Keeper Honey Locust Gleditsia triacanthos `Draves`2 1/2" CAL B&B Spacing as shown RO2 2 Red Oak Quercus rubra 2 1/2" CAL B&B Full, matching heads PARKWAY TREES AFM 8 Autumn Fantasy Maple Acer x freemanii DTR102'3" CAL B&B Spacing as shown FQ 6 Blue Ash Fraxinus quadrangulata 3" CAL B&B Full, matching heads RO 7 Red Oak Quercus rubra 3" CAL B&B Full, matching heads UX 9 Urban Elm Ulmus x 'Urban'3" CAL B&B Full, matching heads DECIDUOUS SHRUBS BCB 60 Glossy Black Chokeberry Aronia melanocarpa var. elata 24" HT CONT Spacing as shown DBH 6 Dwarf Bush Honeysuckle Diervilla lonicera 18" HT CONT Spacing as shown DJ 32 Jewell Bush Honeysuckle Diervilla lonicera `Jewell`24" HT CONT Spacing as shown SF 43 Sunrise Forsythia Forsythia x `Sunrise`24" HT CONT Spacing as shown QFH 14 Quick Fire Hydrangea Hydrangea paniculata `Bulk`24" HT CONT Spacing as shown BBH 24 BoBo Hydrangea Hydrangea paniculata `ILVOBO``18" HT CONT Spacing as shown HL 7 Little Quick Fire Hydrangea Hydrangea paniculata `SMHPLQF`18" HT CONT Spacing as shown GFS 63 Goldflame Spirea Spiraea japonica `Goldflame`24" HT CONT Spacing as shown EVERGREEN SHRUBS PJC2 81 Kallay Compact Pfitzer JuniperJuniperus chinensis `Kallays Compact`24" HT CONT Spacing as shown DSY 10 Dense Yew Taxus x media `Densiformis`18" HT B&B Spacing as shown PLANT SCHEDULE L204 WOODMAN'S FOOD MARKETPLAINFIELD, ILLANDSCAPE PLANSOUTH WESTSHEET NUMBER Brookfield, WI | Milwaukee, WI | Appleton, WI | Madison, WICedarburg, WI | Naperville, IL | Irvine, CAillinois1call.com CALL 811 OR (800) 892-0123 10 20 40 GRAPHIC SCALE 0 NORTH MATCHLINE A-A MATCHLINE A-AMATCHLINE SHEET L203- ALL DETAILS AND SPECIFICATIONS TO BE DETERMINED ON FINAL LANDSCAPE PLANS. - ALL PLANTINGS SHALL COMPLY WITH STANDARDS AS DESCRIBED IN AMERICAN STANDARD OF NURSERY STOCK - ANSI Z60.1 (LATEST VERSION) - MULCH: ALL PLANTING BEDS TO RECEIVE 3" DEEP LAYER OF SHREDDED HARDWOOD BARK MULCH. - INTERIOR PARKING ISLANDS TO RECEIVE 3" DEEP LAYER OF CRUSHED GRANITE. - TURF SEED: DURABLE, PREMIUM COMMERCIAL BLEND. GENERAL LANDSCAPE NOTES P:\3230075\Dwg\Sheets\3230075-LSP02.dwg, L204 SW Landscape Plan, 1/29/2024 11:37:10 AM, ajs3244 APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETPROJECTNORTHPROJECTNORTHELEVATIONSA210NLBEXTERIORPAWJRASOUTH245 FSTSTSTSFSTSTSTS$33529(' &+(&.(''5$:1$%&'($%&'(:22'0$1 SF22'0$5.(T352-(&T125T+352-(&T125T+(/(9$T,21S$1/%(;T(5,253$:-5$125T+246 APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETPROJECTNORTHPROJECTNORTHELEVATIONSA212NLBEXTERIORPAWJRAWEST & EAST247 FSTSTSTS$33529(' &+(&.(''5$:1$%&'($%&'(:22'0$1 SF22'0$5.(T/2$',1*'2&.S$1/%(;T(/(9S3$:-5$S:,T&+:$T(5/2$''2&.S 352-(&T125T+352-(&T125T+352-(&T125T+248 EC-3P-1GL-2GL-2GL-2GL-2EC-1EC-3GL-2REF-1EIFS-1P-1P-1P-1EC-3EC-3EC-3P-1P-1P-1P-1EC-3P-1P-1APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETSCHEMESA220NLBCOLOR & FINISHPAWJRAEXTERIOR249 APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETSCHEMESA221NLBCOLOR & FINISHPAWJRAEXTERIOR250 251 252 253 254 255 256 257 1.82.32.21.10.30.20.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.20.40.71.01.62.22.83.11.50.40.30.30.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.20.40.81.32.12.93.54.52.30.60.40.30.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.20.51.01.62.53.94.25.53.40.80.60.30.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.30.61.01.72.84.74.96.12.30.50.80.30.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.51.01.62.84.34.65.83.70.90.70.40.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.50.91.42.53.64.35.22.80.70.50.30.20.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.40.81.32.23.14.04.22.30.60.40.30.20.20.10.10.10.00.00.00.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.40.71.21.93.13.93.82.30.50.30.30.30.20.10.10.10.00.00.00.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.20.40.71.22.03.03.93.82.50.60.30.30.30.20.10.10.10.00.00.00.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.40.81.32.33.23.94.33.00.60.40.40.30.20.10.10.10.00.00.00.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.40.91.62.53.74.25.23.90.80.50.40.30.20.10.10.10.00.00.00.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.51.01.82.74.44.95.85.21.00.70.50.20.20.10.10.10.10.00.00.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.30.51.11.92.84.85.46.25.00.60.50.50.20.20.10.10.10.10.00.00.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.20.51.01.82.64.34.75.75.11.00.70.40.20.20.10.10.10.10.00.00.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.20.50.91.52.43.64.15.13.90.80.50.40.30.20.10.10.10.10.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.40.81.32.13.03.84.13.00.70.40.40.30.20.10.10.10.10.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.71.11.82.83.63.62.50.60.30.30.30.20.10.10.10.10.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.71.11.72.73.53.52.50.60.30.30.30.20.10.10.10.10.10.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.71.11.92.73.53.72.80.70.30.30.30.20.10.10.10.10.10.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.40.81.22.13.03.74.33.50.80.50.40.30.20.20.10.10.10.10.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.50.91.42.23.54.05.04.60.90.60.50.30.20.20.10.10.10.10.00.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.30.50.91.62.34.04.75.55.81.10.90.50.30.20.20.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.51.01.62.23.94.65.45.81.10.90.50.30.20.20.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.40.61.01.52.03.33.84.84.60.90.70.50.30.20.20.10.10.10.10.10.30.30.30.30.30.30.30.30.30.30.40.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.40.40.40.50.60.81.11.52.02.73.23.93.40.80.50.50.30.20.20.20.10.10.10.10.60.50.50.50.50.50.50.60.60.70.70.70.60.60.60.50.60.60.70.70.80.80.70.70.70.60.70.80.91.01.01.00.90.80.70.70.80.91.11.41.72.12.42.93.12.40.80.50.50.40.30.30.20.20.10.10.11.11.01.00.90.80.80.80.91.11.21.31.31.11.00.90.90.91.01.21.31.51.41.31.21.11.01.11.21.51.71.81.71.51.31.21.21.21.41.72.02.22.32.62.82.72.10.90.60.60.50.40.30.30.20.20.10.11.81.81.71.51.31.31.31.51.72.02.12.11.81.61.41.41.41.61.82.12.22.22.01.91.71.61.72.02.32.52.72.62.42.11.91.82.02.22.52.72.82.83.02.92.52.01.20.90.70.60.50.40.30.20.20.10.12.62.62.52.32.12.02.02.32.73.13.33.22.92.62.32.22.22.52.83.23.43.33.02.72.52.52.73.03.64.34.64.13.53.02.92.92.93.23.84.54.64.23.63.22.82.21.41.00.80.60.50.40.30.20.20.10.14.54.43.83.23.03.03.13.23.74.55.24.84.03.43.23.23.23.33.74.65.34.94.13.53.43.53.63.84.25.05.44.84.23.83.73.73.73.94.35.05.14.54.13.63.02.31.61.10.80.70.50.40.30.20.20.10.15.45.04.33.93.73.73.84.04.44.95.55.14.54.13.93.73.84.04.44.95.45.14.54.13.93.84.04.65.46.06.35.85.14.33.83.73.94.65.46.06.25.74.83.83.02.21.51.00.70.60.40.40.30.20.10.10.16.26.05.44.53.93.63.74.25.36.16.76.35.54.43.73.53.64.15.26.16.66.35.44.33.63.33.33.94.96.26.65.74.53.53.02.93.13.74.76.06.25.14.03.12.51.81.20.80.60.40.30.30.20.20.10.10.16.66.24.83.73.02.62.52.63.14.04.84.33.22.62.32.22.22.43.03.94.74.23.12.42.01.81.71.61.71.91.51.81.61.41.41.31.31.41.51.81.91.91.91.81.71.40.90.50.30.30.20.20.20.10.10.10.12.01.91.61.51.41.31.31.41.51.81.51.81.61.51.41.41.41.51.71.91.61.91.81.71.51.51.51.61.82.11.82.01.81.71.71.61.71.71.92.12.22.12.12.22.01.71.20.70.40.30.30.20.20.10.10.10.11.82.22.01.81.81.81.92.02.22.42.42.52.42.32.22.32.32.42.62.72.72.82.72.62.62.72.82.93.03.13.13.13.13.13.03.13.13.13.02.92.92.82.92.92.82.41.70.90.40.40.30.30.20.20.10.10.13.23.23.23.33.33.33.53.73.73.83.93.94.04.04.04.14.24.34.34.34.34.44.44.44.54.74.84.94.94.94.95.05.05.05.15.35.35.24.84.54.13.93.83.83.73.32.41.10.60.40.40.30.20.20.10.10.10.14.95.05.15.25.35.55.85.96.05.95.96.06.16.16.26.46.56.56.36.26.16.16.16.26.56.66.86.96.86.76.66.66.66.76.86.96.86.76.35.65.14.64.54.74.64.33.31.50.80.60.60.40.20.20.10.10.10.16.76.66.76.76.97.27.47.47.57.47.37.47.47.37.57.77.77.77.67.17.07.17.17.17.37.77.87.97.97.47.47.57.57.37.47.87.37.57.06.15.65.25.05.35.35.24.22.01.00.80.70.40.30.20.10.10.10.17.37.47.57.57.47.98.27.68.48.17.98.28.38.18.18.58.68.68.48.08.07.87.98.18.38.58.68.68.68.78.88.58.59.08.88.28.38.07.68.07.16.05.65.95.95.85.22.51.21.10.90.50.30.20.10.10.10.18.98.68.58.89.48.88.57.68.69.510.39.89.710.210.28.99.29.18.910.19.79.09.09.710.18.99.19.29.010.210.19.49.410.09.88.48.68.27.88.37.26.25.96.26.56.55.02.31.41.31.00.50.30.20.10.10.10.110.49.59.29.410.29.38.77.68.69.310.09.59.39.69.48.68.78.68.58.78.58.18.08.38.38.58.68.68.68.28.18.08.07.97.88.18.07.87.26.35.85.76.06.67.07.05.12.41.51.30.90.40.30.20.10.10.10.18.18.07.97.97.88.18.48.18.48.17.88.08.17.87.88.28.18.07.97.47.27.27.27.17.27.77.87.77.77.47.27.27.27.17.27.37.27.06.55.85.35.35.96.87.27.05.42.00.91.10.80.40.30.20.10.10.10.17.27.27.27.17.17.47.57.47.67.47.27.27.27.17.27.27.27.16.96.86.56.46.36.46.56.66.76.76.66.46.26.16.16.06.06.05.95.75.24.84.44.55.36.26.97.15.22.51.51.41.00.50.30.20.20.10.10.16.36.16.06.06.06.06.16.16.15.95.85.85.75.65.55.55.55.45.25.04.84.84.84.74.64.64.74.64.54.34.34.24.24.03.93.83.73.63.33.03.03.34.35.56.36.65.52.71.41.31.10.60.40.30.20.10.10.14.34.24.24.14.03.93.93.93.93.83.73.73.63.53.53.43.43.33.23.13.13.02.92.92.92.82.82.82.72.72.62.62.52.42.42.32.22.12.01.92.02.53.65.05.96.25.72.91.21.11.00.60.40.30.20.20.10.12.62.62.52.52.52.52.42.52.42.42.32.32.32.32.22.22.22.12.12.12.12.12.02.02.02.02.02.02.02.02.01.91.91.91.91.81.71.71.71.71.82.43.45.05.96.25.22.61.10.90.80.60.40.30.20.20.10.12.02.02.02.02.12.12.12.12.12.12.12.22.22.22.22.22.22.22.22.32.32.32.32.32.42.42.42.42.52.52.52.52.52.52.52.52.52.52.52.42.52.83.95.26.16.25.02.51.00.80.80.60.40.30.20.20.10.12.62.62.62.72.82.92.93.03.13.13.23.23.33.33.43.43.53.53.53.53.63.63.73.73.73.84.04.04.14.04.14.14.24.14.24.24.44.34.23.93.84.04.75.86.46.45.22.81.10.80.80.60.40.30.20.10.10.14.14.24.44.44.54.64.85.05.15.15.15.25.35.35.45.55.75.75.75.55.55.55.65.65.85.96.26.26.26.16.06.06.06.06.16.26.46.26.05.65.25.15.46.26.86.75.83.21.31.00.90.70.40.30.20.10.10.16.16.16.26.36.46.66.86.97.07.07.06.97.07.07.17.27.37.27.27.16.96.86.96.97.07.37.57.27.57.37.07.07.07.07.07.47.57.07.16.45.85.65.86.56.96.76.23.81.41.21.10.70.40.30.20.10.10.17.27.17.27.27.27.57.97.68.08.07.67.77.97.87.68.18.27.58.17.77.57.67.67.67.68.08.37.68.38.07.87.87.77.88.08.18.47.67.97.47.06.56.36.77.27.26.03.41.51.41.20.60.40.20.20.10.10.17.98.07.98.08.38.48.68.68.78.79.09.08.99.19.48.88.68.78.49.19.58.98.79.19.88.98.69.08.59.610.19.29.09.410.29.18.68.87.98.68.77.37.07.37.67.56.03.41.71.41.10.60.30.20.20.10.10.110.09.89.29.210.110.08.99.39.29.310.510.29.910.010.69.48.99.18.59.39.88.98.79.09.58.68.47.88.38.78.98.48.18.38.68.28.27.17.97.46.96.66.77.27.77.46.03.61.01.01.00.50.30.20.20.10.10.18.98.78.38.28.58.48.68.68.88.68.38.48.48.38.18.38.57.68.37.87.57.67.57.57.37.88.07.38.07.57.27.27.37.17.07.47.57.07.26.65.95.96.37.07.47.45.93.21.61.41.20.60.30.20.20.10.10.17.37.27.37.37.27.37.77.77.87.87.47.47.57.47.37.67.67.27.57.26.96.86.86.76.87.07.17.07.06.86.66.46.46.36.46.56.56.36.15.85.55.45.86.57.06.85.93.61.51.41.30.70.40.30.20.10.10.16.76.56.46.46.36.56.56.66.66.56.46.36.36.26.26.26.36.26.15.85.75.55.45.45.45.45.55.45.45.14.94.84.84.74.64.64.64.54.44.14.14.45.26.16.66.25.63.61.41.11.10.70.40.30.20.10.10.14.94.84.74.64.54.44.54.54.54.34.24.24.34.24.24.24.24.24.13.93.83.73.63.53.43.43.43.53.33.13.13.02.92.92.92.92.82.82.82.83.00.30.20.10.10.12.82.72.62.62.52.52.52.42.42.42.42.52.62.72.83.03.13.23.13.03.02.82.62.52.32.42.32.32.22.22.12.02.02.12.22.22.02.22.42.63.00.20.20.10.10.11.41.41.31.31.31.31.21.21.21.31.41.72.12.63.03.63.94.14.04.03.93.63.23.02.42.72.52.42.32.32.12.02.12.32.52.82.63.03.33.74.10.20.20.10.10.10.80.70.70.70.70.70.70.70.70.81.11.72.53.64.65.76.56.86.56.66.35.65.14.33.63.43.53.43.12.72.62.72.72.73.24.05.77.66.35.36.00.20.20.10.10.10.50.50.40.40.50.60.91.52.64.29.714.015.115.214.014.710.39.710.26.88.45.83.13.22.72.02.22.92.41.71.83.17.28.66.05.37.80.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.10.10.10.10.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.10.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.00.20.10.10.10.10.10.20.10.10.10.10.10.20.20.10.10.10.10.20.20.10.10.10.10.20.20.10.10.10.10.20.20.10.10.10.10.20.20.10.10.10.00.30.20.10.10.10.02.61.91.00.60.50.81.72.83.03.13.32.52.02.12.32.72.32.22.62.72.32.42.82.80.30.20.10.10.10.01.31.21.62.52.72.42.53.03.23.33.12.92.82.62.01.30.90.81.11.82.42.72.82.52.42.53.33.61.71.81.81.81.81.71.81.81.71.80.40.20.10.10.10.02.61.81.71.81.92.02.12.12.32.32.22.22.11.81.51.31.01.01.21.41.71.91.91.81.92.53.85.11.41.31.31.31.21.21.21.21.21.30.40.20.10.10.10.12.21.91.71.61.61.71.81.91.91.91.91.81.71.71.61.51.51.51.51.61.71.71.71.82.12.84.05.31.71.51.41.21.11.00.90.80.81.01.42.43.64.34.64.02.31.81.91.71.10.70.40.20.10.10.10.12.42.32.22.12.22.32.52.62.62.62.52.52.42.42.42.52.62.82.72.62.62.62.72.73.03.64.75.53.12.41.91.51.21.00.90.80.80.91.32.13.13.74.03.62.62.42.31.91.30.80.40.20.10.10.10.13.53.53.63.73.63.73.94.24.24.04.04.04.24.14.04.04.34.54.34.14.14.24.34.44.54.95.66.46.56.25.74.73.62.82.11.61.21.00.90.90.91.31.92.63.33.73.73.33.12.82.21.40.70.30.20.10.10.10.15.15.25.45.55.45.45.55.85.85.65.65.75.95.85.75.65.85.95.85.55.55.65.65.75.86.06.46.96.96.55.85.14.33.42.72.11.71.61.41.31.31.62.02.63.44.04.34.23.93.52.41.30.50.20.20.10.10.10.16.36.26.56.66.46.36.66.76.76.76.46.56.76.66.36.46.76.56.66.35.96.16.16.26.26.36.86.96.96.76.05.64.94.03.32.92.82.72.52.32.22.32.73.34.24.85.24.84.63.92.30.80.40.30.20.20.10.10.16.76.76.86.86.76.66.86.66.56.66.66.66.66.56.56.46.36.05.95.86.05.75.45.45.75.85.55.55.55.35.75.54.84.23.93.84.14.24.03.63.53.63.84.55.35.96.05.75.23.91.50.70.40.30.20.20.10.10.15.55.85.35.25.35.34.44.64.54.34.84.74.44.44.84.43.83.93.63.53.93.33.03.03.33.52.93.03.12.93.53.73.84.14.44.75.15.35.24.94.64.64.95.66.46.86.76.14.52.61.00.70.60.40.30.20.10.10.12.42.52.22.02.12.11.92.02.01.81.71.61.51.51.61.61.61.41.61.41.31.11.01.01.21.31.51.71.82.22.63.03.64.24.65.25.85.86.05.65.25.45.76.16.66.96.44.92.71.41.10.90.70.40.20.10.10.10.11.21.00.90.90.91.11.21.20.91.31.21.00.90.80.91.21.20.81.21.21.10.80.70.70.91.21.41.41.52.12.52.93.54.35.05.35.35.35.25.25.65.55.76.06.36.65.23.61.91.21.21.00.60.30.20.10.10.10.11.21.00.90.80.91.11.21.10.91.21.21.00.80.81.01.21.20.91.01.11.00.90.70.80.91.11.21.11.11.51.82.12.53.13.83.73.23.43.23.34.14.34.75.05.35.33.71.81.20.91.00.60.40.20.10.10.10.10.01.00.90.80.80.80.90.80.70.60.70.70.70.70.70.80.80.70.50.50.60.60.60.60.60.60.60.60.50.50.60.70.80.91.21.41.41.51.01.71.92.43.03.74.24.54.22.11.11.20.90.60.30.20.20.10.10.10.10.00.50.50.50.50.50.50.40.30.30.30.40.40.40.50.40.40.30.30.30.30.30.40.40.40.40.30.30.30.30.30.30.40.50.70.91.21.31.01.62.02.32.73.13.43.12.01.01.01.10.80.40.20.20.10.10.10.10.00.00.30.30.30.30.30.30.30.20.20.20.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.50.60.91.21.31.11.41.82.12.32.42.21.60.80.70.80.90.50.30.20.10.10.10.10.00.00.00.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.20.20.20.20.20.20.20.20.20.20.20.20.30.40.50.70.70.70.70.81.11.41.51.51.20.60.50.50.60.50.30.20.10.10.10.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.40.40.40.50.60.70.80.90.80.50.30.30.40.40.30.20.20.10.10.10.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.30.30.40.50.50.50.40.20.20.20.30.30.20.20.10.10.10.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.30.30.30.30.20.10.20.20.20.20.10.10.10.10.10.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.00.00.00.00.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0OUTLOT(1.3 AC)OUTLOT(1.4 AC)OUTLOT(1.0 AC)FS TSTS TS COMP. BCOMP. CFS TSTS TS FS TSTS TS ±243,500 SF614 PARKSPROPOSED WOODMAN'SFOOD MARKETCONCRETE WALK18"16"18"18"16"STMSTMSTSTSTMSTATE ROUTE "59"3.44.75.86.35.53.62.11.00.80.70.53.85.15.96.45.43.11.71.00.80.60.44.35.45.96.65.72.81.61.20.80.50.43.74.55.56.36.65.02.41.61.30.80.40.34.45.05.96.76.84.52.31.51.20.70.40.34.55.16.16.66.50.02.31.31.00.60.40.33.74.85.96.76.84.62.11.41.20.80.40.32.74.25.66.56.75.02.11.31.20.90.40.32.13.75.56.36.65.52.11.11.00.90.50.31.93.65.46.46.65.02.00.90.90.80.50.31.83.65.46.56.65.01.90.90.80.80.50.31.83.55.36.46.65.22.10.90.90.80.50.32.03.65.36.26.55.52.41.11.10.90.50.32.44.05.46.46.75.02.21.21.20.90.40.33.34.65.86.66.94.92.21.31.10.80.40.34.24.96.06.66.65.12.40.70.90.70.40.33.74.75.66.46.84.92.21.31.20.90.40.32.53.95.26.26.55.42.51.21.20.90.50.31.93.45.06.06.45.72.71.00.90.90.50.31.63.04.86.06.45.32.50.90.80.80.50.31.42.94.76.06.35.32.60.90.70.70.60.41.52.94.65.96.35.53.01.00.80.80.60.43.14.75.86.15.93.61.11.01.00.60.32.23.64.96.06.45.73.31.31.21.10.60.33.04.35.36.26.75.63.11.41.21.00.50.33.54.65.56.36.55.61.91.51.00.90.40.34.15.26.26.85.83.31.51.21.10.50.33.34.76.06.66.13.71.41.21.10.60.42.94.55.96.36.44.31.41.01.00.70.43.14.76.06.56.23.91.30.80.80.70.43.64.86.06.56.13.91.30.80.80.70.44.14.75.96.36.24.21.40.80.80.80.53.84.55.76.16.34.91.71.01.10.80.53.14.35.56.26.34.51.71.21.20.90.52.64.15.56.46.44.21.81.31.20.80.42.94.15.56.16.00.02.01.21.10.80.53.03.95.16.06.24.11.91.41.41.00.62.43.44.55.45.74.31.91.51.61.20.71.82.94.14.75.24.62.21.61.71.40.90.30.30.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.33.54.65.86.45.84.52.61.20.90.80.60.40.20.2APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETEngineering Ÿ Design Ÿ ConsultingEngineering with Precision, Pace & Passion.Structural | Mechanical/Electrical/PlumbingCivil | Land Survey | Telecommunication | AquaticAccessibility Consulting | Design & Program Management2675 Pratum Avenue | Hoffman Estates, IL 60192P: 224.293.6333 | F: 224.293.6444wtengineering.comIL License No: 184.007570-0015 | Exp: 04.30.2025 COPYRIGHT 2023 THE W-T GROUP, LLC©MAR K O. VENTRELLISTATE OF I LL I N OISENGINEER PROFESSIONALREGISTERED062-050025PROJECTNORTHEP1.1PLANPHOTOMETRICStatisticsDescriptionSymbolAvgMaxMinMax/MinAvg/MinCalc Zone #12.5 fc32.4 fc0.0 fcN/AN/AScheduleSymbolLabelImageQuantityManufacturerCatalog NumberDescriptionNumber LampsLumens Per LampLight Loss FactorWattagePlotA30Lithonia LightingDSX2 LED 100C 1000 40K T2M MVOLTDSX2 LED WITH 100 LEDs @1000mA, 4000K, TYPE 2 MEDIUM OPTICS1365501360B16Lithonia LightingDSX2 LED 100C 1000 40K T2M MVOLTDSX2 LED WITH 100 LEDs @1000mA, 4000K, TYPE 2 MEDIUM OPTICS1365501720C42Lithonia LightingWPX1 LED P2 50K MvoltWPX1 LED wallpack 3000lm 5000K color temperature 120-277 Volts12954123.68D21Sternberg Lighting1480LED-1L40T3-MDL10--FA-HSSDel Mar Nautical Series, Medium contempoary downlight, Frosted Acrylic, Type 315215159.1E36LSI INDUSTRIES, INCCRUS-SC-LED-SS-CW-UE1135521114F21American Electric LightingATB2 60BLEDE10 XXXXX R2ATB2 SERIES 208W LED 1050MA TYPE 2 4000K CCT12370912081 1 1.6258 0.20.10.10.10.10.01.41.41.31.41.51.41.11.31.31.00.70.50.40.40.71.01.52.12.73.42.80.60.30.30.20.10.10.10.10.00.90.91.01.21.31.01.21.41.31.11.11.11.21.21.21.31.31.31.31.51.51.11.41.51.51.51.51.61.61.01.51.31.00.80.60.40.50.81.31.82.93.44.54.00.80.50.40.20.10.10.10.10.00.10.10.10.30.50.81.01.11.11.11.11.21.31.21.31.31.11.11.11.11.21.30.81.41.51.51.61.92.22.42.62.82.92.92.82.82.62.32.52.62.73.13.43.63.13.02.72.62.62.41.71.20.90.91.11.62.23.84.45.25.41.10.80.50.30.20.10.10.10.10.20.20.20.40.91.51.82.02.02.12.32.12.01.32.22.42.62.62.73.12.92.52.82.62.73.33.54.35.25.86.26.56.77.16.76.45.75.15.45.66.07.17.37.36.66.16.05.45.34.93.62.61.91.61.61.92.54.35.05.86.10.70.50.50.30.20.10.10.10.10.30.30.40.71.62.53.13.53.84.34.94.64.64.94.95.46.05.85.96.15.75.25.45.15.46.27.19.812.913.314.614.714.415.712.68.97.47.47.37.88.18.48.68.38.38.27.87.46.45.34.33.32.52.01.82.02.64.04.55.45.31.10.70.50.30.20.10.10.10.10.40.50.60.92.33.64.34.74.95.15.35.86.46.46.96.97.07.27.16.76.86.96.66.86.77.09.516.424.924.026.726.223.927.119.010.67.87.27.37.57.67.67.97.98.08.18.17.46.45.14.03.22.52.01.81.92.53.54.15.04.31.00.50.50.30.20.20.10.10.10.60.70.81.33.24.65.15.35.14.94.85.45.96.36.46.46.46.76.76.56.46.46.56.36.37.110.319.230.429.632.131.728.331.021.211.27.36.26.36.36.16.46.56.56.77.27.46.95.94.63.42.72.21.81.71.82.33.13.94.33.50.90.40.40.30.20.20.10.10.10.70.91.01.74.15.35.45.44.84.34.14.34.85.25.25.25.45.65.65.45.25.45.65.45.36.49.818.329.429.431.231.227.729.119.710.16.04.84.54.34.14.04.04.34.95.76.26.15.33.82.42.01.81.51.41.62.13.03.94.03.21.00.40.30.30.20.20.10.10.10.81.21.21.84.55.65.55.14.13.12.82.93.23.53.53.43.63.94.14.14.14.34.44.24.25.18.416.727.527.929.930.026.627.918.59.04.83.32.72.52.32.12.22.53.24.45.25.45.13.41.81.41.41.31.31.52.03.03.94.13.31.10.40.30.30.20.20.10.10.10.81.21.31.84.16.05.84.83.62.41.71.61.71.81.81.92.32.83.53.94.14.14.03.53.34.17.215.025.426.328.028.225.025.617.58.44.12.31.71.31.21.21.31.62.43.74.85.25.43.71.51.31.31.11.21.52.23.24.04.53.81.10.50.50.30.20.20.10.10.10.61.01.21.94.26.05.95.03.52.01.20.90.80.80.91.01.52.64.45.15.85.65.03.42.73.56.614.325.326.828.629.625.927.518.98.74.02.11.31.00.80.80.91.42.33.75.05.65.53.61.51.41.41.01.11.62.43.64.35.15.01.30.70.60.30.20.20.10.10.10.71.01.21.94.36.05.85.03.41.91.00.70.50.50.50.71.22.24.45.03.02.43.26.414.426.528.329.631.026.828.420.29.24.12.01.20.80.70.70.81.32.54.15.46.35.53.31.61.41.30.91.11.72.64.15.15.66.21.70.90.60.30.20.20.20.10.10.81.21.21.84.16.05.64.53.21.80.90.60.50.40.50.61.01.83.33.92.62.23.16.113.826.128.429.030.826.328.120.69.54.22.01.20.80.60.60.71.32.64.45.96.45.83.71.10.91.10.91.11.82.64.35.55.96.61.50.60.70.30.20.20.20.10.10.81.01.01.94.65.55.24.53.11.91.10.70.60.50.50.60.91.51.92.52.42.23.05.813.024.026.727.228.424.926.320.29.74.32.01.10.80.60.60.71.32.64.56.06.86.13.71.71.41.30.91.11.72.43.94.85.55.91.60.80.60.40.20.20.20.10.10.70.80.81.84.35.25.34.83.52.31.41.00.80.70.50.60.91.21.22.22.42.22.95.713.125.227.928.830.925.827.621.510.14.42.11.20.80.60.50.71.32.54.25.96.86.44.11.61.41.41.01.11.52.13.34.14.94.81.40.60.50.30.20.20.20.10.10.50.60.61.43.44.75.55.84.72.91.61.61.40.90.60.60.91.41.73.32.52.12.85.512.624.427.928.731.226.227.521.510.24.42.11.20.80.60.60.71.22.44.26.06.76.94.81.61.21.31.11.11.31.92.83.74.33.91.40.50.40.30.30.20.20.10.10.40.40.51.12.62.92.11.10.70.61.01.83.03.62.42.02.75.312.023.427.127.329.625.326.120.610.14.52.11.20.80.60.60.71.22.44.36.27.07.04.71.61.11.21.11.01.21.72.53.64.03.51.50.50.40.30.30.20.20.10.10.30.30.40.92.03.82.51.30.80.71.22.13.62.11.92.65.311.822.726.627.129.425.226.321.610.64.62.21.20.80.60.60.71.12.34.36.27.17.04.71.71.11.11.11.01.21.72.53.43.93.61.60.50.40.40.30.20.20.20.10.30.40.40.81.73.12.81.60.80.71.22.43.41.51.82.65.312.124.428.728.631.526.628.023.211.34.82.31.20.80.60.60.71.12.34.15.96.76.95.11.81.21.21.11.01.31.82.73.44.04.11.90.60.50.40.30.20.20.20.10.40.50.50.81.73.32.91.60.90.81.32.23.61.31.72.75.211.824.029.028.531.727.028.223.411.44.92.31.30.80.60.60.71.12.33.95.76.66.84.91.81.41.41.11.01.31.92.93.84.35.12.50.80.60.40.30.30.20.20.20.40.60.70.92.03.82.71.51.00.91.32.13.52.51.51.31.41.62.03.05.411.322.227.426.929.225.926.322.311.45.02.41.30.80.60.60.71.12.34.05.66.76.74.31.91.41.41.11.01.42.13.14.54.75.83.61.00.80.50.30.30.30.20.20.50.80.91.02.75.15.96.86.43.72.22.62.31.41.01.11.52.32.92.42.12.32.52.83.13.86.011.723.129.228.131.627.427.724.112.05.22.41.30.80.60.60.71.12.34.05.76.56.34.51.71.01.11.01.01.52.13.14.95.06.12.30.70.80.50.40.30.30.20.20.51.01.21.22.85.46.56.65.63.82.11.61.61.31.21.41.92.53.03.03.23.64.14.44.45.07.112.723.829.829.032.428.027.924.212.35.22.41.30.80.60.60.71.02.13.85.36.26.34.02.01.41.31.01.01.41.92.84.24.45.63.51.00.90.60.40.40.30.30.30.41.01.21.32.55.16.66.04.83.31.91.21.11.11.31.62.12.83.54.04.44.95.55.85.66.28.013.324.630.628.831.927.327.524.512.25.12.31.30.90.70.60.71.02.03.34.75.86.04.31.91.51.51.21.01.31.72.53.33.84.82.50.90.80.60.50.50.50.50.60.40.80.90.82.95.26.25.94.73.01.71.00.91.01.21.62.23.03.84.55.05.86.26.36.66.68.012.722.928.025.928.524.024.222.411.24.72.21.31.00.80.80.81.11.83.14.55.15.74.82.21.51.51.31.11.31.62.22.83.53.82.21.10.90.90.70.70.80.91.00.51.01.21.42.85.16.25.74.52.91.71.10.91.01.11.52.12.83.84.85.45.65.85.65.96.57.510.417.020.419.020.817.116.114.78.03.82.21.61.41.21.11.11.31.93.04.45.15.54.52.41.71.61.41.31.41.72.22.93.53.52.51.51.31.21.11.11.21.41.60.61.21.31.32.95.15.95.34.22.91.91.31.11.11.11.31.72.33.03.94.54.04.14.23.94.75.46.48.710.110.110.28.97.96.84.63.02.22.02.01.91.71.61.72.23.14.25.05.24.42.72.11.91.81.61.72.02.53.13.63.62.92.11.91.81.71.71.92.22.40.81.21.21.43.55.35.35.14.23.12.31.81.51.31.31.31.51.82.32.72.92.92.92.82.72.83.13.94.85.45.65.55.04.43.83.12.72.52.62.72.62.52.42.32.63.44.45.15.24.53.32.72.42.32.32.32.53.13.74.14.13.63.02.82.52.52.62.83.34.00.81.11.21.53.24.95.25.14.33.52.92.52.22.11.91.82.12.52.93.33.73.73.42.83.13.13.33.64.04.44.44.24.03.63.33.03.13.54.04.34.13.73.33.23.54.14.85.66.35.94.63.63.02.92.93.03.33.64.25.05.75.34.23.53.33.43.53.74.04.70.91.11.21.63.04.55.05.15.04.74.53.93.32.92.82.93.03.44.35.25.65.14.33.84.04.04.04.45.05.55.34.84.23.83.73.73.84.24.85.55.14.44.04.04.34.65.15.56.16.04.94.13.73.43.33.43.74.14.65.15.75.44.54.13.83.73.84.35.15.71.01.11.31.72.94.14.85.05.05.25.34.63.93.63.63.73.94.24.75.55.85.14.64.24.24.24.34.85.76.66.25.24.64.24.04.14.45.05.66.05.75.24.64.24.24.65.46.36.96.96.05.03.93.33.03.13.54.15.26.26.76.55.64.63.73.43.33.74.45.61.11.31.51.82.63.64.45.05.65.85.95.44.84.23.83.74.04.75.66.36.45.95.24.44.04.14.55.46.47.26.96.25.14.33.83.84.15.16.26.96.55.34.23.63.33.53.94.86.06.25.03.72.92.42.22.22.52.83.54.45.45.23.92.92.32.01.81.71.71.91.31.61.71.92.43.03.64.35.26.16.45.94.63.53.02.83.03.64.65.96.15.14.03.33.13.33.85.37.28.48.16.54.83.52.72.42.22.12.32.22.32.01.81.81.71.81.92.02.12.11.91.71.51.51.41.51.61.82.02.12.22.01.81.71.61.61.51.61.82.01.61.92.02.02.02.12.12.12.12.11.51.71.31.11.00.90.91.01.11.31.31.21.21.11.31.31.52.23.74.44.63.93.02.31.91.71.71.92.11.92.32.01.91.92.02.12.22.42.62.52.52.32.22.22.22.42.42.62.72.83.02.92.72.62.52.62.72.93.03.12.63.33.63.12.62.22.12.01.91.91.31.41.00.80.60.60.50.60.81.01.00.90.80.80.91.01.22.04.14.95.24.53.52.72.42.52.83.13.23.33.33.33.33.33.43.53.83.93.93.93.93.93.93.93.94.14.34.44.44.34.34.34.34.34.44.54.74.95.04.93.13.94.33.63.02.62.42.21.91.71.41.20.90.70.60.50.50.50.60.60.70.70.70.81.01.21.42.45.06.05.95.74.84.14.04.34.74.95.05.05.15.25.35.35.55.65.96.06.05.95.95.95.96.06.16.36.56.56.46.26.05.95.96.06.26.46.76.76.86.84.24.95.14.63.93.02.41.91.51.21.00.80.70.60.50.40.40.40.40.40.40.50.50.71.21.51.62.55.46.56.66.55.95.65.65.96.46.56.86.86.76.76.86.87.07.27.47.47.57.47.17.27.27.27.37.67.77.77.57.16.96.86.86.96.97.47.87.57.97.63.95.25.64.63.42.41.81.41.10.80.70.60.50.40.40.30.30.30.30.30.30.40.50.61.11.61.72.44.97.37.57.26.86.36.16.87.37.27.77.57.37.47.67.57.57.98.27.68.38.07.88.08.18.08.08.48.68.58.47.97.87.57.47.78.18.28.57.88.68.50.71.01.00.90.80.60.60.50.40.40.30.30.30.20.20.20.20.20.20.20.30.30.40.50.91.41.62.54.97.48.08.07.67.37.47.68.07.18.38.59.08.78.58.99.58.98.57.68.69.310.19.59.49.810.29.09.09.18.79.89.78.78.58.910.09.48.69.28.99.50.50.80.50.70.50.30.30.30.20.20.20.20.20.20.20.20.20.20.20.20.20.30.40.50.81.21.52.55.27.68.48.58.28.39.18.68.28.88.69.310.39.49.19.410.29.38.67.68.69.29.99.29.09.39.48.68.68.58.38.58.47.87.67.98.28.28.57.68.78.30.40.50.50.50.40.30.20.20.20.20.10.10.10.10.10.10.10.10.20.20.20.30.40.50.91.51.62.34.97.68.38.07.67.37.27.48.07.38.48.17.97.97.87.97.88.08.38.08.38.07.67.87.97.77.68.08.07.37.97.37.07.06.96.96.97.37.77.47.87.60.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.50.91.41.52.25.57.68.08.07.26.56.16.67.17.07.57.47.07.17.17.17.17.47.57.37.57.37.17.07.07.07.07.17.27.06.96.66.46.26.16.16.26.46.66.66.66.40.10.10.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.60.91.21.32.05.37.58.07.86.96.05.65.76.06.26.36.16.05.95.95.95.95.96.16.06.05.85.75.65.65.55.45.45.45.35.24.94.74.64.64.64.54.54.64.64.64.40.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.60.91.11.21.84.77.27.87.56.34.94.13.94.14.24.14.04.04.04.03.93.93.93.93.93.83.73.63.63.53.53.43.33.33.23.23.03.02.92.92.82.82.82.82.82.72.70.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.60.91.11.11.74.57.07.57.05.53.92.92.52.42.42.42.42.42.42.42.42.42.42.42.42.32.32.32.32.22.22.22.22.12.12.02.12.02.02.02.02.02.02.02.02.02.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.60.91.21.21.74.76.97.06.55.13.52.41.91.81.71.81.81.91.91.91.92.02.02.02.02.02.12.12.12.12.12.12.12.12.12.12.12.12.22.22.22.32.32.42.42.52.50.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.20.20.30.40.50.91.31.41.74.46.87.26.75.33.82.72.22.12.22.32.42.42.52.62.72.72.82.93.03.03.03.13.13.13.23.23.23.33.33.33.33.33.33.43.53.63.63.84.04.14.10.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.20.20.30.30.50.81.41.61.83.86.57.87.36.24.83.73.43.53.73.83.94.04.14.34.44.54.64.84.95.04.95.05.05.15.15.15.15.35.45.45.25.25.25.25.35.45.75.96.16.26.20.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.20.20.30.40.61.11.11.64.16.67.98.17.36.25.45.25.55.86.06.06.06.06.16.26.36.66.76.87.06.86.86.76.76.86.87.07.16.97.06.86.66.56.46.56.66.97.27.47.57.50.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.20.20.30.40.61.21.41.93.86.78.38.37.86.96.26.36.77.17.37.37.17.17.27.27.27.47.87.68.07.97.57.57.67.67.47.78.07.67.97.57.07.17.17.27.37.58.08.28.38.20.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.40.71.31.61.83.76.78.38.37.87.36.76.87.57.98.18.17.87.97.98.08.38.48.68.68.78.68.88.88.68.79.08.78.57.48.38.59.08.48.08.39.19.38.48.88.88.70.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.40.71.21.41.64.17.18.18.48.28.08.48.77.98.58.68.610.09.89.29.310.110.08.79.39.19.210.410.09.59.610.59.68.88.08.69.09.78.78.28.28.99.08.28.48.48.30.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.50.71.11.21.53.76.98.28.68.48.08.28.37.78.28.38.38.88.78.38.38.58.58.68.68.78.58.28.28.18.28.18.28.57.58.37.87.37.27.17.17.17.27.87.87.87.80.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.50.71.01.11.43.46.68.28.48.07.26.66.67.47.67.77.87.47.37.47.47.27.47.87.87.87.77.37.27.37.27.17.47.67.27.47.16.66.56.46.46.46.66.87.07.06.80.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.50.71.01.11.43.46.68.08.27.76.76.16.26.66.97.07.06.96.76.76.66.66.76.76.76.76.56.36.26.16.16.16.16.26.16.15.75.55.35.15.15.05.15.25.35.35.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.40.71.11.21.43.66.87.67.77.16.05.35.15.35.65.75.75.75.65.65.45.15.04.94.84.64.44.24.14.14.14.03.94.03.93.83.63.43.33.33.23.13.03.13.13.02.90.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.40.71.21.41.53.16.17.57.36.35.14.13.84.04.44.54.75.14.95.04.84.14.03.53.12.82.52.32.22.22.12.12.12.12.02.01.91.81.71.71.61.61.61.51.51.51.40.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.30.40.61.11.41.52.65.57.47.06.14.73.73.53.84.54.75.46.46.26.25.74.64.13.32.31.71.41.21.11.11.11.11.01.01.00.90.90.90.90.90.90.80.80.80.80.70.70.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.50.91.00.91.65.56.86.85.94.63.73.84.46.710.010.29.711.713.712.69.46.03.01.81.10.80.70.70.70.60.60.60.60.50.50.50.60.60.60.50.50.50.50.50.50.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.50.91.21.42.45.17.16.65.64.33.63.94.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.51.01.31.32.45.36.86.55.44.23.74.44.30.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.30.50.91.11.12.55.76.76.35.44.13.64.46.30.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.60.80.91.02.25.36.76.45.53.93.04.48.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.40.60.80.80.92.05.16.76.55.54.13.33.44.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.60.80.91.02.15.26.66.45.54.03.02.91.90.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.50.91.01.12.35.56.56.25.43.92.92.61.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.50.91.21.22.14.96.76.45.44.13.12.71.80.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.81.21.32.04.76.86.65.84.43.43.32.60.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.60.90.91.24.76.56.65.94.53.73.96.90.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.71.21.31.94.46.76.65.64.43.74.79.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.81.21.21.84.86.56.35.64.44.14.910.40.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.81.01.01.75.06.56.35.74.54.25.310.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.50.70.80.81.54.46.46.55.94.74.35.28.80.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.50.70.80.81.34.26.36.55.94.74.14.910.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.70.90.91.44.36.36.45.94.74.25.16.90.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.30.40.71.01.01.54.56.36.35.84.74.25.16.40.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.40.71.21.21.53.86.16.65.84.94.45.16.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.51.11.21.63.65.96.76.25.14.34.78.60.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.30.50.90.80.93.65.86.66.25.24.45.010.38.70.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.51.11.21.43.15.66.65.94.94.34.99.78.40.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.61.11.21.33.55.86.15.74.63.94.37.67.50.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.30.60.90.91.13.45.86.05.74.73.94.36.25.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.20.20.40.60.80.71.02.85.36.15.74.73.73.74.73.70.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.20.20.40.60.70.70.92.65.06.05.74.63.43.03.63.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.20.20.40.60.70.70.92.65.26.05.64.63.22.52.41.70.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.20.20.30.60.90.91.02.95.55.95.54.53.02.01.50.90.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.51.01.11.12.75.36.15.74.53.01.81.00.60.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.51.01.21.22.24.86.45.84.73.21.80.90.60.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.40.81.00.92.44.96.26.04.93.42.01.20.80.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.30.30.40.81.11.22.14.66.25.74.73.22.11.61.30.10.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.30.40.50.50.61.01.31.31.94.45.75.24.12.92.02.02.40.30.30.40.50.50.50.40.40.40.40.50.50.60.60.60.60.60.50.50.50.60.70.70.80.80.91.21.31.22.04.65.14.63.92.72.02.12.80.50.60.80.91.00.90.80.80.70.70.81.01.21.31.31.21.00.90.80.91.01.11.31.41.31.31.41.31.11.83.84.64.33.72.51.81.92.11.61.11.22.12.51.60.90.60.71.22.33.02.62.93.12.31.81.70.81.01.21.51.61.61.41.31.21.21.41.61.92.12.11.91.71.51.41.41.61.82.02.01.91.71.61.41.21.63.24.03.83.22.41.71.41.31.01.32.22.72.11.20.70.64.63.52.21.51.62.02.11.71.10.81.01.42.02.32.52.52.32.43.03.31.21.51.92.32.52.42.32.12.01.92.22.63.03.43.43.12.72.42.22.32.52.93.33.53.12.62.11.71.51.72.63.23.12.72.11.51.11.01.01.21.61.61.51.20.90.84.94.63.02.11.51.51.41.41.31.21.01.11.31.51.71.81.92.02.22.52.51.72.13.03.94.43.93.32.92.93.03.13.54.25.05.04.23.53.33.33.33.33.74.44.84.13.22.62.21.91.82.22.62.62.31.81.41.11.01.11.21.31.31.31.21.21.25.34.53.02.11.71.61.51.51.61.61.61.61.61.71.81.92.02.22.42.52.52.22.73.34.24.74.23.83.63.53.63.84.24.65.25.24.64.13.83.73.74.04.54.95.24.74.03.22.52.01.71.92.12.22.01.81.61.51.51.61.71.81.81.81.92.02.35.24.63.62.92.62.52.52.52.72.92.92.82.82.82.93.03.13.33.63.73.61.72.33.34.55.35.85.44.73.83.43.43.74.65.66.36.25.54.43.63.33.33.84.85.86.25.54.33.12.31.81.51.61.82.02.12.12.22.32.73.03.13.13.13.23.53.74.25.46.46.15.95.44.84.44.34.14.04.14.44.74.64.44.54.74.84.74.74.85.25.45.21.11.52.13.24.55.14.33.12.31.91.81.82.02.63.43.32.41.81.51.41.31.31.41.91.31.81.31.11.00.91.01.21.62.02.52.93.33.64.14.74.94.74.95.15.45.76.26.87.17.36.96.46.15.95.95.75.65.65.86.16.05.95.96.16.26.16.06.16.36.56.40.20.30.50.60.80.50.80.60.50.40.40.50.60.81.00.90.70.60.40.40.40.50.60.90.60.90.60.50.50.60.71.11.62.22.83.64.24.65.25.86.16.06.06.26.56.76.87.07.37.37.37.06.56.66.66.46.26.36.76.66.86.76.46.66.76.66.46.76.86.76.90.10.20.30.50.70.60.60.40.30.30.30.30.40.60.70.70.60.40.30.30.30.40.50.60.70.70.60.50.40.50.71.01.52.22.93.84.55.05.96.26.46.66.56.66.86.86.86.87.06.86.86.76.66.56.36.26.36.26.05.95.85.96.26.15.95.96.15.65.35.45.10.10.20.30.30.40.40.40.30.30.20.20.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.40.40.40.60.81.21.82.53.44.34.94.84.95.14.95.55.65.25.25.45.24.44.64.44.34.84.44.14.14.44.23.53.73.43.33.73.43.13.23.52.92.61.52.40.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.40.50.71.01.42.02.63.02.42.52.52.22.52.42.12.02.12.11.92.02.01.81.71.51.31.31.41.41.51.61.51.41.21.11.11.11.11.21.31.01.30.10.10.10.10.10.10.10.10.20.20.20.20.10.10.10.10.10.10.20.10.20.20.10.10.10.10.10.10.20.20.20.30.30.40.50.70.91.01.21.20.71.21.21.00.90.91.01.11.31.21.21.31.10.90.80.80.91.11.21.01.11.21.10.90.80.81.01.21.20.91.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.30.50.71.01.21.10.91.21.21.00.80.80.91.11.21.01.01.21.10.90.80.80.91.11.20.90.91.11.00.90.80.81.01.11.00.80.90.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.30.50.70.91.00.90.70.90.90.90.80.80.80.90.80.60.60.70.70.70.70.70.70.70.60.50.50.50.60.60.60.60.60.60.50.40.40.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.30.40.40.50.50.40.40.40.50.50.50.50.50.50.40.30.30.40.40.40.40.40.40.40.30.30.30.30.30.40.40.40.30.30.30.30.30.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.20.20.30.30.20.20.20.20.30.30.30.30.30.30.30.20.20.20.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.20.20.20.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.20.20.20.20.20.20.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.02.0%PROPOSEDSTORMWATEROUTLOT(1.0 AC)OUTLOT(1.0 AC)OUTLOT(1.0 AC)OUTLOT(2.0 AC)VANVANVANGENTS GENTS GENTS STATE ROUTE "59"GRAVELCONCRETE WALKW. 119TH ST.GRAVELGRAVELCONCRETE FLUMECONCRETEASPHALTACCESS POINT1-STORYMETALBUILDING2,463 SF.ASPHALTVVMVVV24" MULTI10"48"#2HUBVMVVSTST72.5'34.1'72.0'34.1'PROPOSEDGAS & LUBEPROPOSEDCAR WASH±243,500 SF614 PARKSPROPOSED WOODMAN'SFOOD MARKETAPPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETEngineering Ÿ Design Ÿ ConsultingEngineering with Precision, Pace & Passion.Structural | Mechanical/Electrical/PlumbingCivil | Land Survey | Telecommunication | AquaticAccessibility Consulting | Design & Program Management2675 Pratum Avenue | Hoffman Estates, IL 60192P: 224.293.6333 | F: 224.293.6444wtengineering.comIL License No: 184.007570-0015 | Exp: 04.30.2025 COPYRIGHT 2023 THE W-T GROUP, LLC©MAR K O. VENTRELLISTATE OF I LL I N OISENGINEER PROFESSIONALREGISTERED062-050025PROJECTNORTHEP1.2PLANPHOTOMETRICStatisticsDescriptionSymbolAvgMaxMinMax/MinAvg/MinCalc Zone #12.5 fc32.4 fc0.0 fcN/AN/AScheduleSymbolLabelImageQuantityManufacturerCatalog NumberDescriptionNumber LampsLumens Per LampLight Loss FactorWattagePlotA30Lithonia LightingDSX2 LED 100C 1000 40K T2M MVOLTDSX2 LED WITH 100 LEDs @1000mA, 4000K, TYPE 2 MEDIUM OPTICS1365501360B16Lithonia LightingDSX2 LED 100C 1000 40K T2M MVOLTDSX2 LED WITH 100 LEDs @1000mA, 4000K, TYPE 2 MEDIUM OPTICS1365501720C42Lithonia LightingWPX1 LED P2 50K MvoltWPX1 LED wallpack 3000lm 5000K color temperature 120-277 Volts12954123.68D21Sternberg Lighting1480LED-1L40T3-MDL10--FA-HSSDel Mar Nautical Series, Medium contempoary downlight, Frosted Acrylic, Type 315215159.1E36LSI INDUSTRIES, INCCRUS-SC-LED-SS-CW-UE1135521114F21American Electric LightingATB2 60BLEDE10 XXXXX R2ATB2 SERIES 208W LED 1050MA TYPE 2 4000K CCT1237091208259 APPROVED2023-229CHECKEDDRAWNA74321BCDE56ABCDE7432156WOODMAN'SFOOD MARKETEngineering Ÿ Design Ÿ ConsultingEngineering with Precision, Pace & Passion.Structural | Mechanical/Electrical/PlumbingCivil | Land Survey | Telecommunication | AquaticAccessibility Consulting | Design & Program Management2675 Pratum Avenue | Hoffman Estates, IL 60192P: 224.293.6333 | F: 224.293.6444wtengineering.comIL License No: 184.007570-0015 | Exp: 04.30.2025 COPYRIGHT 2023 THE W-T GROUP, LLC©MAR K O. VENTRELLISTATE OF I LL I N OISENGINEER PROFESSIONALREGISTERED062-050025PROJECTNORTHEP1.3DIAGRAMSDETAILS & BELOW FINAL GRADE18" MINIMUM.24" UNDERDRIVEWAY &PARKING AREA6'-0"3'-0"1" MIN.EXPOSED CONCRETETO HAVE RUBBEDFINISH260 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 1 of 7 Control options Other options Finish (required) Shipped installed NLTAIR2 nLight AIR generation 2 enabled10 PER NEMA twist-lock receptacle only (no controls) 11 PER5 Five-wire receptacle only (no controls) 11,12 PER7 Seven-wire receptacle only (no controls) 11,12 DMG 0-10V dimming extend out back of housing for external control (no controls) DS Dual switching 13,14 PIRH Bi-level, motion/ambient sensor, 15-30’ mounting height, ambient sensor enable at 5fc 5.15 PIRHN Network, Bi-Level motion/ambient sensor16 PIRH1FC3V Bi-level, motion sensor, 15’-30’ mounting height, ambient sensor enabled at 1fc 5.15 BL30 Bi-level switched dimming, 30% 5,13,17 BL50 Bi-level switched dimming, 50% 5,13,17 PNMTDD3 Part night, dim till dawn 5,18 PNMT5D3 Part night, dim 5 hrs 5,18 PNMT6D3 Part night, dim 6 hrs 5,18 PNMT7D3 Part night, dim 7 hrs 5,18 FAO Field Adjustable Output 19 Shipped installed HS House-side shield 20 SF Single fuse (120, 277, 347V) 6 DF Double fuse (208, 240, 480V) 6 L90 Left rotated optics 1 R90 Right rotated optics 1 Shipped separately BS Bird spikes21 EGS External glare shield21 DDBXD Dark bronze DBLXD Black DNAXD Natural aluminum DWHXD White DDBTXD Textured dark bronze DBLBXD Textured black DNATXD Textured natural aluminum DWHGXD Textured white D-Series Size 2LED Area Luminaire Specifications Ordering Information EXAMPLE: DSX2 LED P7 T3M MVOLT SPA DDBXD Catalog Number Notes Type EPA:1.1 ft2 (0.10 m2) Length:40” (101.6 cm) Width:15” (38.1 cm) Height:7-1/4” (18.4 cm) Weight (max):36 lbs(16.3 kg) Hit the Tab key or mouse over the page to see all interactive elements. W L H DSX2 LED Series LEDs Color temperature Distribution Voltage Mounting DSX2 LED Forward optics P1 P5 P2 P6 P3 P7 P4 P8 Rotated optics1 P10 P13 P11 P14 P12 30K 3000 K 40K 4000 K 50K 5000 K AMBPC Amber phosphor converted2,3 T1S Type I Short T5VS Type V Very Short T2S Type II Short T5S Type V Short T2M Type II Medium T5M Type V Medium T3S Type III Short T5W Type V Wide T3M Type III Medium BLC Backlight control2,3 T4M Type IV Medium LCCO Left corner cutoff2,3 TFTM Forward Throw Medium RCCO Right corner cutoff2,3 MVOLT 4,5 120 6 208 5,6 240 5,6 277 6 347 5,6,7 480 5,6,7 Shipped included SPA Square pole mounting RPA Round pole mounting WBA Wall bracket SPUMBA Square pole universal mounting adaptor 8 RPUMBA Round pole universal mounting adaptor 8 Shipped separately KMA8 DDBXD U Mast arm mounting bracket adaptor (specify finish) 9 Capable Luminaire This item is an A+ capable luminaire, which has been designed and tested to provide consistent color appearance and system-level interoperability. • All configurations of this luminaire meet the Acuity Brands’ specification for chromatic consistency • This luminaire is A+ Certified when ordered with DTL® controls marked by a shaded background. DTL DLL equipped luminaires meet the A+ specification for luminaire to photocontrol interoperability1 • This luminaire is part of an A+ Certified solution for ROAM® or XPoint™ Wireless control networks, providing out-of-the-box control compatibility with simple commissioning, when ordered with drivers and control options marked by a shaded background1 To learn more about A+, visit www.acuitybrands.com/aplus. 1. See ordering tree for details. 2. A+ Certified Solutions for ROAM require the order of one ROAM node per luminaire. Sold Separately: Link to Roam; Link to DTL DLLA+ Capable options indicated by this color background. A & B 261 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 2 of 7 Drilling To see complete photometric reports or download .ies files for this product, visit Lithonia Lighting’s D-Series Area Size 2 homepage. Photometric Diagrams Isofootcandle plots for the DSX2 LED 80C 1000 40K. Distances are in units of mounting height (30’). LEGEND 0.1 fc 0.5 fc 1.0 fc Test No. LTL22434P1 tested in accordance with IESNA LM-79-08.4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T3M Test No. LTL22425P1 tested in accordance with IESNA LM-79-08.4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T1S Test No. LTL22428P1 tested in accordance with IESNA LM-79-08.4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 Test No. LTL22430P1 tested in accordance with IESNA LM-79-08.4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T5WT4M Top of Pole 0.563” 2.650” 1.325”0.400”(2 PLCS) Template #8 Tenon O.D.Single Unit 2 at 180°2 at 90°3 at 120°3 at 90°4 at 90° 2-3/8”AST20-190 AST20-280 AST20-290 AST20-320 AST20-390 AST20-490 2-7/8”AST25-190 AST25-280 AST25-290 AST25-320 AST25-390 AST25-490 4”AST35-190 AST35-280 AST35-290 AST35-320 AST35-390 AST35-490 Tenon Mounting Slipfitter ** Ordering Information NOTES1 P10, P11, P12 or P14 and rotated optics (L90, R90) only available together.2 AMBPC not available with BLC, LCCO, RCCO, HS or P5, P7, P8, P13 or P14.3 Not available with HS.4 MVOLT driver operates on any line voltage from 120-277V (50/60 Hz).5 Any PIRx with BL30, BL50 or PNMT, is not available with 208V, 240V, 347V, 480V or MVOLT. It is only available in 120V or 277V specified. 6 Single fuse (SF) requires 120V, 277V or 347V. Double fuse (DF) requires 208V, 240V or 480V.7 Not available with BL30, BL50 or PNMT options.8 Existing drilled pole only. Available as a separate combination accessory; for retrofit use only: PUMBA (finish) U; 1.5 G vibration load rating per ANCI C136.31.9 Must order fixture with SPA otion.Must be ordered as a separate accessory; see Accessories information. For use with 2-3/8” mast arm (not included).10 Must be ordered with PIRHN. 11 Photocell ordered and shipped as a separate line item from Acuity Brands Controls. See accessories. Not available with DS option. Shorting Cap included.12 If ROAM® node required, it must be ordered and shipped as a separate line item from Acuity Brands Controls. Node with integral dimming. Shorting Cap included.13 Requires (2) separately switched circuits. See Outdoor Control Technical Guide for details.14 Provides 50/50 fixture operation via (2) independent drivers. Not available with PER, PER5, PER7, PIR or PIRH.15 Reference Motion Sensor table on page 3.16 Must be ordered with NLTAIR2. For more information on nLight Air 2 visit this link.17 Not available with 347V, 480V, DS and PNMT. For PER5 or PER7 see PER Table on page 3. Requires isolated neutral.18 Not available with 347V, 480V, DS, BL30, BL50. For PER5 or PER7 see PER Table on page 3. Separate Dusk to Dawn required.19 Not available with other dimming controls options.20 Not available with BLC, LCCO and RCCO distribution. Also available as a separate accessory; see Accessories information.21 Must be ordered with fixture for factory pre-drilling. 22 Requires luminaire to be specified with PER, PER5 and PER7 option. Ordered and shipped as a separate line item from Acuity Brands Controls.23 For retrofit use only. Accessories Ordered and shipped separately. DLL127F 1.5 JU Photocell - SSL twist-lock (120-277V) 22 DLL347F 1.5 CUL JU Photocell - SSL twist-lock (347V) 22 DLL480F 1.5 CUL JU Photocell - SSL twist-lock (480V) 22 DSHORT SBK U Shorting cap 22 DSX2HS 80C U House-side shield for 80 LED unit 20 DSX2HS 90C U House-side shield for 90 LED unit 20 DSX2HS 100C U House-side shield for 100 LED unit 20 PUMBA DDBXD U*Square and round pole universal mounting bracket (specify finish) 23 KMA8 DDBXD U Mast arm mounting bracket adaptor (specify finish) 8 For more control options, visit DTL and ROAM online. External Glare Shield 14.1019.05 .50 4.25 .50 73˚ 12.05 12.476 HANDHOLE ORIENTATION AHandhole B C D Pole drilling nomenclature: # of heads at degree from handhole (default side A) DM19AS DM28AS DM29AS DM32AS DM39AS DM49AS 1 @ 90°2 @ 280°2 @ 90°3 @ 120°3 @ 90°4 @ 90° Side B Side B & D Side B & C Round pole only Side B, C, & D Sides A, B, C, D Note: Review luminaire spec sheet for specific nomenclature Pole top or tenon O.D.4.5" @ 90°4" @ 90°3.5" @ 90°3" @ 90°4.5" @ 120°4" @ 120°3.5" @ 120°3" @ 120° DSX SPA Y Y Y N ---- DSX RPA Y Y N N Y Y Y Y DSX SPUMBA Y N N N ---- DSX RPUMBA N N N N Y Y Y N *3 fixtures @120 require round pole top/tenon. 262 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 3 of 7 Performance Data Use these factors to determine relative lumen output for average ambient temperatures from 0-40°C (32-104°F). Lumen Ambient Temperature (LAT) Multipliers Ambient Lumen Multiplier 0°C 32°F 1.04 5°C 41°F 1.04 10°C 50°F 1.03 15°C 50°F 1.02 20°C 68°F 1.01 25°C 77°F 1.00 30°C 86°F 0.99 35°C 95°F 0.98 40°C 104°F 0.97 Projected LED Lumen Maintenance Data references the extrapolated performance projections for the platforms noted in a 25°C ambient, based on 10,000 hours of LED testing (tested per IESNA LM-80-08 and projected per IESNA TM-21-11). To calculate LLF, use the lumen maintenance factor that corresponds to the desired number of operating hours below. For other lumen maintenance values, contact factory. Operating Hours 0 25000 50000 100000 Lumen Maintenance Factor 1.00 0.96 0.92 0.85 Motion Sensor Default Settings Option Dimmed State High Level (when triggered)Phototcell Operation Dwell Time Ramp-up Time Ramp-down Time PIR or PIRH 3V (37%) Output 10V (100%) Output Enabled @ 5FC 5 min 3 sec 5 min *PIR1FC3V or PIRH1FC3V 3V (37%) Output 10V (100%) Output Enabled @ 1FC 5 min 3 sec 5 min *for use with Inline Dusk to Dawn or timer. PER Table Control PER (3 wire) PER5 (5 wire)PER7 (7 wire) Wire 4/Wire5 Wire 4/Wire5 Wire 6/Wire7 Photocontrol Only (On/Off)Wired to dimming leads on driver Wired to dimming leads on driver Wires Capped inside fixture ROAM Wired to dimming leads on driver Wired to dimming leads on driver Wires Capped inside fixture ROAM with Motion (ROAM on/off only)Wires Capped inside fixture Wires Capped inside fixture Wires Capped inside fixture Future-proof*Wired to dimming leads on driver Wired to dimming leads on driver Wires Capped inside fixture Future-proof* with Motion Wires Capped inside fixture Wires Capped inside fixture Wires Capped inside fixture Recommended Will not work Alternate *Future-proof means: Ability to change controls in the future. Current (A) Performance Package LED Count Drive Current Wattage 120 208 240 277 347 480 Forward Optics (Non-Rotated) P1 80 530 140 1.18 0.68 0.59 0.51 0.40 0.32 P2 80 700 185 1.56 0.90 0.78 0.66 0.52 0.39 P3 80 850 217 1.82 1.05 0.90 0.80 0.63 0.48 P4 80 1050 270 2.27 1.31 1.12 0.99 0.79 0.59 P5 80 1250 321 2.68 1.54 1.34 1.17 0.93 0.68 P6 100 1050 343 2.89 1.66 1.59 1.37 1.00 0.71 P7 100 1250 398 3.31 1.91 1.66 1.45 1.16 0.81 P8 100 1350 431 3.61 2.07 1.81 1.57 1.25 0.91 Rotated Optics (Requires L90 or R90) P10 90 530 156 1.30 0.76 0.65 0.62 0.45 0.32 P11 90 700 207 1.75 1.01 0.87 0.74 0.60 0.46 P12 90 850 254 2.12 1.22 1.06 0.94 0.73 0.55 P13 90 1200 344 2.88 1.65 1.44 1.25 1.00 0.73 P14 90 1400 405 3.39 1.95 1.71 1.48 1.18 0.86 Electrical Load 263 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 4 of 7 Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of the configurations shown, within the tolerances allowed by Lighting Facts. Contact factory for performance data on any configurations not shown here. Lumen Output Forward Optics LED Count Drive Current Power Package System Watts Dist.Type 30K (3000 K, 70 CRI) 40K (4000 K, 70 CRI) 50K (5000 K, 70 CRI) AMBPC (Amber Phosphor Converted) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW 80 530 P1 140W T1S 17,575 3 0 3 126 18,933 3 0 3 135 19,173 3 0 3 137 10,578 2 0 2 78 T2S 17,556 3 0 3 125 18,913 3 0 3 135 19,152 3 0 3 137 10,554 2 0 2 77 T2M 17,647 3 0 3 126 19,010 3 0 3 136 19,251 3 0 3 138 10,571 2 0 2 77 T3S 17,090 3 0 3 122 18,411 3 0 3 132 18,644 3 0 3 133 10,548 2 0 2 77 T3M 17,604 3 0 3 126 18,964 3 0 3 135 19,204 3 0 3 137 10,569 2 0 2 77 T4M 17,221 3 0 3 123 18,552 3 0 4 133 18,787 3 0 4 134 10,547 2 0 2 77 TFTM 17,593 3 0 3 126 18,952 3 0 4 135 19,192 3 0 4 137 10,741 1 0 2 78 T5VS 18,297 4 0 1 131 19,711 4 0 1 141 19,961 4 0 1 143 11,155 3 0 0 81 T5S 18,312 4 0 2 131 19,727 4 0 2 141 19,977 4 0 2 143 11,149 3 0 0 81 T5M 18,266 4 0 2 130 19,677 4 0 2 141 19,926 4 0 2 142 11,096 3 0 2 81 T5W 18,146 5 0 3 130 19,548 5 0 3 140 19,796 5 0 3 141 10,957 3 0 2 80 BLC 14,424 2 0 2 103 15,539 2 0 3 111 15,736 2 0 3 112 LCCO 10,733 1 0 3 77 11,562 1 0 3 83 11,709 2 0 3 84 RCCO 10,733 1 0 3 77 11,562 1 0 3 83 11,709 2 0 3 84 80 700 P2 185W T1S 22,305 3 0 3 121 24,029 3 0 3 130 24,333 3 0 3 132 13,147 2 0 2 71 T2S 22,281 3 0 4 120 24,003 3 0 4 130 24,307 3 0 4 131 13,116 2 0 2 70 T2M 22,396 3 0 3 121 24,127 3 0 3 130 24,432 3 0 3 132 13,138 2 0 2 70 T3S 21,690 3 0 4 117 23,366 3 0 4 126 23,662 3 0 4 128 13,110 2 0 2 70 T3M 22,342 3 0 4 121 24,068 3 0 4 130 24,373 3 0 4 132 13,135 2 0 3 70 T4M 21,857 3 0 4 118 23,545 3 0 4 127 23,844 3 0 4 129 13,108 2 0 2 70 TFTM 22,328 3 0 4 121 24,054 3 0 4 130 24,358 3 0 4 132 13,349 2 0 2 71 T5VS 23,222 5 0 1 126 25,016 5 0 1 135 25,333 5 0 1 137 13,864 3 0 1 74 T5S 23,241 4 0 2 126 25,037 4 0 2 135 25,354 4 0 2 137 13,856 3 0 1 74 T5M 23,182 5 0 3 125 24,974 5 0 3 135 25,290 5 0 3 137 13,790 3 0 2 73 T5W 23,030 5 0 4 124 24,810 5 0 4 134 25,124 5 0 4 136 13,617 4 0 2 72 BLC 18,307 2 0 3 99 19,721 2 0 3 107 19,971 2 0 3 108 LCCO 13,622 2 0 3 74 14,674 2 0 4 79 14,860 2 0 4 80 RCCO 13,622 2 0 3 74 14,674 2 0 4 79 14,860 2 0 4 80 80 850 P3 217W T1S 26,202 3 0 3 121 28,226 3 0 3 130 28,584 3 0 3 132 17,833 3 0 3 66 T2S 26,174 3 0 4 121 28,196 3 0 4 130 28,553 3 0 4 132 17,791 3 0 3 66 T2M 26,309 3 0 3 121 28,342 3 0 3 131 28,700 3 0 3 132 17,821 3 0 3 66 T3S 25,479 3 0 4 117 27,448 3 0 4 126 27,795 3 0 4 128 17,782 3 0 3 66 T3M 26,245 3 0 4 121 28,273 3 0 4 130 28,631 3 0 4 132 17,817 3 0 3 66 T4M 25,675 3 0 4 118 27,659 3 0 4 127 28,009 3 0 4 129 17,779 3 0 3 66 TFTM 26,229 3 0 4 121 28,255 3 0 4 130 28,613 3 0 4 132 18,107 3 0 3 67 T5VS 27,279 5 0 1 126 29,387 5 0 1 135 29,759 5 0 1 137 18,805 4 0 1 70 T5S 27,301 4 0 2 126 29,410 5 0 2 136 29,783 5 0 2 137 18,794 4 0 1 70 T5M 27,232 5 0 3 125 29,336 5 0 3 135 29,707 5 0 3 137 18,705 4 0 2 69 T5W 27,053 5 0 4 125 29,144 5 0 4 134 29,513 5 0 4 136 18,470 5 0 3 68 BLC 21,504 2 0 3 99 23,166 2 0 3 107 23,459 2 0 4 108 LCCO 16,001 2 0 4 74 17,238 2 0 4 79 17,456 2 0 4 80 RCCO 16,001 2 0 4 74 17,238 2 0 4 79 17,456 2 0 4 80 80 1050 P4 270W T1S 30,963 4 0 4 115 33,355 4 0 4 124 33,777 4 0 4 125 T2S 30,930 4 0 4 115 33,320 4 0 4 123 33,742 4 0 4 125 T2M 31,089 3 0 4 115 33,491 3 0 4 124 33,915 3 0 4 126 T3S 30,108 4 0 4 112 32,435 4 0 5 120 32,845 4 0 5 122 T3M 31,014 3 0 4 115 33,410 3 0 4 124 33,833 3 0 4 125 T4M 30,340 3 0 5 112 32,684 3 0 5 121 33,098 3 0 5 123 TFTM 30,995 3 0 5 115 33,390 3 0 5 124 33,812 3 0 5 125 T5VS 32,235 5 0 1 119 34,726 5 0 1 129 35,166 5 0 1 130 T5S 32,261 5 0 2 119 34,754 5 0 2 129 35,194 5 0 2 130 T5M 32,180 5 0 4 119 34,667 5 0 4 128 35,105 5 0 4 130 T5W 31,969 5 0 4 118 34,439 5 0 5 128 34,875 5 0 5 129 BLC 25,412 2 0 4 94 27,376 2 0 4 101 27,722 2 0 4 103 LCCO 18,909 2 0 4 70 20,370 2 0 4 75 20,628 2 0 4 76 RCCO 18,909 2 0 4 70 20,370 2 0 4 75 20,628 2 0 4 76 264 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 5 of 7 Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of the configurations shown, within the tolerances allowed by Lighting Facts. Contact factory for performance data on any configurations not shown here. Lumen Output Forward Optics LED Count Drive Current Power Package System Watts Dist.Type 30K (3000 K, 70 CRI) 40K (4000 K, 70 CRI) 50K (5000 K, 70 CRI) AMBPC (Amber Phosphor Converted) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW 80 1250 P5 321W T1S 35,193 4 0 4 110 37,912 4 0 4 118 38,392 4 0 4 120 T2S 35,155 4 0 5 110 37,872 4 0 5 118 38,351 4 0 5 119 T2M 35,336 4 0 4 110 38,067 4 0 4 119 38,549 4 0 4 120 T3S 34,222 4 0 5 107 36,866 4 0 5 115 37,333 4 0 5 116 T3M 35,251 3 0 4 110 37,974 3 0 5 118 38,455 4 0 5 120 T4M 34,485 3 0 5 107 37,149 4 0 5 116 37,620 4 0 5 117 TFTM 35,229 3 0 5 110 37,951 3 0 5 118 38,431 3 0 5 120 T5VS 36,639 5 0 1 114 39,470 5 0 1 123 39,970 5 0 1 125 T5S 36,669 5 0 2 114 39,502 5 0 2 123 40,002 5 0 2 125 T5M 36,576 5 0 4 114 39,403 5 0 4 123 39,901 5 0 4 124 T5W 36,336 5 0 5 113 39,144 5 0 5 122 39,640 5 0 5 123 BLC 28,884 3 0 4 90 31,115 3 0 4 97 31,509 3 0 4 98 LCCO 21,492 2 0 4 67 23,153 2 0 5 72 23,446 3 0 5 73 RCCO 21,492 2 0 4 67 23,153 2 0 5 72 23,446 3 0 5 73 100 1050 P6 343W T1S 37,824 4 0 4 110 40,747 4 0 4 119 41,263 4 0 4 120 21,838 1 0 1 64 T2S 37,784 4 0 5 110 40,704 4 0 5 119 41,219 4 0 5 120 21,787 1 0 1 64 T2M 37,979 4 0 4 111 40,913 4 0 4 119 41,431 4 0 4 121 21,824 1 0 1 64 T3S 36,780 4 0 5 107 39,623 4 0 5 116 40,124 4 0 5 117 21,776 1 0 1 63 T3M 37,886 3 0 5 110 40,814 4 0 5 119 41,331 4 0 5 120 21,819 1 0 1 64 T4M 37,063 4 0 5 108 39,927 4 0 5 116 40,433 4 0 5 118 22,175 1 0 1 65 TFTM 37,863 3 0 5 110 40,789 4 0 5 119 41,305 4 0 5 120 21,773 1 0 1 63 T5VS 39,379 5 0 1 115 42,422 5 0 1 124 42,959 5 0 1 125 23,029 2 0 0 67 T5S 39,411 5 0 2 115 42,456 5 0 2 124 42,993 5 0 2 125 23,016 2 0 0 67 T5M 39,311 5 0 4 115 42,349 5 0 4 123 42,885 5 0 4 125 22,906 2 0 1 67 T5W 39,053 5 0 5 114 42,071 5 0 5 123 42,604 5 0 5 124 22,619 2 0 1 66 BLC 31,043 3 0 4 91 33,442 3 0 4 97 33,865 3 0 4 99 LCCO 23,099 2 0 5 67 24,884 3 0 5 73 25,199 3 0 5 73 RCCO 23,099 2 0 5 67 24,884 3 0 5 73 25,199 3 0 5 73 100 1250 P7 398W T1S 42,599 4 0 4 107 45,890 4 0 4 115 46,471 4 0 4 117 T2S 42,553 4 0 5 107 45,842 4 0 5 115 46,422 4 0 5 117 T2M 42,773 4 0 4 107 46,078 4 0 4 116 46,661 4 0 5 117 T3S 41,423 4 0 5 104 44,624 4 0 5 112 45,189 4 0 5 114 T3M 42,669 4 0 5 107 45,966 4 0 5 115 46,548 4 0 5 117 T4M 41,742 4 0 5 105 44,967 4 0 5 113 45,537 4 0 5 114 TFTM 42,643 4 0 5 107 45,938 4 0 5 115 46,519 4 0 5 117 T5VS 44,350 5 0 1 111 47,777 5 0 1 120 48,381 5 0 1 122 T5S 44,385 5 0 2 112 47,815 5 0 3 120 48,420 5 0 3 122 T5M 44,273 5 0 4 111 47,695 5 0 4 120 48,298 5 0 4 121 T5W 43,983 5 0 5 111 47,382 5 0 5 119 47,982 5 0 5 121 BLC 34,962 3 0 4 88 37,664 3 0 5 95 38,140 3 0 5 96 LCCO 26,015 3 0 5 65 28,025 3 0 5 70 28,380 3 0 5 71 RCCO 26,015 3 0 5 65 28,025 3 0 5 70 28,380 3 0 5 71 100 1350 P8 448W T1S 45,610 4 0 4 106 49,135 4 0 4 114 49,757 4 0 4 115 T2S 45,562 4 0 5 106 49,083 4 0 5 114 49,704 4 0 5 115 T2M 45,797 4 0 4 106 49,336 4 0 5 114 49,960 4 0 5 116 T3S 44,352 4 0 5 103 47,779 4 0 5 111 48,384 4 0 5 112 T3M 45,686 4 0 5 106 49,216 4 0 5 114 49,839 4 0 5 116 T4M 44,693 4 0 5 104 48,147 4 0 5 112 48,756 4 0 5 113 TFTM 45,657 4 0 5 106 49,186 4 0 5 114 49,808 4 0 5 116 T5VS 47,485 5 0 1 110 51,155 5 0 1 119 51,802 5 0 1 120 T5S 47,524 5 0 3 110 51,196 5 0 3 119 51,844 5 0 3 120 T5M 47,404 5 0 4 110 51,067 5 0 5 118 51,713 5 0 5 120 T5W 47,093 5 0 5 109 50,732 5 0 5 118 51,374 5 0 5 119 BLC 37,434 3 0 5 87 40,326 3 0 5 94 40,837 3 0 5 95 LCCO 27,854 3 0 5 65 30,006 3 0 5 70 30,386 3 0 5 71 RCCO 27,854 3 0 5 65 30,006 3 0 5 70 30,386 3 0 5 71 265 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 6 of 7 Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of the configurations shown, within the tolerances allowed by Lighting Facts. Contact factory for performance data on any configurations not shown here. Lumen Output Rotated Optics LED Count Drive Current Power Package System Watts Dist. Type 30K (3000 K, 70 CRI) 40K (4000 K, 70 CRI) 50K (5000 K, 70 CRI) AMBPC (Amber Phosphor Converted) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW 90 530 P10 156W T1S 20,145 4 0 4 129 21,702 4 0 4 139 21,977 4 0 4 141 11,475 3 0 3 77 T2S 20,029 4 0 4 128 21,577 4 0 4 138 21,850 4 0 4 140 11,448 3 0 3 76 T2M 20,391 4 0 4 131 21,967 4 0 4 141 22,245 4 0 4 143 11,467 3 0 3 76 T3S 19,719 4 0 4 126 21,242 4 0 4 136 21,511 4 0 4 138 11,442 3 0 3 76 T3M 20,379 4 0 4 131 21,954 4 0 4 141 22,232 4 0 4 143 11,464 4 0 4 76 T4M 19,995 4 0 4 128 21,540 4 0 4 138 21,812 5 0 5 140 11,440 4 0 4 76 TFTM 20,511 4 0 4 131 22,096 5 0 5 142 22,376 5 0 5 143 11,651 4 0 4 78 T5VS 20,655 4 0 1 132 22,251 4 0 1 143 22,533 4 0 1 144 12,288 3 0 1 82 T5S 20,482 4 0 2 131 22,064 4 0 2 141 22,343 4 0 2 143 11,978 3 0 1 80 T5M 20,477 5 0 3 131 22,059 5 0 3 141 22,338 5 0 3 143 12,301 4 0 2 82 T5W 20,293 5 0 3 130 21,861 5 0 3 140 22,138 5 0 4 142 12,109 4 0 2 81 BLC 16,846 4 0 4 108 18,148 4 0 4 116 18,378 4 0 4 118 LCCO 12,032 2 0 3 77 12,961 2 0 3 83 13,125 2 0 3 84 RCCO 12,016 4 0 4 77 12,944 4 0 4 83 13,108 4 0 4 84 90 700 P11 207W T1S 25,518 4 0 4 123 27,490 4 0 4 133 27,837 4 0 4 134 14,387 3 0 3 70 T2S 25,371 5 0 5 123 27,331 5 0 5 132 27,677 5 0 5 134 14,354 3 0 3 70 T2M 25,829 4 0 4 125 27,825 4 0 4 134 28,177 4 0 4 136 14,378 4 0 4 70 T3S 24,977 5 0 5 121 26,907 5 0 5 130 27,248 5 0 5 132 14,347 4 0 4 70 T3M 25,814 5 0 5 125 27,809 5 0 5 134 28,161 5 0 5 136 14,374 4 0 4 70 T4M 25,327 5 0 5 122 27,284 5 0 5 132 27,629 5 0 5 133 14,344 4 0 4 70 TFTM 25,981 5 0 5 126 27,989 5 0 5 135 28,343 5 0 5 137 15,408 4 0 1 75 T5VS 26,164 5 0 1 126 28,185 5 0 1 136 28,542 5 0 1 138 15,019 4 0 1 73 T5S 25,943 4 0 2 125 27,948 5 0 2 135 28,302 5 0 2 137 15,424 4 0 2 75 T5M 25,937 5 0 3 125 27,941 5 0 3 135 28,295 5 0 3 137 14,609 4 0 4 71 T5W 25,704 5 0 4 124 27,691 5 0 4 134 28,041 5 0 4 135 15,182 4 0 2 74 BLC 21,339 4 0 4 103 22,988 4 0 4 111 23,279 4 0 4 112 LCCO 15,240 2 0 4 74 16,418 2 0 4 79 16,626 2 0 4 80 RCCO 15,220 5 0 5 74 16,396 5 0 5 79 16,604 5 0 5 80 90 850 P12 254W T1S 29,912 4 0 4 118 32,223 4 0 4 127 32,631 5 0 4 128 T2S 29,740 5 0 5 117 32,038 5 0 5 126 32,443 5 0 5 128 T2M 30,277 4 0 4 119 32,616 5 0 5 128 33,029 5 0 5 130 T3S 29,278 5 0 5 115 31,540 5 0 5 124 31,940 5 0 5 126 T3M 30,259 5 0 5 119 32,597 5 0 5 128 33,010 5 0 5 130 T4M 29,688 5 0 5 117 31,982 5 0 5 126 32,387 5 0 5 128 TFTM 30,455 5 0 5 120 32,808 5 0 5 129 33,224 5 0 5 131 T5VS 30,669 5 0 1 121 33,039 5 0 1 130 33,457 5 0 1 132 T5S 30,411 5 0 2 120 32,761 5 0 2 129 33,176 5 0 2 131 T5M 30,404 5 0 3 120 32,753 5 0 4 129 33,168 5 0 4 131 T5W 30,131 5 0 4 119 32,459 5 0 4 128 32,870 5 0 4 129 BLC 25,013 4 0 4 98 26,946 4 0 4 106 27,287 4 0 4 107 LCCO 17,865 2 0 4 70 19,245 2 0 4 76 19,489 2 0 4 77 RCCO 17,841 5 0 5 70 19,220 5 0 5 76 19,463 5 0 5 77 90 1200 P13 344W T1S 38,768 5 0 5 113 41,764 5 0 5 121 42,292 5 0 5 123 T2S 38,545 5 0 5 112 41,523 5 0 5 121 42,049 5 0 5 122 T2M 39,241 5 0 5 114 42,273 5 0 5 123 42,808 5 0 5 124 T3S 37,947 5 0 5 110 40,879 5 0 5 119 41,396 5 0 5 120 T3M 39,218 5 0 5 114 42,249 5 0 5 123 42,783 5 0 5 124 T4M 38,478 5 0 5 112 41,451 5 0 5 120 41,976 5 0 5 122 TFTM 39,472 5 0 5 115 42,522 5 0 5 124 43,060 5 0 5 125 T5VS 39,749 5 0 1 116 42,821 5 0 1 124 43,363 5 0 1 126 T5S 39,415 5 0 2 115 42,461 5 0 2 123 42,998 5 0 2 125 T5M 39,405 5 0 4 115 42,450 5 0 4 123 42,988 5 0 4 125 T5W 39,052 5 0 5 114 42,069 5 0 5 122 42,602 5 0 5 124 BLC 32,419 5 0 5 94 34,925 5 0 5 102 35,367 5 0 5 103 LCCO 23,154 3 0 5 67 24,943 3 0 5 73 25,259 3 0 5 73 RCCO 23,124 5 0 5 67 24,910 5 0 5 72 25,226 5 0 5 73 90 1400 P14 405W T1S 42,867 5 0 5 106 46,180 5 0 5 114 46,764 5 0 5 115 T2S 42,621 5 0 5 105 45,914 5 0 5 113 46,495 5 0 5 115 T2M 43,390 5 0 5 107 46,743 5 0 5 115 47,335 5 0 5 117 T3S 41,959 5 0 5 104 45,201 5 0 5 112 45,773 5 0 5 113 T3M 43,365 5 0 5 107 46,716 5 0 5 115 47,307 5 0 5 117 T4M 42,547 5 0 5 105 45,834 5 0 5 113 46,414 5 0 5 115 TFTM 43,646 5 0 5 108 47,018 5 0 5 116 47,614 5 0 5 118 T5VS 43,952 5 0 1 109 47,349 5 0 1 117 47,948 5 0 1 118 T5S 43,583 5 0 2 108 46,950 5 0 2 116 47,545 5 0 3 117 T5M 43,572 5 0 4 108 46,939 5 0 4 116 47,533 5 0 4 117 T5W 43,181 5 0 5 107 46,518 5 0 5 115 47,107 5 0 5 116 BLC 35,847 5 0 5 89 38,617 5 0 5 95 39,106 5 0 5 97 LCCO 25,602 3 0 5 63 27,580 3 0 5 68 27,930 3 0 5 69 RCCO 25,569 5 0 5 63 27,544 5 0 5 68 27,893 5 0 5 69 266 One Lithonia Way • Conyers, Georgia 30012 • Phone: 800.279.8041 • www.lithonia.com © 2011-2018 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 03/21/18 Page 7 of 7 FEATURES & SPECIFICATIONS INTENDED USE The sleek design of the D-Series Area Size 2 reflects the embedded high performance LED technology. It is ideal for applications like car dealerships and large parking lots adjacent to malls, transit stations, grocery stores, home centers, and other big-box retailers. CONSTRUCTION Single-piece die-cast aluminum housing has integral heat sink fins to optimize thermal management through conductive and convective cooling. Modular design allows for ease of maintenance and future light engine upgrades. The LED drivers are mounted in direct contact with the casting to promote low operating temperature and long life. Housing is completely sealed against moisture and environmental contaminants (IP65). Low EPA (1.1 ft2) for optimized pole wind loading. FINISH Exterior parts are protected by a zinc-infused Super Durable TGIC thermoset powder coat finish that provides superior resistance to corrosion and weathering. A tightly controlled multi-stage process ensures a minimum 3 mils thickness for a finish that can withstand extreme climate changes without cracking or peeling. Available in both textured and non-textured finishes. OPTICS Precision-molded proprietary acrylic lenses are engineered for superior area lighting distribution, uniformity, and pole spacing. Light engines are available in 3000 K, 4000 K, or 5000 K (70 CRI) configurations. The D-Series Size 2 has zero uplight and qualifies as a Nighttime FriendlyTM product, meaning it is consistent with the LEED® and Green GlobesTM criteria for eliminating wasteful uplight. ELECTRICAL Light engine configurations consist of high-efficacy LEDs mounted to metal-core circuit boards to maximize heat dissipation and promote long life (up to L85/100,000 hrs at 25°C). Class 1 electronic drivers are designed to have a power factor >90%, THD <20%, and an expected life of 100,000 hours with <1% failure rate. Easily-serviceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). INSTALLATION Included mounting block and integral arm facilitate quick and easy installation. Stainless steel bolts fasten the mounting block securely to poles and walls, enabling the D-Series Size 2 to withstand up to a 2.0 G vibration load rating per ANSI C136.31. The D-Series Size 2 utilizes the AERISTM series pole drilling pattern (Template #8). NEMA photocontrol receptacle is available. LISTINGS UL Listed for wet locations. Light engines are IP66 rated; luminaire is IP65 rated. Rated for -40°C minimum ambient. U.S. Patent No. D670,857 S. International patent pending. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/QPL to confirm which versions are qualified. International Dark-Sky Association (IDA) Fixture Seal of Approval (FSA) is available for all products on this page utilizing 3000K color temperature only. WARRANTY 5-year limited warranty. Complete warranty terms located at: www.acuitybrands.com/CustomerResources/Terms_and_conditions.aspx Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. 267 268 Catalog Number Notes Type CONTRACTOR SELECT WPX SERIES LED Page 1 of 2 WPX LED Wall packs The WPX LED wall packs are energy-efficient, cost-effective, and aesthetically appealing full-cut off solution for both new construction and HID wall pack replacement/renovation opportunities. Reliable IP66 construction and excellent LED lumen maintenance ensure a long service life. FEATURES: ¡Architectural design at very economical prices ¡Energy efficient - payback in less than two years ¡Wide range of configuration options available Luminaire CCT Lumens Input Watts Photocell Finish Voltage Catalog Number CI Code UPC Pallet qty.Replaces Up To WPX0 SWW2 3000K/ 4000K/ 5000K 850 - 1,650 6.4-13W Switchable On/Off DARK BRONZE 120-277V WPX0 LED ALO SWW2 MVOLT PE DDBXD M2 *276U4U 196182511806 280 70W Metal Halide WPX1 4000K 2,900 24W N/A DARK BRONZE 120-277V WPX1 LED P2 40K MVOLT DDBXD M4 *265SWK 193048870589 160 150W Metal Halide WPX2 4000K 6,000 47W N/A DARK BRONZE 120-277V WPX2 LED 40K MVOLT DDBXD M2 *265SX3 193048870756 120 250W Metal Halide 5000K 6,000 47W N/A DARK BRONZE 120-277V WPX2 LED 50K MVOLT DDBXD M2 *265SX6 193048870770 120 250W Metal Halide More configurations are available. Click here or visit www.acuitybrands.com and search for WPX LED. Contractor Select™ Note : WPX3 lumen package and all the WPX configuration options are not included in the Contractor Select program. For more information, please visit WPX LED. 269 One Lithonia Way, Conyers, GA 30012 | 1-800-705-7378 | www.lithonia.com © 2020-2023 Acuity Brands Lighting, Inc. All rights reserved. Rev. 08/09/23 Page 2 of 2CONTRACTOR SELECT WPX SERIES LED INTENDED USE:The WPX LED wall packs are designed to provide a cost-effective, energy-efficient solution for the one-for-one replacement of existing HID wall packs. The WPX0, WPX1, WPX2 and WPX3 are ideal for replacing up to 70W, 150W, 250W, and 400W HID luminaires respectively. WPX luminaires deliver a uniform, wide distribution. WPX is rated for -40ºC to 40ºC. CONSTRUCTION:WPX feature a die-cast aluminum main body with optimal thermal management that both enhances LED efficacy and extends component life. The luminaires are IP66 rated, and sealed against moisture or environmental contaminants. ELECTRICAL:Light engine(s) configurations consist of high-efficacy LEDs with a min LED lumen maintenance of L86/100,000 hours. Color temperature (CCT) options of 3000K, 4000K and 5000K with minimum CRI of 70 (80 for WPX0). Electronic drivers ensure system power factor >90% and THD <20%. All luminaires have 6kV surge protection (Note: WPX1 LED P1 package and WPX0 comes with a standard surge protection rating of 2.5kV). Note: The standard WPX LED wall pack luminaires come with field-adjustable drive current feature. This feature allows tuning the output current of the LED drivers to adjust the lumen output (to dim the luminaire). INSTALLATION:WPX can be mounted directly over a standard electrical junction box. A port on the back surface allows poke-through conduit wiring on surfaces that don't have an electrical junction box. WPX1, WPX2 and WPX3 come with three 1/2 inch conduit ports on three sides that allow for surface conduit wiring. Wiring can be made in the integral wiring compartment in all cases. WPX is only recommended for installations with LEDs facing downwards. LISTINGS:CSA Certified to meet U.S. and Canadian standards. Suitable for wet locations. IP66 Rated. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/QPL to confirm which versions are qualified. WARRANTY:5-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25°C. Specifications subject to change without notice. Specifications Dimensions All dimensions are inches (centimeters) unless otherwise indicated. Front View Side View w D u L ---- :::c: <( B Luminaire Height (H)Width (W)Depth (D)Side Conduit Location WeightAB WPX0 5.75” (14.6 cm)5.5” (14.0 cm)2” (5.1 cm)N/A N/A 2.5 lbs (1.1kg) WPX1 8.1” (20.6 cm)11.1” (28.3 cm)3.2” (8.1 cm)4.0” (10.3 cm)0.6” (1.6 cm)6.1 lbs (2.8kg) WPX2 9.1” (23.1 cm)12.3” (31.1 cm)4.1” (10.5 cm)4.5” (11.5 cm)0.7” (1.7 cm)8.2 lbs (3.7kg) WPX3 9.5” (24.1 cm) 13.0” (33.0 cm) 5.5” (13.7 cm) 4.7” (12.0 cm) 0.7” (1.7 cm) 11.0 lbs (5.0kg) 270 EPA 1.34 (ft2) WEIGHT38 LBS 7 YEAR WARRANTY LUMEN RANGE3,815 to 6,635 LIFE SPAN L70 MINIMUM 100,000 HOURS UL LISTED CHECK FOR FAQ’s IP RATING Mounting Configuration (Click here to link to mounting configuration specification page) •1W •3A •2AM•1A •3A90 •SH441 •2A •4A •CH441 •2A90 •1AM W = Wall Mount A = Arm Mount AM = Arm Mid-Mount SH = Stem Hung CH = Chain Hung 1 Include overall drop length in inches after designation for Stem/Chain application (IE: CH44-48”) Fixture • 1480LED LED • 1L CCT - Color Temperature (K) • 27(00) • 30(00) • 35(00) • 40(00) • 50(00) Distribution Type • T2 • T3 • T4 • T5 Driver • MDL07 (120v-277v, 700mA) • MDL10 (120v-277v, 1050mA) • MDH07 (347v-480v, 700mA)• MDH10 (347v-480v, 1050mA) Lens • A (Acrylic) • FA (Frosted Acrylic) Options (Click here to view accessories sheet) • R72 7-Pin control receptacle only • PE3 Twist-Lock Photocontrol (120v-277v) • PE33 Twist-Lock Photocontrol (347v) • PE43 Twist-Lock Photocontrol (480v) • SC3 Shorting Cap • FHD4 Double Fuse and Hold • HSHS Standard Horizontal Hangstraight, Spike Finial • HSHN Standard Horizontal Hangstraight, No Finial• HSHB Standard Horizontal Hangstraight, Ball Finial • EZ Vertical Hangstraight, Large, “EZ” Mount • HSS 120° House Side Shield 2 For use with “HSH_” hang straights only. 3 Requires control receptacle. 4 Ships loose for installation in base. Arm (Click here to link to arm specification page) See Arms & Wall Brackets specification sheets. • 50 • 80 • 6236 • TASCR • R35 • 478 • 480 • 579 • BA • 70 • 55 • TA • R25 5 Luminaires above grade height to be 2’ higher than pole height, REQUIRES “EZ” hangstraight. Pole (Click here to link to pole specification page) See Pole specification sheets. Finish (Click here to view paint finish sheet) Standard Finishes6 • BKT Black Textured • WHT White Textured • PGT Park Green Textured • ABZT Architectural Medium Bronze Textured • DBT Dark Bronze Textured 6 Smooth finishes are available upon request. Custom Finishes7 • CM Custom Match • OI Old Iron • RT Rust • WBR Weathered Brown • CD Cedar • WBK Weathered Black • TT Two Tone 7 Custom colors require upcharge. Sternberg Select Finishes • VG Verde Green • SI Swedish Iron • OWGT Old World Gray Textured Specifications Fixture The 1480 Del Mar fixture is a medium scale, contemporary down light with unique detail. It shall be 24” wide and the overall height shall be 28-1/ 2”. It shall be made of heavy wall cast aluminum, 356 alloy, extruded aluminum fabricated tube cage and flared aluminum shades around a large diameter acrylic tube lens. The Luminaire shall be UL listed in US and Canada. LED’s The luminaire shall use high output, high brightness LED’s, consisting of a two piece assembly complete with Chip on Board (COB) LED component and COB holder frame. The LED’s and printed circuit boards shall be 100% recyclable; they shall also be protected from moisture and corrosion by a conformal coating. They shall not contain lead, mercury or any other hazardous substances and shall be RoHS compliant. The LED life rating data shall be determined in accordance with IESNA LM-80. The High Performance white LED’s will have a life expectancy of approximately 100,000 hours with not less than 70% of original brightness (lumen maintenance), rated at 25°C. The High Brightness, High Output LED’s shall be 4000K (2700K, 3000K, 3500K or 5000K option) color temperature with a minimum of 70 CRI. Consult factory for custom color CCT. The luminaire shall have a minimum ______ (see table) delivered initial lumen rating when operated at steady state with an average ambient temperature of 25°C (77°F). Optics The luminaire shall be provided with individual, molded silicone refractor type optics applied to each COB (Chip On Board) LED assembly. The optic shall be at least 92% efficient while providing superior thermal, UV and impact resistance for the COB assembly. The optic ensures precise light control while providing cutoff control that limits or contains up-light. The luminaire shall provide Type ___ (2, 3, 4 or 5) light distribution per the IESNA classifica- tions. Testing shall be done in accordance with IESNA LM-79. Electronic Drivers The LED driver shall be U.L. Recognized. It shall be securely mounted inside the fixture, for optimized performance and longevity. It shall be supplied with a quick-disconnect electrical connector on the power supply, providing easy power connections and fixture installation. It shall have overload, overheat and short circuit protection, and have a DC voltage output, constant current design, 50/60HZ. It shall be 8/20 STERNBERG LIGHTING. ALL RIGHTS RESERVED. PRINTED IN THE USA. 800-621-3376 555 Lawrence Ave., Roselle, IL 60172 info@sternberglighting.com www.sternberglighting.com See next page BUILD A PART NUMBER ORDERING EXAMPLE: 2A-1480LED-1L40T5-MDL10-A-FHD-HSV/OEPT/3316P5/BKT Mounting Config.Fixture LED CCT Type Driver Lens Option Control Receptacle Option Control Option Fuse Option Hangstraight Option House Side Shield Arm See Arm Spec Sheets Pole See Pole Spec Sheets Finish 1480LED DEL MAR SERIES LED JOB NAME FIXTURE TYPE MEMO 65 D 271 8/20 STERNBERG LIGHTING. ALL RIGHTS RESERVED. PRINTED IN THE USA. 800-621-3376 555 Lawrence Ave., Roselle, IL 60172 info@sternberglighting.com www.sternberglighting.com 1480LED DEL MAR SERIES supplied with line-ground, line-neutral and neutral-ground electrical surge protection in accordance with IEEE/ANSI C62.41.2 guide-lines. It shall be a high efficiency driver with a THD less than 20% and a high power factor greater than .9. It shall be dimming capable using a 0-10v signal, consult factory for more information. Lens The luminaire shall include an injection molded acrylic lens assembly mechanically attached to the luminaire housing and shall provide protection for all internal optic compo-nents from dirt, dust, bugs, water and impact. It shall have an IP rating of no less than 65. Photocontrols Twist-Lock Style: The photocontrol shall be mounted on the hang-straight and pre-wired to driver. The twist lock type photocontrol is instant on with a 3-6 second turn off, and shall turn on at 1.5 footcandles with a turn-off at 2-3 footcandles. Photocontrol is 120-277 volt and warranted for 6 years. Warranty Seven-year limited warranty. See product and finish warranty guide for details. Finish Refer to website for details. LED Fixtures Performance 1480LED-OJWB 14” 43-1/2” 34-1/4” 22-1/4” 1480LED 28-1/2” 24” MODEL #T2 DELIVERED LUMENS EFFICACY (LPW)T3 DELIVERED LUMENS EFFICACY (LPW)T4 DELIVERED LUMENS EFFICACY (LPW)T5 DELIVERED LUMENS EFFICACY (LPW)WATTAGE 1L40T_-MDL10 6040 100.7 6195 103.3 6215 103.6 6635 110.6 60 1L30T_-MDL10 5885 98.1 6035 100.6 6055 100.9 6465 107.8 60 1L27T_-MDL10 5350 89.2 5485 91.4 5500 91.7 5875 97.9 60 1L40T_-MDL07 4310 107.8 4435 110.9 4425 110.6 4670 116.8 40 1L30T_-MDL07 4200 105.0 4320 108.0 4310 107.8 4550 113.8 40 1L27T_-MDL07 3815 95.4 3925 98.1 3920 98.0 4135 103.4 40 272 08/28/17 © 2017 LSI INDUSTRIES INC. Project Name Fixture Type Catalog # HOUSING - Low profile, durable die-cast, aluminum construction, providing a reliable weather-tight seal. LEDS - Features an array of select, mid-power, high brightness, high efficiency LED chips; 5000K color temperature, 70 CRI (nominal). DRIVE CURRENT - Choice of Very Low Wattage (VLW), Low Wattage (LW), Super Saver (SS), High Output (HO) or Very High Output (VHO). OPTICS / DISTRIBUTION - Choice of Symmetrical or Asymmetrical, which directs light through a clear tempered glass lens, to provide a uniform distribution of light to vertical and horizontal surfaces. OPTICAL UNIT - Features an ultra-slim 7/8” profile die-cast housing, with a flat glass lens. Unit is water-resistant, sealed to an IP67 rating. Integral designed heat sink does not trap dirt and grime, ensuring cool running performance over the life of the fixture. PRESSURE STABILIZING VENT - Luminaire assembly incorporates a pressure stabilizing vent breather to prevent seal fatigue and failure. HAZARDOUS LOCATION - Designed for lighter than air fuel applications. Product is suitable for Class 1 Division 2 only when properly installed per LSI installation instructions (consult factory). DRIVER - State-of-the-art driver technology superior energy efficiency and optimum light output. Driver components are fully encased in potting for moisture resistance. Complies with IEC and FCC standards. 0-10 V dimming supplied standard with all drive currents. DRIVER HOUSING - Die-cast aluminum, wet location rated driver/electrical enclosure is elevated above canopy deck to prevent water entry, provide easy “knock-out” connection of primary wiring and contributes to attaining the lowest operating temperatures available. Seals to optical housing via one-piece molded silicone gasket. OPERATING TEMPERATURE - -40°C to 50°C (-40°F to +122°F) ELECTRICAL - Universal voltage power supply, 120-277 VAC, 50/60 HZ input. Drivers feature two-stage surge protection (including separate surge protection built into electronic driver) meets IEEE C62.41.2-2002, Scenario 1, Location Category C. FINISH - Standard color is white and is finished with LSI’s DuraGrip® polyester powder coat process. DuraGrip withstands extreme weather changes without cracking or peeling. INSTALLATION - One person installation. No additional sealant required. Installs in a 12” or 16” deck pan. Deck penetration consists of a 4” hole, simplifying installation and water sealing. Unit is designed to quickly retrofit into existing Scottsdale (4”) hole as well as openings for Encore and Encore Top Access and to reconnect wiring for the SC/ECTA without having to relocate the conduit. Retro panels are available for existing Encores (see back page) as well as kits for recessed and 2x2 installations (see separate spec sheets). Support brackets are provided standard, to prevent sagging of deck. SHIPPING WEIGHT - 27 pounds (single pack), 48 pounds (double pack). EXPECTED LIFE - Minimum 60,000 to 100,000 hours depending upon the ambient temperature of the installation location. See LSI web site for specific guidance. WARRANTY - Limited 5-year warranty. LISTING - UL and ETL listed to UL 1598, UL 8750 and other U.S. and International safety standards. Suitable for wet locations. PHOTOMETRICS - Please visit our web site at www.lsi-industries.com for detailed photometric data. LED CANOPY LIGHT - LEGACYTM (CRUS) US & Int’l. patents pending. Consult Factory Class 1, Division 2 – Available on LW and SS T5 Temperature Classification – The surface temperature of this product will not rise above 100°C., within a 40°C ambient. Gas Groups A,B,C, and D – Group A: Acetylene / Group B: Hydrogen / Group C: Propane and Ethylene / Group D: Benzene, Butane, Methane & Propane. This product, or selected versions of this product, meet the standards listed below. Please consult factory for your specific requirements. wet location IP67 wet location AC - Asymmetric SC - Standard Symmetric AC distribution utilizes a reflector which alters the look from a standard S distribution DOE LIGHTING FACTS Department of Energy has verified representative product test data and results in accordance with its Lighting Facts Program. Visit www.lightingfacts.com for specific catalog strings. TYPE E 273 08/28/17 © 2017 LSI INDUSTRIES INC. Project Name Fixture Type Catalog # Prefix Color Temperature CRUS SC - Standard Symmetric AC - Asymmetric LED 50 - 5000K Input Voltage UE - Universal Voltage (120-277V) 347 - 480V Finish WHT - WhiteBRZ - BronzeBLK - Black Light SourceDistribution1 TYPICAL ORDER EXAMPLE: LUMINAIRE ORDERING INFORMATION CRUS SC LED HO 50 UE WHT VLW - Very Low WattLW - Low WattSS - Super SaverHO - High OutputVHO - Very High Output Drive Current ACCESSORY ORDERING INFORMATION Description Order Number (Accessories are field installed) Retrofit Panels - EC / ECTA / SCF to CRU, for 16" Deck Panel 525946 Retrofit Panels - ECTA / SCF to CRU, for 12" Deck Panel 530281 Retrofit 2x2 Cover Panel Blank (no holes) 357282 Retrofit RIC Cover Panel Blank (no holes) 354702 Description Order Number Kit - Hole Plugs and Silicone (enough for 25 retrofits)1 1320540 1- Consists of (25) 7/8" hole plugs and (1) 10.3 oz tube of RTV Options HL - Hazardous location available on LW and SS FOOTNOTES:1- AC distribution utilizes a reflector which alters the look from a standard S distribution. LED CANOPY LIGHT - LEGACYTM (CRUS) VLW - Very Low Watt LW - Low Watt SS - Super Saver LIGHT OUTPUT - CRUS Cool White Lumens Watts LPW SC AC SC/AC SC AC HO - High Output VHO - Very High Output DIMENSIONS 7 1/8” (181 mm) 7/8” (22 mm) 15 15/16” (404 mm) 15 15/16” (404 mm) 7632 10525 8884 13674 11595 18633 15145 22418 17262 132 159 141 115 141 109 125 74 142 120 140 11898 9055 61 148 274 Note: Specifications subject to change without notice. PRODUCT OVERVIEW Applications: RoadwaysOff rampsResidential streetsParking lots Autobahn Series ATB2 Roadway Lighting Features: OPTICAL The Autobahn’s new molded silicone optics provide exceptional performance. Silicone optics are superior to other polymeric materials in the areas of; optical efficiency, thermal performance, and reduction in dirt accumulation, all of which can lead to long term lumen degradation and a shift in optical distribution. Also, because silicone allows for the molding of fine details as well as thick sections, it produces the most crisp, clean and well-defined lighting distributions available. Silicone optics paired with modern LED’s allow the Autobahn to take full advantage of both technologies. Same Light: Performance is comparable to 400-1000W HPS roadway luminaires. White Light: Correlated color temperature - 4000K, or optional 2700K, 3000K or 5000K, all 70 CRI minimum. Unique IP66 rated LED light engines provided 0% uplight and restrict backlight to within sidewalk depth, providing optimal application coverage and optimal pole spacing. Available in Type II, III, IIIL, IV, & V roadway distributions. ELECTRICAL Expected Life: LED light engines are rated >100,000 hours at 25°C, L70. Electronic driver has an expected life of 100,000 hours at a 25°C ambient. Lower Energy: Saves an average of 40-60% over comparable HPS platforms. Robust Surge Protection: Two different surge protection options provide a minimum of ANSI C136.2 10kV/5kA protection. 20kV/10kA protection is also available. Luminaire ships with a 0-10v dimmable driver. Luminaire is continuous and step dimming capable via AO option or controls installed on P7 photocontrol receptacle option. MECHANICAL Easy to Maintain: Includes standard AEL lineman-friendly features such as tool-less entry, 3 station terminal block and quick disconnects. Bubble level located inside the electrical compartment for easy leveling at installation. Rugged die-cast aluminum housing is polyester powder-coated for durability and corrosion resistance. Rigorous five-stage pre-treating and painting process yields a finish that achieves a scribe creepage rating of 7 (per ASTM D1654) after over 5000 hours exposure to salt fog chamber (operated per ASTM B117). Four-bolt mast arm mount is adjustable for arms from 1-1/4” to 2” (1-5/8” to 2-3/8” O.D.) diameter and provides a 3G vibration rating per ANSI C136.31. Wildlife shield is cast into the housing (not a separate piece). CONTROLS NEMA 3 Pin photocontrol receptacle is standard, with the Acuity designed ANSI 7 Pin receptacle optionally available. Premium solid state locking sale photocontrol - PCSS (10 year rated life). Extreme long life sold state locking style photocontrol - PCLL (20 year rated life). Optional onboard Adjustable Output module allows the light output and input wattage to be modified to meet site specific requirements, and can also allow a single fixture to be flexibly applied in many different applications. Autobahn Series – AEL_0109_ATB2 DIMENSIONS Effective Projected Area (EPA) The EPA for the ATB2 is 0.78 sq. ft., Approx. Wt. = 21 lbs. (9.53 kg) 787.4 mm (31”) 25.4 mm (1”) 38.1 mm (1.5”) 355.6 mm (14”) 101.6 mm (4”) 787.4 mm (31”) 25.4 mm (1”) 38.1 mm (1.5”) 355.6 mm (14”) 101.6 mm (4”) STANDARDS DesignLights Consortium® (DLC) Premium qualified product. Not all versions of this product may be DLC Premium qualified. Please check the DLC Qualified Products List at www.designlights.org/QPL to confirm which versions are qualified. Color temperatures of ≤ 3000K must be specified for International Dark-Sky Association certification. Rated for -40°C to 40°C ambient. CSA Certified to U.S. and Canadian standards Complies with ANSI: C136.2, C136.10, C136.14, C136.31, C136.15, C136.37 BUY AMERICAN ACT — Product with the BAA option is assembled in the USA and meets the Buy America(n) government procurement requirements under FAR, DFARS and DOT regulations. Please refer to www.acuitybrands.com/buy-american for additional information. TYPE F 275 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 ORDERING INFORMATION Autobahn Series ATB2 Roadway Lighting Notes 1. Not available in 347 or 480V. 2. Not available with P901 - P905 performance packages 3. XVOLT option only available with P601 and P602 performance packages Series LED Performance Package Voltage Optics ATB2 Autobahn LED Roadway P601 26,192 lumens nominal P602 29,188 lumens nominal P603 33,062 lumens nominal P604 36,305 lumens nominal P605 39,786 lumens nominal P901 30,398 lumens nominal P902 36,273 lumens nominal P903 41,215 lumens nominal P904 45,247 lumens nominal P905 50,476 lumens nominal MVOLT Multi-volt, 120V - 277V 347 347V 480 480V XVOLT 277V-480V 3 R2 Roadway Type II R3 Roadway Type III R3L Roadway Type III Long R4 Roadway Type IV 2 R5 Roadway Type V Options Color Temperature (CCT) (Blank)4000K CCT, 70 CRI Min. 27K 2700K CCT, 70 CRI Min. 3K 3000K CCT, 70 CRI Min. 5K 5000K CCT, 70 CRI Min. Paint (Blank)Gray (Standard) BK Black BZ Bronze DDB Dark Bronze GI Graphite WH White GN Green Surge Protection (Blank)Standard 20kV/10kA SPD MP MOV Pack 10kV/5kA Terminal Block (Blank)Terminal Block (Standard) T2 Wired to L1 & L2 Positions Misc. BL External Bubble Level HSS House-Side Shield NL Nema Label XL Not CSA Certified HK Hingekeepers BAA Buy America(n) Act Compliant UMR-XX 8” Horizontal Arm for Round Pole, Painted to match Fixture UMS-XX 8” Horizontal Arm for Square Pole, Painted to match Fixture UMR-GALV 8” Horizontal Arm for Round Pole, Galvanized UMS-GALV 8” Horizontal Arm for Square Pole, Galvanized Controls. (Blank)3 Pin NEMA Photocontrol Receptacle (Standard) P7 7 Pin Photocontrol Receptacle (Dimmable Driver Included) NR No Photocontrol Receptacle AO Field Adjustable Output PCSS Solid State Lighting Photocontrol (120-277V) 1 PCLL Solid State Long Life Photocontrol SH Shorting Cap Packaging (Blank)Single Unit (Standard) JP Job Pack (42/Pallet) Accessories:External House Side Shields ATB2P60XR2R3LR5HSS for use with P601 - P605, R2, R3L or R5 distribution ATB2P60XR3HSS for use with P601 - P605, R3 distribution ATB2P60XR4HSS for use with P601 - P605, R4 distribution ATB2P90XR2R3LR5HSS for use with P901 - P905, R2, R3L or R5 distribution ATB2P90XR3HSS for use with P901 - P905, R3 distribution Light Trespass ShieldATB2ULTS ATB2 Universal Light Trespass Shield ATB Decorative Arms ATB2DECOS XX ATB Decorative Arm for Square Pole Painted to match fixture ATB2DECOR XX ATB Decorative Arm for Round Pole Painted to match fixture 276 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 PERFORMANCE PACKAGE Autobahn Series ATB2 Roadway Lighting Note: Individual fixture performance may vary. Specifications subject to change without notice. ATB2 15C 20C 25C 30C 35C 40C LLD Multiplier 1.02 1.01 1.00 0.99 0.98 0.97 PERFORMANCE PACKAGE To calculate the LLD for a temperature other than 25°C, multiply the LLD @ 25°C (shown in the performance package table) by the LLD multiplier for the selected temperature. ATB2 Distribution Input Watts 2700K 3000K 4000/5000K Lumens LPW Lumens LPW Lumens LPW P601 R2 175 22,828 131 24,280 139 27,200 156 R3 22,689 130 25,200 144 27,080 155 R3L 21,844 125 22,513 129 23,761 136 R4 23,376 135 23,760 136 24,770 143 R5 23,291 135 23,810 138 24,680 143 P602 R2 196 24,983 126 26,610 135 30,060 152 R3 24,831 126 27,770 142 30,020 153 R3L 24,270 124 24,770 126 26,400 135 R4 25,697 135 26,280 137 27,230 143 R5 25,489 135 26,270 138 27,010 144 P603 R2 233 28,442 121 30,430 131 34,020 145 R3 28,269 121 32,760 141 33,990 145 R3L 27,087 116 28,050 120 29,464 126 R4 29,359 124 29,800 126 31,110 132 R5 29,019 125 29,850 127 30,750 132 P604 R2 263 31,060 118 33,130 126 37,050 140 R3 30,871 118 35,670 136 36,950 141 R3L 29,369 112 30,541 116 31,946 121 R4 32,001 125 32,450 126 33,910 132 R5 31,690 126 32,790 127 33,580 133 P605 R2 295 33,992 115 36,960 125 39,750 135 R3 33,785 115 38,670 131 39,910 136 R3L 31,867 108 33,149 112 34,663 118 R4 34,728 120 35,430 122 36,800 127 R5 34,681 121 35,130 122 36,750 128 P901 R2 199 27,147 137 28,470 143 30,430 154 R3 26,982 135 29,040 146 31,350 157 R3L 26,100 131 26,603 134 28,390 143 R5 27,698 141 29,020 146 29,350 149 P902 R2 245 32,512 133 35,070 144 38,090 156 R3 32,314 132 35,600 145 38,970 159 R3L 31,000 127 31,344 128 33,720 138 R5 33,171 137 33,740 138 35,150 145 P903 R2 282 37,007 131 39,380 140 42,990 152 R3 36,782 130 39,540 140 43,580 154 R3L 35,238 125 35,154 125 38,330 136 R5 37,758 134 37,860 134 40,010 142 P904 R2 319 40,420 127 43,410 137 47,220 148 R3 40,175 126 43,600 137 48,170 151 R3L 38,327 120 38,078 119 41,690 131 R5 41,240 132 41,420 132 43,700 140 P905 R2 369 44,573 121 48,390 132 52,380 142 R3 44,303 120 48,560 132 53,940 146 R3L 42,886 116 42,455 115 46,649 126 R5 45,477 128 45,390 127 48,190 136 277 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 Autobahn Series ATB2 Roadway Lighting * Also includes any custom (non-catalog) CCT PERFORMANCE PACKAGE LLD @ 25°C ATB2 R2, R3 Distributions 3000K & 4000K CCT R2, R3 Distributions 2700K & 5000K CCT*R3L, R4, & R5 Distributions Any CCT 50k Hours 75k Hours 100k Hours 50k Hours 75k Hours 100k Hours 50k Hours 75k Hours 100k Hours P601 0.96 0.94 0.93 0.92 0.88 0.85 0.92 0.88 0.85 P602 0.96 0.94 0.93 0.92 0.88 0.85 0.92 0.88 0.85 P603 0.96 0.94 0.93 0.91 0.87 0.84 0.91 0.87 0.84 P604 0.96 0.94 0.93 0.91 0.87 0.83 0.91 0.87 0.83 P605 0.96 0.94 0.93 0.90 0.86 0.82 0.90 0.86 0.82 P901 0.96 0.94 0.93 0.91 0.88 0.84 0.91 0.88 0.84 P902 0.96 0.94 0.93 0.91 0.87 0.83 0.91 0.87 0.83 P903 0.96 0.94 0.93 0.90 0.86 0.82 0.90 0.86 0.82 P904 0.96 0.94 0.93 0.90 0.86 0.82 0.90 0.86 0.82 P905 0.96 0.94 0.93 0.89 0.84 0.79 0.89 0.84 0.79 278 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 PERFORMANCE PACKAGE Autobahn Series ATB2 Roadway Lighting B.U.G. Ratings ATB2 Distribution 2700K 3000K 4000/5000K B U G B U G B U G P601 R2 3 0 3 3 0 3 3 0 3 R3 3 0 3 3 0 3 3 0 4 R3L 3 0 4 3 0 4 3 0 4 R4 3 0 4 3 0 4 3 0 4 R5 5 0 3 5 0 3 5 0 3 P602 R2 3 0 3 3 0 3 3 0 3 R3 3 0 3 3 0 4 3 0 4 R3L 3 0 4 3 0 4 3 0 4 R4 3 0 4 3 0 4 3 0 4 R5 5 0 3 5 0 3 5 0 3 P603 R2 3 0 3 3 0 3 4 0 4 R3 3 0 4 3 0 4 3 0 4 R3L 3 0 4 3 0 4 3 0 4 R4 3 0 5 3 0 5 3 0 5 R5 5 0 4 5 0 4 5 0 4 P604 R2 3 0 3 4 0 4 4 0 4 R3 3 0 4 3 0 4 3 0 4 R3L 3 0 4 3 0 4 3 0 5 R4 3 0 5 3 0 5 3 0 5 R5 5 0 4 5 0 4 5 0 4 P605 R2 4 0 4 4 0 4 4 0 4 R3 3 0 4 3 0 4 3 0 4 R3L 3 0 5 3 0 5 3 0 5 R4 3 0 5 3 0 5 4 0 5 R5 5 0 4 5 0 4 5 0 4 P901 R2 3 0 3 3 0 3 3 0 3 R3 3 0 4 3 0 4 3 0 4 R3L 3 0 4 3 0 4 3 0 4 R5 5 0 3 5 0 4 5 0 4 P902 R2 4 0 4 4 0 4 4 0 4 R3 3 0 4 3 0 4 3 0 4 R3L 3 0 5 3 0 5 3 0 5 R5 5 0 4 5 0 4 5 0 4 P903 R2 4 0 4 4 0 4 4 0 4 R3 3 0 4 3 0 4 4 0 5 R3L 4 0 5 4 0 5 4 0 5 R5 5 0 4 5 0 4 5 0 4 P904 R2 4 0 4 4 0 4 4 0 4 R3 3 0 4 4 0 5 4 0 5 R3L 4 0 5 4 0 5 4 0 5 R5 5 0 4 5 0 4 5 0 4 P905 R2 4 0 4 4 0 4 4 0 5 R3 4 0 5 4 0 5 4 0 5 R3L 4 0 5 4 0 5 4 0 5 R5 5 0 5 5 0 5 5 0 5 279 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 Autobahn Series ATB2 Roadway Lighting 3"1-1/2" RAD. 1/4" PLATE 3"8" 1.66 O.D. x .140 WALL TB. 1/4" PLATE.43 x 1-3/4" SLOT 7-1/2""5-1/2"2-7/8" (2 PLCS.) UMR POLE ADAPTOR RECOMMENDED FOR USE WITH POLES OF 4" DIAMETER OR SMALLER UMS POLE ADAPTOR 280 Warranty Five-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. Please contact your sales representative for the latest product information. AEL Headquarters, One Lithonia Way, Conyers Georgia 30012www.americanelectriclighting.com Phone: 1-866-HOLOPHANEEmail: TechSupportINF@AcuityBrands.com© 2014-2023 Acuity Brands Lighting, Inc. All Rights Reserved. ATB2 Rev. 05/11/23 10.59" 12.375" 38.5" 5" 2.6" 1.55" 1.35" .78" 1" Round Pole Adapter Plate (Supplied with ATB2DECOR) .66" .6" 4.9" 2x.45".66" Model Weight EPA ATB2DECOS 6.5 lbs 0.30 ft² ATB2DECOR 8.0 lbs 0.30 ft² ATB2DECOS with ATB2 Luminaire 27.5 lbs 0.84 ft² ATB2DECOR with ATB2 Luminaire 29.0 lbs 0.84 ft² Autobahn Series ATB2 Roadway Lighting 281 282 28 www.hapco.com Elliptical Section 8" 2° J Arm Length Extruded Aluminum Pole Plate Alloy 6063-T6 With 1/2"-13NC Stainless Steel Hardware (Wire Hole In Shaft With 1" I. D. Rubber Grommet) B Wall ThicknessTapered Aluminum TubeAlloy 6063-T6 A Mounting HeightHandhole C Butt Diameter 4-Bolt Base With Bolt Covers 2" NPS Sliptter (Options Available - See Accessory Specications)1'-6" Top Diameter D Tapered Aluminum Tube.125" Wall Alloy 6063-T66"AluminumPole Cap With S. S. Screws 2'-6" Rise6" Butt Diameter - Reinforced, 3" x 5" curved Cast Aluminum Frame (Alloy 356-T6) with Aluminum Door and two (2) SS Hex Head Screws. A Grounding Provision incorporating a 3/8" diameter hole is provided opposite the Handhole.7"+ Butt Diameters - Reinforced, 4" x 6" curved Cast Aluminum Frame (Alloy 356-T6) with Aluminum Door and two (2) SS Hex Head Screws. Reinforced Frame will contain a tapped 3/8"-16NC Grounding Provision. WARNING: Do not install light pole without luminaire. Handhole Round Tapered Aluminum Pole with Arms Single Mast — 4-Bolt BaseRTA Shaft and arm will be constructed of seamless extruded tube of 6063 Aluminum Alloy per the requirements of ASTM B221. The shaft assembly shall be full-length heat treated after base weld to produce a T6 temper. Pole Anchorage Vibration Damper 4-Bolt Cast Aluminum Base Flange of Alloy 356-T6 with Aluminum Bolt Covers (Alloy 356-F) and Stainless Steel Hex Head Attaching Screws. Base Style Anchorage Kit will include four (4) L-shaped Steel Anchor Bolts conforming to AASHTO M314-90 Grade 55. Ten inches (10") of threaded end will be galvanized per ASTM A153. Kits will contain four (4) Hex Nuts, four (4) Lock Washers, and four (4) Flat Washers (all components Galvanized Steel). A bolt circle template will be provided. When determined necessary by Hapco, a Vibration Damper will be factory-installed inside the pole shaft. Customer specification of the damper is available. Satin Aluminum or Powder Coated Finish per Customer Specification. Dimensions in Inches C D F G H I Butt Dia. top Dia. Bolt Cir. Dia. Base sq. Bolt proj. Bolt size 6 4.5 9 - 10 9.75 2.75 1 x 36 x 4 7 4.5 10 - 11 10.5 2.75 1 x 36 x 4 8 4.5 11 - 12 11.25 2.75 1 x 36 x 4 Handhole - 0° 180°| I0° - 90° 270° - GBaseSquare FBoltCircle H Bolt Proj.IBoltSize TYPE F POLES 283 29www.hapco.com rta - rounD tapereD aluminum pole with armssingle mast4-Bolt BaseR T A 4 M 1 - MOUNTINGHEIGHT WALLTHICK. BUTTDIA. TOPDIA. BASESTYLE ARMSTYLE ARMQUANT. ARMLTH. FINISH Catalog Number System The catalog number for Hapco poles utilizes the following identification system. Catalog Number Example - RTA 30 D 8 B 4 M 1 6 – 01 Round Tapered Aluminum, 30’ Mounting Height, .188" Wall Thickness, 8" Butt Diameter, 4.5" Top Diameter, 4-Bolt Base, Mast Arm, Single, 6’ Arm Length, Satin Aluminum Finish. Wall Thickness C = .156" D = .188" E = .219" F = .250" Butt Diameter 6 = 6" 7 = 7" 8 = 8" Top Diameter B = 4.5" C = 6" Base Style 4 = 4-Bolt Base Arm Style M = Mast Arm Quantity 1 = Single Arm Length 4 = 4’ 6 = 6’ 8 = 8’ A = 10’ Finish 01 = Satin Aluminum BA = Black Powder Coat BH = White Powder Coat BM = Dark Bronze Powder Coat BV = Dark Green Powder Coat GC = Gray Powder Coat ** = Specify Finish 20 20 20 20 20 20 25 25 25 25 25 25 25 25 25 25 30 30 30 30 30 30 30 30 30 30 35 35 35 35 35 35 35 35 35 35 40 40 40 40 40 40 40 40 0.156'' 6 4' 60 11.0 9.0 8.2 6.5 5.2 21-082 RTA20C6B4M14-** 0.156'' 6 6' 60 9.0 7.2 6.6 5.7 4.4 21-085 RTA20C6B4M16-** 0.156'' 6 8' 40 6.8 5.2 4.8 4.0 3.2 21-087 RTA20C6B4M18-** 0.188'' 6 4' 60 11.0 8.8 8.2 6.8 5.6 21-002 RTA20D6B4M14-** 0.188'' 6 6' 60 9.0 7.2 6.6 5.4 4.6 21-005 RTA20D6B4M16-** 0.188'' 6 8' 40 6.8 5.2 4.8 4.0 3.2 21-007 RTA20D6B4M18-** 0.156'' 6 6' 40 6.6 4.3 3.8 2.5 1.7 21-285W3 RTA25C6B4M16-** 0.188'' 6 4' 60 9.6 6.9 6.2 4.7 3.6 21-282 RTA25D6B4M14-** 0.188'' 6 6' 60 8.8 6.2 5.4 4.0 2.9 21-285 RTA25D6B4M16-** 0.188'' 6 8' 45 6.2 5.0 4.7 3.2 2.2 21-287 RTA25D6B4M18-** 0.156'' 7 4' 60 10.4 8.2 7.6 6.3 5.0 21-362 RTA25C7B4M14-** 0.156'' 7 6' 60 8.6 6.8 6.2 5.2 4.2 21-365 RTA25C7B4M16-** 0.156'' 7 8' 40 6.4 5.0 4.6 3.8 3.0 21-367 RTA25C7B4M18-** 0.188'' 7 4' 60 10.4 8.2 7.6 6.4 5.4 21-292 RTA25D7B4M14-** 0.188'' 7 6' 60 8.6 6.8 6.2 5.2 4.4 21-295 RTA25D7B4M16-** 0.188'' 7 8' 40 6.4 5.0 4.6 3.8 3.0 21-297 RTA25D7B4M18-** 0.156'' 7 4' 60 7.6 5.1 4.4 3.1 2.2 21-692 RTA30C7B4M14-** 0.156'' 7 6' 40 7.0 4.6 3.9 2.6 1.7 21-695 RTA30C7B4M16-** 0.156'' 7 8' 40 6.1 3.8 3.1 1.8 0.9 21-697 RTA30C7B4M18-** 0.156'' 8 4' 60 10.0 7.8 7.4 6.0 4.8 21-642 RTA30C8B4M14-** 0.156'' 8 6' 60 8.2 6.4 6.0 5.0 4.2 21-645 RTA30C8B4M16-** 0.156'' 8 8' 40 6.0 4.8 4.4 3.6 2.8 21-647 RTA30C8B4M18-** 0.188'' 8 4' 60 10.0 7.8 7.4 6.0 5.0 21-582 RTA30D8B4M14-** 0.188'' 8 6' 60 8.2 6.4 6.0 5.0 4.2 21-585 RTA30D8B4M16-** 0.188'' 8 8' 40 6.0 4.8 4.4 3.6 2.8 21-587 RTA30D8B4M18-** 0.188'' 8 10' 40 6.0 4.8 4.4 3.4 2.8 21-590 RTA30D8B4M1A-** 0.156'' 8 4' 60 8.0 5.3 4.6 3.2 2.2 21-922 RTA35C8B4M14-** 0.156'' 8 6' 40 7.4 4.7 4.1 2.7 1.7 21-925 RTA35C8B4M16-** 0.156'' 8 8' 40 5.8 3.9 3.3 1.9 0.9 21-927 RTA35C8B4M18-** 0.188'' 8 4' 60 9.6 7.8 7.0 5.2 3.9 21-862 RTA35D8B4M14-** 0.188'' 8 6' 60 7.8 6.2 6.2 4.5 3.3 21-865 RTA35D8B4M16-** 0.188'' 8 8' 40 5.8 4.6 4.2 3.4 2.6 21-867 RTA35D8B4M18-** 0.188'' 8 8' 40 5.8 4.6 4.2 3.4 2.8 21-897 RTA35D8C4M18-** 0.250'' 8 4' 60 9.6 7.6 7.0 5.8 5.0 21-882 RTA35F8B4M14-** 0.250'' 8 6' 60 7.8 6.2 5.8 4.8 4.0 21-885 RTA35F8B4M16-** 0.250'' 8 8' 40 5.8 4.6 4.2 3.4 2.8 21-887 RTA35F8B4M18-** 0.188'' 8 4' 60 7.0 4.4 3.8 2.4 1.5 50700-041 RTA40D8B4M14-** 0.188'' 8 6' 40 6.4 3.8 3.2 1.8 1.0 50700-001 RTA40D8B4M16-** 0.188'' 8 8' 40 5.6 3.1 2.5 1.1 - 50700-002 RTA40D8B4M18-** 0.219'' 8 6' 55 7.6 5.8 5.0 3.4 2.2 50700-005 RTA40E8B4M16-** 0.219'' 8 8' 40 5.6 4.4 4.2 2.6 1.6 50700-006 RTA40E8B4M18-** 0.250'' 8 4' 60 9.2 7.4 6.8 5.4 4.2 50700-045 RTA40F8B4M14-** 0.250'' 8 6' 60 7.6 6.0 5.6 4.8 3.5 50700-009 RTA40F8B4M16-** 0.250'' 8 8' 40 5.6 4.4 4.0 3.2 2.6 50700-025 RTA40F8B4M18-** a B C j mtg. wall Butt arm lum. maximum epa olD hgt. thiCkness Diameter length weight 90 100 110 120 130 Cat. numBer Catalog numBer EPA Notes: Effective Projected Area (EPA) in square feet. EPA’s calculated using wind velocity (mph) indicated in accordance with 2009 AASHTO LTS-5 using a 25 year design life. Maximum EPA is based on the luminaire weight shown. Increased luminaire weight may reduce the maximum EPA. If weight is exceeded, or if other design life or code is required, please consult the factory. 284 STATE ROUTE "59"W. 119TH ST.AERO DR.SPAULDINGSCHOOL DR.( IN FEET ) GRAPHIC SCALE 0 160804040 SHEET OF CROSSROADS CENTER PRELIMINARY PLAT 1 1 S:\5169048\dwg\PP101D.dwg \ SHEET 1 'DWH RI 0DS -DQXDU\ 04 EULF R SWXUP PURIHVVLRQDO LDQG SXUYH\RU HULFVWXUP#UDVPLWKQDWLRQDOFRP RHJLVWUDWLRQ NXPEHU 00066 E[SLUHV 11004 CRUSRUDWH LLFHQVH NXPEHU 18400 E[SLUHV 400 SXEGLYLGHU :RRGPDQ V FRRG 0DUNHW IQF 61 LLEHUW\ LDQH -DQHVYLOOH :I 4 'HQRWHV 4 LURQ SLSH F28N' 'HQRWHV 1 LURQ SLSH 18 ORQJ SET THAT PART 2F THE :EST 1 2F THE S28TH:EST 14 2F SECTI2N T2:NSHIP N2RTH RANGE EAST 2F THE THIR' PRINCIPAL 0ERI'IAN 9ILLAGE 2F PLAINFIEL' :ILL C28NT< ILLIN2IS 'HQRWHV DFFHVV UHVWULFWLRQV 'HQRWHV 1 LURQ SLSH 18 ORQJ WR EH SET LQ FRQFUHWH I'2T ACCESS N2TE TKHUH VKDOO EH QR GLUHFW YHKLFXODU DFFHVV WRIURP SWDWH RRXWH DQG LRW 6 LRW LRW 8 RU LRW AOO RWKHU DFFHVV VKDOO EH IURP LQWHUQDO FLUFXODWLRQ OF 285 SHEET OF CROSSROADS CENTER PRELIMINARY PLAT 1 1 S:\5169048\dwg\PP101D.dwg \ SHEET 2 EULF R SWXUP PURIHVVLRQDO IOOLQRLV LDQG SXUYH\RU HULFVWXUP#UDVPLWKFRP RHJLVWUDWLRQ NXPEHU 00066 E[SLUHV 11004 CRUSRUDWH LLFHQVH NXPEHU 18400 E[SLUHV 400 %DVLV RI %HDULQJV %HDULQJV DUH EDVHG RQ WKH SRXWK OLQH RI WKH SRXWKZHVW 14 RI SHFWLRQ TRZQVKLS NRUWK RDQJH EDVW LQ WKH TRZQ RI :KHDWODQG :LOO CRXQW\ IOOLQRLV ZKLFK EHDUV NRUWK 88 1 EDVW TLWOH CRPPLWPHQW TKLV VXUYH\ ZDV SUHSDUHG EDVHG RQ FLUVW APHULFDQ TLWOH IQVXUDQFH CRPSDQ\ WLWOH FRPPLWPHQW QXPEHU NCS1110A' FRPPLWPHQW GDWH 0DUFK 1 0 FORRG NRWH AFFRUGLQJ WR IORRG LQVXUDQFH UDWH PDS RI WKH :LOO CRXQW\ FRPPXQLW\ SDQHO QXPEHU 11 C00G HIIHFWLYH GDWH RI FHEUXDU\ 1 01 WKLV VLWH IDOOV LQ ]RQH A (DUHDV VXEMHFW WR WKH 1 DQQXDO FKDQFH IORRG) DQG ]RQH ; (DUHDV GHWHUPLQHG WR EH RXWVLGH WKH 0 DQQXDO FKDQFH IORRGSODLQ) 0XQLFLSDO =RQLQJ TKH EDVLF ]RQLQJ LQIRUPDWLRQ OLVWHG EHORZ LV IURP WKH PODLQILHOG IOOLQRLV CRGH RI 2UGLQDQFHV AUWLFOH 9I GDWHG 0D\ 10 0 DQG GRHV QRW UHIOHFW DOO UHJXODWLRQV WKDW PD\ DSSO\ SLWH LV ]RQHG % HLJKZD\ %XVLQHVV 'LVWULFW FURQW VHWEDFN 0 IHHW SLGH \DUG VHWEDFN 1 IHHW CRUQHU VLGH VHWEDFN 0 IHHW RHDU \DUG VHWEDFN0 IHHW FAR 04 0LQLPXP ORW DUHD 460 VTXDUH IHHW 0D[LPXP ORW ZLGWK 100 IHHW 0D[LPXP KHLJKW IHHW AUHD L2T 1 10484 SF 400 AC L2T 868 SF 1 48 AC L2T 40 SF 104 AC L2T 4 44 SF 10168 AC L2T 4646 SF 10668 AC L2T 6 14166 SF 866 AC L2T 80 SF 1446 AC L2T 8 1 SF 11 AC L2T 461 SF 10016 AC 'E'ICATI2N 4 SF 08604 AC T2TAL 160 SF 6 48 AC NRWHV TKHUH VKDOO EH QR YHKLFXODU DFFHVV WR SWDWH RRXWH RWKHU WKDQ WKRVH DFFHVV SRLQWV VKRZQ RQ WKLV SODW LRWV 4 6 8 DQG VKDOO KDYH DFFHVV YLD LQWHUQDO FLUFXODWLRQ RHVWULFWLYH CRYHQDQWV ZLOO EH UHFRUGHG VHSDUDWHO\ EOHYDWLRQV UHIHU WR NA9'88 'DWXPSWDUWLQJ %HQFKPDUN NDWLRQDO GHRGHWLF SXUYH\ 0RQXPHQW '.01 02N80ENT 'IS. IN RETAINING :ALL EOHYDWLRQ 64 SXEGLYLGHU :RRGPDQ V FRRG 0DUNHW IQF 61 LLEHUW\ LDQH -DQHVYLOOH :I 4 2ZQHU RI UHFRUG :RRGPDQ V FRRG 0DUNHW IQF 61 LLEHUW\ LDQH -DQHVYLOOH :I 4 VILLAGE ENGINEER'S CERTIFICATE ASSURYHG WKLV GD\ RI A' 04 E\ WKH 9LOODJH EQJLQHHU RI WKH 9LOODJH RI PODLQILHOG :LOO CRXQW\ IOOLQRLV BBBBBBBBBBBBBBBBBBBBBBBBBBB 9LOODJH EQJLQHHU SXUYH\RU RA SPLWK IQF 164 : %OXHPRXQG RRDG %URRNILHOG :I 00 EQJLQHHU RA SPLWK IQF 164 : %OXHPRXQG RRDG %URRNILHOG :I 00 STATE HIGHWAY CERTIFICATE TKLV SODW KDV EHHQ DSSURYHG E\ WKH IOOLQRLV 'HSDUWPHQW RI TUDQVSRUWDWLRQ ZLWK UHVSHFW TR URDGZD\ DFFHVV SXUVXDQW RI RI ³AQ AFW WR UHYLVH WKH ODZ LQ UHODWLRQ WR SODWV´ DV DPHQGHG A SODQ WKDW PHHWV WKH UHTXLUHPHQWV FRQWDLQHG LQ WKH 'HSDUWPHQW V ³PROLF\ RQ PHUPLWV IRU AFFHVV 'ULYHZD\V WR SWDWH HLJKZD\V´ ZLOO EH UHTXLUHG E\ WKH 'HSDUWPHQW %\ BBBBBBBBBBBBBBBBBBBBBBBBB 'DWH BBBBBBBBBBBBBBBBBBBBBBBB -2SE RI2S PE REGI2N 2NE ENGINEER OWNERS CERTIFICATION STATE 2F :ISC2NSIN ` SS C28NT< 2F R2C.` TKLV LV WR FHUWLI\ WKDW :RRGPDQ V FRRG 0DUNHW IQF LV WKH RZQHU RI WKH ODQG GHVFULEHG KHUHRQ DQG KDV FDXVHG WKH VDPH WR EH VXUYH\HG DQG SODWWHG DV LQGLFDWHG KHUHRQ IRU WKH XVHV DQG SXUSRVHV WKHUHLQ VHW IRUWK DV DOORZHG DQG SURYLGHG E\ VWDWXWH DQG KHUHE\ DFNQRZOHGJHV DQG DGRSWV WKH VDPH XQGHU WKH VW\OH DQG WLWOH DIRUHVDLG TKLV VXEGLYLVLRQ VKDOO EH NQRZQ DQG GHVLJQDWHG DV CURVVURDGV CHQWHU LQ WKH 9LOODJH RI PODLQILHOG :LOO CRXQW\ IOOLQRLV AOO VWUHHWV DQG DOOH\V DQG SXEOLF RSHQ VSDFHV VKRZQ DQG QRW KHUHWRIRUH GHGLFDWHG DUH KHUHE\ GHGLFDWHG WR WKH SXEOLF AOVR WKLV LV WR FHUWLI\ WKDW WKH SURSHUW\ EHLQJ VXEGLYLGHG DIRUHVDLG DQG WR WKH EHVW RI RZQHUV NQRZOHGJH DQG EHOLHI VDLG VXEGLYLVLRQ OLHV HQWLUHO\ ZLWKLQ WKH OLPLWV RI PODLQILHOG SFKRRO 'LVWULFW 0 LQ :LOO CRXQW\ IOOLQRLV :H WKH XQGHUVLJQHG :RRGPDQ V FRRG 0DUNHW IQF GR KHUHE\ FHUWLI\ WKDW ZH DUH WKH RZQHUV RI WKH UHDO HVWDWH VKRZQ DQG GHVFULEHG KHUHLQ TKLV VXEGLYLVLRQ VKDOO EH NQRZQ DQG GHVLJQDWHG DV CURVVURDGV CHQWHU LQ WKH 9LOODJH RI PODLQILHOG :LOO CRXQW\ IOOLQRLV :ITNESS RXU HDQGV DQG SHDOV 'DWHG DW BBBBBBBBBBBBBBBBBBBBBBB :LVFRQVLQ WKLV GD\ RI A' 04 :RRGPDQ V FRRG 0DUNHW IQF D :LVFRQVLQ FRUSRUDWLRQ %\ COLQW :RRGPDQ PUHVLGHQW SURVEYOR'S CERTIFICATE STATE 2F :ISC2NSIN ` SS C28NT< 2F :A8.ESHA ` TKLV LV WR FHUWLI\ WKDW I EULF R SWXUP D PURIHVVLRQDO IOOLQRLV LDQG SXUYH\RU NR 00066 KDYH VXUYH\HG DQG VXEGLYLGHG WKH SURSHUW\ DV GHVFULEHG DQG DV VKRZQ E\ WKH DQQH[HG SODW ZKLFK LV D FRUUHFW UHSUHVHQWDWLRQ RI VDLG VXUYH\ DQG VXEGLYLVLRQ TKLV VXUYH\ FRPSOLHV ZLWK 9LOODJH RI PODLQILHOG CRGH RI 2UGLQDQFHV CKDSWHU AUWLFOH II 'LYLVLRQ 4 AOO SODW H[WHULRU PRQXPHQWV KDYH EHHQ IRXQG RU VHW DV LQGLFDWHG KHUHRQ AOO GLVWDQFHV DUH VKRZQ LQ IHHW DQG GHFLPDOV WKHUHRI GLYHQ XQGHU P\ KDQG DQG VHDO DW %URRNILHOG :LVFRQVLQ WKLV WK GD\ RI -DQXDU\ 04 FLHOG GDWH IRU PHDVXUHPHQWV ERXQGDU\ PRQXPHQWV DQG WRSRJUDSKLF GDWD FROOHFWLRQ ASULO 18 0 COUNTY CLERK'S CERTIFICATE STATE 2F ILLIN2IS ` SS CRXQW\ RI ` I LA8REN FERR< CRXQW\ COHUN RI :LOO CRXQW\ IOOLQRLV GR KHUHE\ FHUWLI\ WKDW WKHUH DUH QR GHOLQTXHQW JHQHUDO WD[HV DQG QR UHGHHPDEOH WD[ VDOHV DJDLQVW DQ\ RI WKH ODQG LQFOXGHG LQ WKH DQQH[HG SODW I IXUWKHU FHUWLI\ WKDW I KDYH UHFHLYHG DOO VWDWXWRU\ IHHV LQ FRQQHFWLRQ ZLWK WKH DQQH[HG SODW GLYHQ XQGHU P\ KDQG DQG VHDO RI WKH CRXQW\ COHUN DW :LOO CRXQW\ IOOLQRLV WKLV GD\ RI BBBBBBBBBBBBBBBBBBB A' 04 BBBBBBBBBBBBBBBBBBBBBBBBB LDXUHQ FHUU\ CRXQW\ COHUN NOTARY CERTIFICATE STATE 2F :ISC2NSIN ` SS C28NT< 2F R2C.` %HIRUH PH WKH XQGHUVLJQHG NRWDU\ PXEOLF LQ DQG IRU WKH CRXQW\ DQG SWDWH SHUVRQDOO\ DSSHDUHG COLQW :RRGPDQ DQG KH DFNQRZOHGJHG WKH H[HFXWLRQ RI WKH IRUHJRLQJ LQVWUXPHQW DV KLV YROXQWDU\ DFW DQG GHHG IRU WKH SXUSRVHV WKHUHLQ H[SUHVVHG :ITNESS P\ HDQG DQG NRWRULDO SHDO WKLV GD\ RI 04 BBBBBBBBBBBBBBBBBBBBBBBBB NRWDU\ PXEOLF PLAN COMMISSION/ZONING BOARD OF APPEALS CERTIFICATES ASSURYHG E\ WKH PUHVLGHQW DQG %RDUG RI TUXVWHHV RI WKH 9LOODJH RI PODLQILHOG DW D PHHWLQJ KHOG BBBBBBBBBBBBBBBBBBBBBBBBB PUHVLGHQW BBBBBBBBBBBBBBBBBBBBBBBBB 9LOODJH COHUN THAT PART 2F THE :EST 1 2F THE S28TH:EST 14 2F SECTI2N T2:NSHIP N2RTH RANGE EAST 2F THE THIR' PRINCIPAL 0ERI'IAN 9ILLAGE 2F PLAINFIEL' :ILL C28NT< ILLIN2IS 02RE PARTIC8LARL< 'ESCRI%E' AS F2LL2:S C200ENCING AT THE S28TH:EST C2RNER 2F THE S28THEAST 14 2F SAI' SECTI2N THENCE N2RTH 88 1´ EAST AL2NG THE S28TH LINE 2F SAI' S28TH:EST 14 SECTI2N 61 FEET T2 THE P2INT 2F %EGINNING THENCE N2RTH 016 00´ :EST 0 FEET T2 A P2INT 2N THE N2RTH RIGHT2F:A< LINE 2F :EST 11 TH STREET THENCE S28TH 88 1´ :EST AL2NG SAI' N2RTH LINE 4 6 FEET T2 A P2INT THENCE N2RTH 14 1 ´ :EST 860 FEET T2 A P2INT 2N THE EAST RIGHT2F:A< LINE 2F STATE R28TE ³ ´ THENCE N2RTH 014 1´ :EST AL2NG SAI' EAST LINE 148 FEET T2 A P2INT THENCE N2RTH 8806 1 ´ EAST AL2NG THE S28TH LINE 2F S28TH P2INTE 8NIT 1 A 'ISTANCE 2F 6 FEET T2 A P2INT THENCE N2RTH 01 41´ :EST 114 FEET T2 A P2INT 2N SAI' S28TH LINE THENCE N2RTH 88 16´ EAST AL2NG SAI' S28TH LINE 10 FEET T2 A P2INT 2N THE :EST LINE 2F THE EAST 1 2F THE S28TH:EST 14 2F AF2RE0ENTI2NE' SECTI2N THENCE S28TH 0140 8´ EAST AL2NG SAI' :EST LINE 14 FEET T2 A P2INT 2N THE AF2RE0ENTI2NE' S28TH LINE 2F THE S28TH:EST 14 SECTI2N THENCE S28TH 88 1´ :EST AL2NG SAI' S28TH LINE 084 FEET T2 THE P2INT 2F %EGINNING SAI' LAN'S C2NTAINING 18 S48ARE FEET 2R 640 1 ACRES VILLAGE BOARD CERTIFICATES ASSURYHG E\ WKH PUHVLGHQW DQG %RDUG RI TUXVWHHV RI WKH 9LOODJH RI PODLQILHOG DW D PHHWLQJ KHOG BBBBBBBBBBBBBBBBBBBBBBBBB PUHVLGHQW BBBBBBBBBBBBBBBBBBBBBBBBB 9LOODJH COHUN OF 286 P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 1 of 32 B&C v0 ANNEXATION AGREEMENT FOR GATEWAY COMMONS Revision Date: _______________, 2024 THIS ANNEXATION AGREEMENT is entered into this ____ day of March, 2024, by and between the Village of Plainfield, an Illinois municipal corporation (hereinafter referred to as “VILLAGE”), and Woodman’s Food Market, Inc., a Wisconsin corporation (hereinafter referred to as “DEVELOPER”) for all the property described in the Plat of Annexation marked Exhibit A (hereinafter referred to as “SUBJECT PROPERTY”, attached hereto. WITNESSETH: WHEREAS, the VILLAGE is an Illinois municipal corporation; and WHEREAS, DEVELOPER is the owner of the SUBJECT PROPERTY; and WHEREAS, the SUBJECT PROPERTY is contiguous to the corporate limits of the VILLAGE; and WHEREAS, DEVELOPER proposes to develop the SUBJECT PROPERTY with the following features (collectively, the “Development”): (a) a grocery store containing approximately 243,500 square feet (“Food Market”) to be constructed on Lot 10, and a fuel center operating on a 24-hour per day–7-day per week basis, with 10 fueling station dispensers, and both attended and unattended fueling, a convenience store, and a quick-lube facility (“Gas/Lube Facility”); and a car wash (“Car Wash”) to be constructed on Lot 4 (the “Woodman’s Project”); and multiple perimeter lots DEVELOPER intends to sell to third parties for the development of additional uses on Lot 1, Lot 2, Lot 3, Lot 5, Lot 6, Lot 7, and Lot 8 of the SUBJECT PROPERTY, as depicted on the Subdivision Plat (the “Outlots”). WHEREAS, it is the intention of the parties that the annexation of the SUBJECT PROPERTY to the VILLAGE be upon the terms and conditions of this Annexation Agreement; and WHEREAS, in accordance with 65 ILCS 5/11-15.1-1 et seq. of the Illinois Compiled Statutes and pursuant to lawful notice, the VILLAGE has placed this Annexation Agreement before the public for comment and hearing by its President and Board of Trustees (“Corporate Authorities”); and WHEREAS, the VILLAGE desires to improve the real estate tax base of the VILLAGE, enhance opportunities for residents of the VILLAGE to shop within the VILLAGE, and increase sales tax revenue for the VILLAGE; and WHEREAS, DEVELOPER has submitted to the VILLAGE applications to classify the SUBJECT PROPERTY in the VILLAGE’s B-3 zoning district and grant a special use for a planned development (“Zoning Applications”), as well as the following (“Preliminary Development Plan”): a preliminary site 287 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 2 of 32 and landscaping plan (“Preliminary Site Plan”), and preliminary plat of subdivision (“Preliminary Plat”) and preliminary engineering plans (“Preliminary Engineering Plans”), as identified and described in Exhibit B-1; all in accordance with the Village Ordinances (defined below); and WHEREAS, on February 6, 2024, the VILLAGE Plan Commission conducted a public hearing and meeting regarding the Zoning Applications and Preliminary Development Plan; and WHEREAS, on March 4, 2024, the VILLAGE Corporate Authorities conducted a public hearing and meeting regarding this Agreement; and WHEREAS, the VILLAGE has provided all notices required to be given and held all public hearings required to be held, all in accordance with Village Ordinances and other applicable laws; and WHEREAS, the development of the SUBJECT PROPERTY in accordance with this Annexation Agreement is in the best interests of the VILLAGE and DEVELOPER, will promote sound planning and development of the VILLAGE, and will inure to the benefit of the citizens of the VILLAGE; and WHEREAS, the VILLAGE, by its Corporate Authorities, has adopted an ordinance approving this Annexation Agreement in the manner provided by law; and WHEREAS, the adoption and approval of this Annexation Agreement is an exercise of the powers vested in the VILLAGE by the Village Ordinances, the Illinois Constitution, the Illinois Compiled Statutes, including without limitation Article 13 of the Illinois Municipal Code (65 ILCS 5/11-13-1, et seq.), Section 11-15-1 et seq. of the Illinois Municipal Code (65 ILCS 5/11-15-1, et seq.), the VILLAGE’s police powers, the VILLAGE’s home rule municipal authority and other applicable law; NOW, THEREFORE, in consideration of the premises and of the mutual covenants and Agreements herein contained, it is hereby agreed as follows: 1. INCORPORATION OF RECITALS AND EXHIBITS. The foregoing recitals are hereby incorporated into the body of this Annexation Agreement as if fully set forth and repeated herein. Any exhibit referred to in this Annexation Agreement and attached hereto shall also be considered incorporated herein by express reference. 2. ANNEXATION AND ZONING DEVELOPER agrees within seven (7) days after its execution of this Annexation Agreement to file properly executed petitions for annexing and zoning said premises, if said petitions have not already been filed. Within thirty (30) days thereafter, the VILLAGE agrees, pursuant to requisite notice having been given, and in accordance with law, to enact and adopt ordinances annexing and zoning the SUBJECT PROPERTY to zoning classification B-3 Highway Business District with a Special Use for Planned Development, as provided in Exhibit C. 288 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 3 of 32 OWNER and DEVELOPER agree that the SUBJECT PROPERTY shall be developed in accordance with the Village Ordinances (defined in Exhibit C) and agree to follow all of the Village Ordinances in connection with such development except as modified in this Annexation Agreement (and subject to the provisions of Exhibit C) and shall develop the SUBJECT PROPERTY in accordance with the Final Development Plan (defined in Exhibit C). 3. PARK DISTRICT ANNEXATION. Upon annexation of the SUBJECT PROPERTY to the VILLAGE, DEVELOPER agrees to file a petition to annex the SUBJECT PROPERTY to the Plainfield Township Park District within thirty (30) days. 4. PARK AND SCHOOL DONATIONS. The OWNER and DEVELOPER agree to comply with the Village Ordinance on land/cash donations for park and school sites. The DEVELOPER agrees to pay all fees identified in the School Facility Impact Fee schedule and School Transition Fee schedule attached. The DEVELOPER shall be required to enter into a Park Dedication and Improvement Agreement with the Park District to formalize the terms of meeting the park obligation for development of the SUBJECT PROPERTY. Subject to Section __ of Exhibit C, the OWNER and DEVELOPER agree to pay a fee at building permit set by the junior college within which district the development occurs and approved by the VILLAGE. FIRE PROTECTION DISTRICT DONATION. Subject to Section __ of Exhibit C, the OWNER and DEVELOPER agree to pay $1,000.00 contribution per residential unit to the Fire Protection District in which the unit is located and $0.15 per square foot for commercial development. The fee will be paid at the time of building permit issuance. 6. LIBRARY IMPACT FEE. Subject to Section __ of Exhibit C, the OWNER and DEVELOPER agree to pay the applicable contribution per unit, as set forth in the inter-governmental Agreement between the VILLAGE and the Plainfield Library District and/or Oswego Library District, as applicable. The fee will be paid at the time of building permit issuance. 7. WATER AND SEWER SERVICE. See Exhibit C. 8. WATER AND SANITARY SEWER FEES. Subject to Section __ of Exhibit C, connection fees required for connection to the VILLAGE’s sanitary sewer system are as established by Village Ordinance. The connection fees to the VILLAGE’s water supply system are as follows: 289 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 4 of 32 Water Meter size (inches) Water Connection Fee 1 $3,305.00 1 ½ $3,810.00 2 $4,280.00 3 $4,775.00 4 $5,250.00 6 $6,230.00 All sanitary sewer construction requiring an Illinois Environmental Protection Agency construction permit, upon receipt of required IEPA Sewer Permit, but before any sewer main construction, the property owner or OWNER shall be required to pay the VILLAGE the total sewer connection fee for the entire area served by said permit. The population equivalent stated on the IEPA permit shall be the basis for calculating the required connection fees. However, said basis shall be subject to review with individual building permit applicants. Substantial sanitary sewer construction shall begin within ninety (90) days of receiving required IEPA sewer construction permits. 9. SANITARY SEWER OVERSIZING IMPACT FEE. The OWNER and DEVELOPER recognize that certain sanitary sewer oversizing is required pursuant to the Sanitary Sewer Recapture Map. Said Map outlines the estimated cost per acre of sewer oversizing according to zones. The oversizing will be constructed by either the OWNER and DEVELOPER or the VILLAGE, at the VILLAGE’s discretion. If constructed by the OWNER and DEVELOPER, recapture will follow the provisions of Section 10 of this ANNEXATION AGREEMENT. If constructed by the VILLAGE, OWNER and DEVELOPER will reimburse all VILLAGE expenses related to the sewer construction, including engineering, easement acquisition, administration and legal fees. The percentage of the total project cost to be reimbursed by DEVELOPER shall be calculated based on the acreage of the development within the recapture area. Any applicable fees shall be payable at the time of final plat or if no platting is necessary, prior to building permit. 10. RECAPTURE FEES. Upon development, DEVELOPER shall be obligated to pay any recapture fees as applicable to the annexed property for municipal water, sanitary sewers, storm water, roadways, traffic signals or improvements or any other improvements as set forth in 65 ILCS 5/9-5-1. VILLAGE may adopt any necessary ordinances to provide for recapture to OWNER for streets, water, sanitary sewer or storm sewer lines constructed by OWNER, which benefit other properties by the installation and/or over sizing of said improvements. Such recapture ordinances shall only be adopted upon satisfactory demonstration by the OWNER or DEVELOPER that the recapture is fair and equitable and that provision of notice of the proposed recapture fees is provided to affected 290 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 5 of 32 property owner. The determination that a proposed recapture is fair and equitable shall be solely that of the VILLAGE. Fees are due upon VILLAGE request. In the event benefiting property subject to recapture is owned by a government agency (e.g., fire protection district, park district, school district), such government entity shall not be required to pay recapture, thus reducing the total amount DEVELOPER and/or VILLAGE are entitled to recapture. Any recapture ordinances shall be for a maximum of ten (10) years from the date of adoption of said ordinance with two percent (2%) interest payable to the OWNER or DEVELOPER commencing two (2) years from the date of completion of said improvement. An administrative fee shall be charged at the rate of two percent (2%) of the total recapturable amount payable to the VILLAGE to cover administrative costs of the recapture Agreement. The costs to be recaptured shall not exceed 110 percent (110%) of the estimated costs per the approved engineer’s opinion of probable construction costs (EOPC). Any increase in cost of more than 5 percent (5%) of the EOPC (but in no event more than 10 percent (10%) of the EOPC) shall not be permitted unless a detailed explanation of the increase in costs is submitted by DEVELOPER and approved by the VILLAGE. 11. ANNEXATION FEES. Subject to Section 4.1 of Exhibit C, the OWNER and DEVELOPER agree to pay an annexation fee to the VILLAGE of $2,000.00 per dwelling unit for any residential development, or $4,000.00 per gross acre for commercial development, payable at the time of final plat or if no platting is necessary, prior to building permit issuance. This fee shall be set at this rate for a period of five (5) years following execution of this Annexation Agreement, after which time the fee shall be as set by Village policy per adopted Resolution then in effect. 12. TRAFFIC IMPROVEMENT FEE. Subject to Section 4.1 of Exhibit C, the OWNER and DEVELOPER agree to pay a traffic improvement fee to the VILLAGE of $1,500.00 per unit of residential development. Said fees shall be payable at the time of final plat or if no platting is necessary, prior to building permit issuance. This fee shall be set at this rate for a period of five (5) years following execution of this Annexation Agreement, after which time the fee shall be as set by Village policy per adopted Resolution then in effect. 13. MUNICIPAL FACILITY FEE. The OWNER and DEVELOPER agrees to pay $1,500.00 per unit for future municipal facilities. Said fees shall be payable at the time of final plat or if no platting is necessary, prior to building permit issuance. This fee shall be set at this rate for a period of five (5) years following execution of this Annexation Agreement, after which time the fee shall be as set by Village policy per adopted Resolution then in effect. 291 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 6 of 32 14. MULTI-MODAL FEE. The DEVELOPER agrees to pay a fee of $250.00 per dwelling unit to help fund regional, non- vehicular transportation and recreation improvements, such as multi-use path connections and extensions. Said fees shall be payable at the time of final plat or if no platting is necessary, prior to building permit issuance. This fee shall be set at this rate for a period of five (5) years following execution of this Annexation Agreement, after which time the fee shall be as set by Village policy per adopted Resolution then in effect. 15. EMERGENCY SERVICES FEE. The DEVELOPER agrees to pay a fee of $50.00 per dwelling unit to help fund emergency service infrastructure, such as tornado sirens and traffic signal emergency pre-emption devices. Said fees shall be payable at the time of final plat or if no platting is necessary, prior to building permit issuance. This fee shall be set at this rate for a period of five (5) years following execution of this Annexation Agreement, after which time the fee shall be as set by Village policy per adopted Resolution then in effect. 16. EASEMENTS. The OWNER agrees to dedicate right-of-way or grant utility easements within thirty (30) days of written request by the VILLAGE, to the extent expressly provided in Exhibit C. 17. SIDEWALKS AND PARKWAY TREES. To the extent expressly provided in Exhibit C, the VILLAGE may require the OWNER to install sidewalks and parkway trees on any platted lot upon notice by the VILLAGE after a period of two (2) years from the date of recording of the final plat which includes that lot. The VILLAGE may also require installation of sidewalks and parkway trees on any platted lot that is consolidated with an adjacent lot. 18. ARCHITECTURAL DESIGN PROVISIONS. Because the Development is commercial and not residential, DEVELOPER agrees to develop the Property according to the Design Standards attached as Exhibit B-2. 19. VARIANCES. No variances will be necessary to develop the property except as described in Exhibit C. 20. MISCELLANEOUS FEES. All other fees provided for by ordinance and uniformly applied and collected in connection with the development of the property within the corporate limits of Plainfield, except as otherwise specified in this Annexation Agreement shall be applicable to the SUBJECT PROPERTY. Payment of all fees due under the Village Ordinances, together with the posting of any and all letters of credit and other guarantees shall be a pre-condition to the approval by the VILLAGE of any final plan, plat or site plan submitted by OWNER and DEVELOPER under this Annexation Agreement. 292 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 7 of 32 21. AMENDMENTS. Except as provided in Exhibit C: (i) This Annexation Agreement, including the attached exhibits, may be amended only with the mutual consent of the parties by a duly executed written instrument subject to notice and hearing as provided by law. (ii) In the case of the VILLAGE, the written instrument may only be in the form of an ordinance duly adopted in accordance with applicable laws. (iii) Modifications subsequent to this Annexation Agreement’s adoption shall require a public hearing and procedures consistent with law. Amendments affecting only a portion of the SUBJECT PROPERTY may be effectuated by duly executed written instrument signed by the VILLAGE and the owner of the relevant portion of the SUBJECT PROPERTY subject to notice and hearing as provided by law. 22. EXHIBIT C. Any modifications to the VILLAGE’S standard Annexation Agreement provisions are set forth in Exhibit C. The OWNER, DEVELOPER and VILLAGE agree that should any conflicts between Exhibit C and the text of this Annexation Agreement exist, the provisions of Exhibit C shall supersede those of this text. 23. DORMANT SPECIAL SERVICE AREA (SSA). OWNER and DEVELOPER agree to the VILLAGE enacting a dormant Special Service Area (SSA) to act as a back-up in the event that the Homeowners’ Association fails to maintain the private common areas, private detention ponds, perimeter landscaping features, and entrance signage within the SUBJECT PROPERTY. The special service area will be completed as part of the first phase of development. 24. ENFORCEMENT. This Annexation Agreement shall be enforceable by any action at law or in equity, including actions for specific performance and injunctive relief. The laws of the State of Illinois shall control the construction and enforcement of this Annexation Agreement. The parties agree that all actions instituted on this Annexation Agreement or the Economic Incentive Agreement approved pursuant to Exhibit C shall be commenced and heard in the Circuit Court of Will County, Illinois, and hereby waive venue in any other court of competent jurisdiction. Before any failure of any party to perform any obligation arising from this Annexation Agreement shall be deemed to constitute a breach, the party claiming the breach shall notify the defaulting party and demand performance. No breach of this Annexation Agreement shall have been found to have occurred if performance is commenced to the satisfaction of the complaining party within thirty (30) days of the receipt of such notice. 25. EFFECT OF SUCCESSORS. This Annexation Agreement shall be binding upon and inure to the benefit of the VILLAGE and its successor municipal corporations and corporate authorities. This Annexation Agreement 293 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 8 of 32 shall be binding upon and inure to the benefit of OWNER, DEVELOPER, and their respective grantees, lessees, assigns, successors and heirs. 26. CONSTRUCTION OF AGREEMENT. This Annexation Agreement shall be interpreted and construed in accordance with the principles applicable to the construction of contracts. Provided, however, that the parties stipulate that they participated equally in the negotiation and drafting of the Annexation Agreement and that no ambiguity contained in this Annexation Agreement shall be construed against a particular party. 27. SEVERABILITY. If any provision, covenant, agreement or portion of this Annexation Agreement or its application to any person, entity or property is held invalid, such invalidity shall not affect the application or validity of any other provision, covenants, agreement or portions of this Annexation Agreement, and this Annexation Agreement is declared to be severable. 28. EFFECT OF THIS ANNEXATION AGREEMENT. The provisions of this Annexation Agreement shall supersede the provisions of any ordinances, codes, policies or regulations of the VILLAGE which may be in conflict with the provisions of this Annexation Agreement. 29. DURATION. This Annexation Agreement shall remain in full force and effect for a term of twenty (20) years from the date of its execution, or for such longer period provided by law. 30. NOTICE. Any notice or demand hereunder from one party to another party or to an assignee or successor in interest of either party or from an assignee or successor in interest of either party to another party, or between assignees or successors in interest, either party shall provide such notice or demand in writing and shall be deemed duly served if mailed by prepaid registered or certified mail addressed as follows: If to the VILLAGE: John F. Argoudelis Joshua Blakemore Village President Village Administrator 24401 W. Lockport Street 24401 W. Lockport Street Plainfield, IL 60544 Plainfield, IL 60544 With copies to: Richard Vogel, Village Attorney Tracy, Johnson & Wilson 2801 Black Road, 2nd Floor 294 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 9 of 32 Joliet, IL 60435 If to OWNER: Dr. Rong Tu 2240 Highland Avenue Lombard, IL 60148 With copies to: Dick Kuhn Kuhn, Heap & Monson 522 S. Washington Street, Suite 100 Naperville, IL 60540 If to DEVELOPER: Woodman’s Food Market, Inc. Attn: VP–Real Estate 2631 Liberty Lane Janesville, WI 53545 With copies to: Boardman & Clark LLP 1 S. Pinckney Street, Suite 410 Madison, WI 53703 Or to such address as any party hereto or an assignee or successor in interest of a party hereto may from time to time designate by notice to the other party hereto or their successors in interest. IN WITNESS WHEREOF, the parties have caused this Annexation Agreement to be executed the day and year first above written. 295 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 10 of 32 THE VILLAGE OF PLAINFIELD a Municipal Corporation By: Village President ATTEST: By: Village Clerk DEVELOPER: Woodman’s Food Market, Inc. By: Clint Woodman, President OWNER: Chicago Title Land Trust Company, successor trustee to North Star Trust Company, successor trustee to MB Financial Bank, N.A. successor to The Mid-City National Bank of Chicago, successor to Bank Of Elmhurst, as trustee under Trust Agreement dated May 11, 1987, and known as Trust Number 163-0587, an Illinois land trust By: Name: Title: This instrument is executed by Chicago Title Land Trust Company not personally but solely as Trustee under trust No. 163-0587, in the exercise of the power and authority conferred upon and vested in it as such Trustee. All the terms, provisions, stipulations, covenants and conditions to be performed by Chicago Title Land Trust Company are undertaken by it solely as Trustee, as aforesaid, and not individually, and all statements herein made are made on information and belief and are to be construed accordingly, and no personal liability shall be asserted or be enforceable against Chicago Title Land Trust Company by reason of any of the terms, provisions, stipulations, covenants and/or statements contained in this instrument. 296 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT A—PLAT OF ANNEXATION & LEGAL DESCRIPTION P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 1 of 32 B&C v0 THAT PART OF THE WEST 1/2 OF THE SOUTHWEST 1/4 OF SECTION 22, TOWNSHIP 37 NORTH, RANGE 9, EAST OF THE THIRD PRINCIPAL MERIDIAN, TOWN OF WHEATLAND, WILL COUNTY, ILLINOIS, MORE PARTICULARLY DESCRIBED AS FOLLOWS: COMMENCING AT THE SOUTHWEST CORNER OF THE SOUTHWEST 1/4 OF SAID SECTION 22; THENCE NORTH 88°59’17” EAST ALONG THE SOUTH LINE OF SAID SOUTHWEST 1/4 SECTION 615.52 FEET TO THE POINT OF BEGINNING; THENCE NORTH 01°56’00” WEST 52.90 FEET TO A POINT ON THE NORTH RIGHT-OF-WAY LINE OF WEST 119TH STREET; THENCE SOUTH 88°27’13” WEST ALONG SAID NORTH LINE 495.36 FEET TO A POINT; THENCE NORTH 51°54’19” WEST 38.60 FEET TO A POINT ON THE EAST RIGHT-OF-WAY LINE OF STATE ROUTE “59”; THENCE NORTH 01°54’12” WEST ALONG SAID EAST LINE 1248.93 FEET TO A POINT; THENCE NORTH 88°06’19” EAST ALONG THE SOUTH LINE OF SOUTH POINTE UNIT 1, A DISTANCE OF 36.35 FEET TO A POINT; THENCE NORTH 01°53’41” WEST 1.14 FEET TO A POINT ON SAID SOUTH LINE; THENCE NORTH 88°55’16” EAST ALONG SAID SOUTH LINE 1202.29 FEET TO A POINT ON THE WEST LINE OF THE EAST 1/2 OF THE SOUTHWEST 1/4 OF SAID SECTION 22; THENCE SOUTH 01°40’38” EAST ALONG SAID WEST LINE 1324.59 FEET TO A POINT ON THE SOUTH LINE OF THE SOUTHWEST 1/4 OF SECTION 22; THENCE SOUTH 88°59’17” WEST ALONG SAID SOUTH LINE 708.43 FEET TO THE POINT OF BEGINNING. SAID LANDS CONTAINING 1,585,979 SQUARE FEET OR 36.4091 ACRES. Permanent Index Number: 07-01-22-300-017-0000 297 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT B-1—PRELIMINARY DEVELOPMENT PLAN P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 1 of 32 B&C v0 “Preliminary Development Plan” means and includes the following plans prepared by RA Smith: • “Preliminary Site & Landscape Plans” dated 01/29/2024 included in Plan Commission Meeting Agenda of 02/06/2024 • “Preliminary Plat • “Preliminary Engineering Plans” dated [TBD] and including each of the following: SHEET NUMBER DESCRIPTION C100 TITLE SHEET C200 EXISTING CONDITIONS & DEMOLITION PLAN C300 OVERALL SITE PLAN C301-306 DETAILED SITE PLANS C400 OVERALL GRADING PLAN C401-406 DETAILED GRADING PLANS C500 EROSION CONTROL PLAN C600 OVERALL UTILITY PLAN C601-606 STORM SEWER PLANS C700-705 SANITARY SEWER PLAN & PROFILE C800 WATER MAIN PLAN C900-904 SITE DETAILS & SPECIFICATIONS L100 OVERALL LANDSCAPE PLAN L200-L204 DETAILED LANDSCAPE PLANS [TO BE UPDATED] 298 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT B-2—DESIGN STANDARDS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 1 of 32 B&C v0 CROSSROADS CENTER DESIGN STANDARDS Village of Plainfield, IL March 2024 [WILL INSERT WHEN FINAL] 299 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 2 of 32 B&C v0 CONTENTS 1. BACKGROUND Error! Bookmark not defined. 1.1 Definitions 16 1.2 Authority Error! Bookmark not defined. 1.3 Prior Agreements 16 1.4 Exculpation Error! Bookmark not defined. 2. ANNEXATION/ZONING/ORDINANCES (Section 2 of the Annexation Agreement) 2 2.1 PD Ordinance & Annexation Agreement Error! Bookmark not defined. 2.2 Annexation 2 2.3 Compliance with Village Ordinances. 2 2.4 Additional Uses 3 2.5 Plans Error! Bookmark not defined. 3. Development Error! Bookmark not defined. 3.1 Construction of Project 15 3.2 Timing of Construction Error! Bookmark not defined. 3.3 Screening 16 3.4 Liquor Licenses Error! Bookmark not defined. 3.5 Estoppel Certificates 17 3.6 Operations 16 3.7 Site Lighting Regulations 16 3.8 Construction Vehicle Access 16 4. IMPACT FEES, ANNEXATION FEE, AND DONATIONS (SECTIONS 4, 6, 11, 12, 13, AND 14 THE ANNEXATION AGREEMENT). 4 4.1 Inapplicable Donations and Fees 4 4.2 No Other Impact Fees, Donation, or Dedications. 4 5. DORMANT SSA (SECTION 21 OF THE ANNEXATION AGREEMENT). 4 6. SANITARY SEWER IMPROVEMENTS (SECTION 7 OF THE ANNEXATION AGREEMENT). 6 6.1 Capacity 6 6.2 Construction 6 7. WATER IMPROVEMENTS (SECTION 7 OF THE ANNEXATION AGREEMENT). 6 8. ROADWAY IMPROVEMENTS. 6 8.1 Construction 7 8.2 Dedication Error! Bookmark not defined. 9. APPLICABLE RECAPTURE FEES TO BE PAID BY DEVELOPER (SECTION 10 OF THE ANNEXATION AGREEMENT). 8 10. NO OVERSIZING REQUIRED (SECTION 10 OF THE ANNEXATION AGREEMENT). 8 11. EASEMENTS (SECTION 15 OF THE ANNEXATION AGREEMENT). 8 12. DEVELOPMENT OF SUBJECT PROPERTY IN ACCORDANCE WITH APPROVED DOCUMENTS. 8 12.1 Developer’s General Rights 8 12.2 No Obligation to Develop 9 12.3 Phasing of Development; Timing of Final Plan Submittals 9 12.4 Final Plan Submittals 9 12.5 Review and Determination of Major and Minor Changes 10 12.6 Approval or Denial of Final Plan Submittals 10 12.7 Effect of Approval 11 12.8 Costs of Review Error! Bookmark not defined. 13. VARIANCES (SECTION 17 OF THE ANNEXATION AGREEMENT). 11 14. BUILDING AND OCCUPANCY PERMITS; STOP WORK ORDERS. 12 14.1 Building Permits. 12 14.2 Certificates of Occupancy. 12 14.3 Costs for Satisfying Review TimesError! Bookmark not defined. 14.4 Stop Work Orders 13 15. PRELIMINARY GRADING AND PREPARATION OF THE PROPERTY FOR DEVELOPMENT. 13 16. TEMPORARY SIGNAGE 13 17. LIQUOR LICENSES 13 18. ESTABLISHMENT OF SPECIAL SERVICE AREA FOR PUBLIC IMPROVEMENTS. Error! Bookmark not defined. 19. ECONOMIC INCENTIVE AGREEMENT. 14 20. AMENDMENTS (SECTION 19 OF THE ANNEXATION AGREEMENT. 14 21. ENFORCEMENT (SECTION 22 OF THE ANNEXATION AGREEMENT). 14 22. RIGHTS AND OBLIGATIONS OF OWNER (SECTION 23 OF THE ANNEXATION AGREEMENT). 14 23. SUCCESSORS IN INTEREST (SECTION 23 OF THE ANNEXATION AGREEMENT). 15 23.1 Binding Effect of Agreement 15 23.2 Release of Obligations Through Conveyance 15 300 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 2 of 32 1. ANNEXATION/ZONING/ORDINANCES (Section 2 of the Annexation Agreement) 1.1 ANNEXATION (A) PETITION. Contemporaneously with its delivery to VILLAGE of (i) an executed copy of the Annexation Agreement and (ii) satisfactory proof of DEVELOPER’s acquisition of the fee simple interest in the SUBJECT PROPERTY (the “Acquisition Date”), DEVELOPER shall file a petition for annexing the SUBJECT PROPERTY to the VILLAGE pursuant to Section 7-1-8 of the Illinois Municipal Code (65 ILCS 5/7-1-8) (“Annexation Petition”). This Annexation Agreement will terminate and be of no further force or effect if DEVELOPER has not submitted the Annexation Petition to the VILLAGE within one year after the full execution of this Annexation Agreement (“Effective Date”). (B) ADOPTION. At its first regular meeting that is at least seven business days after the filing of the Annexation Petition, the VILLAGE shall enact and adopt an ordinance annexing the SUBJECT PROPERTY (the “Annexation Ordinance”), an ordinance granting B-3 Highway Business District Zoning to the SUBJECT PROPERTY (the “Zoning Ordinance”), and an ordinance approving a special use for Planned Development, the substance of which shall incorporate the submittals identified in Exhibit B-1 and otherwise be consistent with the Annexation Agreement. (C) RECORDING/AMENDMENT. Within thirty (30) days after the adoption of the Annexation Ordinance, the VILLAGE shall: (i) record the Annexation Agreement, Annexation Ordinance and the Final Plat (defined below); and (ii) amend the VILLAGE’s official zoning map to reflect the Zoning Ordinance. 1.2 COMPLIANCE WITH VILLAGE ORDINANCES. (A) GENERALLY. The SUBJECT PROPERTY shall be developed in accordance with ordinances, codes, policies, and regulations of the VILLAGE (collectively, “Village Ordinances”) except as modified or otherwise provided for in the Annexation Agreement. If any provision of the Annexation Agreement or any other Approved Document (defined below), including the Final Development Plan, is inconsistent with a Village Ordinance, current or future, then the Approved Document shall supersede and control over such Village Ordinance and Zoning Ordinance. (B) AMENDMENTS. (1) General Amendments to Village Ordinances. During the term of this Annexation Agreement, no amendment to a Village Ordinance pertaining to land use or development (including fees and charges relating to land use and development) shall apply to the DEVELOPER’s development of the Woodman’s Project, subject to Section 1.2(C) of this Exhibit C. From the Effective Date through that date which is three (3) years thereafter, no amendment to a Village Ordinance pertaining to land use or development (including fees and charges relating to land use and development) shall apply to the development of the Outlots within the SUBJECT PROPERTY, , subject to Section 1.2(C) of this Exhibit C. 301 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 3 of 32 (2) Zoning Amendment. No amendment, modification, or change to (and no action that has the effect of amending, modifying, or changing, or requiring an amendment, modification, or change to) the PD Ordinance, the Zoning Ordinance, the Preliminary Development Plan, or the Final Development Plan shall be applicable to the SUBJECT PROPERTY, without the prior, express, written consent of DEVELOPER. (C) LESS RESTRICTIVE CODES. If, during the term of the Annexation Agreement, any of the Village Ordinances is generally modified, amended, interpreted, or changed so as to be less restrictive than the Village Ordinance that is otherwise applicable, then such less restrictive Village Ordinance shall inure to DEVELOPER’S benefit and DEVELOPER may elect to develop the SUBJECT PROPERTY pursuant to such less restrictive Village Ordinance. (D) SUNSETS. Notwithstanding any of the Village Ordinances that may be to the contrary, the Approved Documents shall remain in effect with respect to the Woodman’s Project and no permit issued by the Village with respect to the Woodman’s Project shall expire prior to the expiration of the term of the Annexation Agreement. 2. ADDITIONAL USES 2.1 PERMITTED All permitted uses and special uses allowed currently within the B-3 Highway Business District or allowed in the future within the B-3 Highway Business District shall be deemed to be permitted uses on the SUBJECT PROPERTY. In addition, and not by way of limitation, the following uses shall be permitted uses on the SUBJECT PROPERTY (collectively, the “Additional Permitted Uses”): (1) outdoor dining areas for restaurants and eating establishments; (2) one drive-through that is accessory to a permitted use; (3) outdoor retail sales and display areas, provided that such use shall be permitted within 30 feet of either Route 59 or 119th Street only with written approval of the Corporate Authorities; (4) special events such as, but not limited to, art shows, fashion shows, charity events and children’s events; (5) special amenities, such as, but not limited to, kiosks and water features, fire pits, gathering places and similar amenities.; and (6) future lot splits of the Outlots shall be as described in Section 13.2 of this 2C. 2.2 PROHIBITED Outdoor storage shall not be permitted in the Development. 302 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 4 of 32 3. INTERIM USES The interim uses set forth below shall be permitted anywhere on the SUBJECT PROPERTY during the term of the Annexation Agreement, subject to a restoration bond, as necessary, in accordance with the provisions of Article I, Section 2.5-1(1) of the Building Code of the VILLAGE (collectively, the “Interim Uses”): (1) all types of farming; (2) borrow pits; (3) parking lots; (4) stock piling, removal and or sale of dirt, clay, gravel or other construction materials; (5) temporary stormwater detention; and (6) construction, storage and office trailers. 4. FEES (IMPACT, ANNEXATION, DONATIONS & OTHERS) 4.1 INAPPLICABLE DONATIONS AND FEES Because the SUBJECT PROPERTY is not being developed as a residential development, Sections 4, 6, 12, 13, 14, and 15 of the Annexation Agreement shall not apply to the SUBJECT PROPERTY and neither OWNER nor DEVELOPER shall be required to make any land donation, pay any impact fee in lieu thereof, or pay any other fee, provided for in such Sections, except as expressly provided in this Exhibit C. 4.2 NO OTHER IMPACT FEES, DONATION, OR DEDICATIONS. The VILLAGE represents and warrants that: (A) IMPACT FEES. Unless waived by action of the Fire Protection District, the only impact fee that OWNER or DEVELOPER shall be required to pay for the Project shall be to the Fire Protection District identified in Section 5 of the Annexation Agreement, in the amount of $0.15 per square foot of commercial building developed. (B) DEDICATIONS. The only dedications that DEVELOPER shall be required to make for the Development shall be as described Sections 6 through 8 of this Exhibit C, and the easements on the Final Plat, as provided in Section 11 of this Exhibit C. (C) NO OTHERS. The VILLAGE shall impose no additional impact fees or dedications that apply to the SUBJECT PROPERTY or to OWNER or DEVELOPER (including fees or dedications intended to pay or provide for public facilities, property, or costs that are made necessary by the development of the SUBJECT PROPERTY). (D) FUTURE EXCLUSIONS. If the VILLAGE adopts any ordinance or other action requiring impact fees or dedications in the future that impacts the Development, it shall take any action that may be necessary to exempt DEVELOPER from such future fees and dedications as applied to the Woodman’s Project for the term of the Annexation Agreement, and to exempt DEVELOPER from such future fees and 303 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 5 of 32 dedications as applied to the development of the Outlots for a period of three (3) years from the Effective Date. 4.3 REVIEW & PERMIT/INSPECTION FEES Final Plan submittal review fees shall be as set forth in Section 7-163 of the Village Code of Ordinances. Building permit review and inspection fees shall be as set forth in Chapter 2.5, Article XII of the Village Code of Ordinances. 4.4 CONNECTION FEES Sewer and water utility connection fees shall be as set forth in Section 8-56 of the Village Code of Ordinances. 4.5 RECAPTURE FEES VILLAGE and DEVELOPER acknowledge that recapture fees or obligations may become due and owing in connection with the development of the SUBJECT PROPERTY pursuant to certain agreements recorded with the Will County Recorder’s Office as Document Nos. R96-097390 and R97-101174, but further acknowledge the existence of concerns over the enforcement of the same and the identification of the proper parties in interest to receive payment thereunder. Accordingly, to eliminate undue delay in the development of the SUBJECT PROPERTY as contemplated by the Annexation Agreement, VILLAGE shall hold DEVELOPER harmless from claims for recapture payments asserted under either of Document Nos. R96-097390 or R97-101174, either by cooperating with DEVELOPER to amend the Economic Incentive Agreement set forth in Exhibit E to increase the amount of the incentive provided to DEVELOPER thereunder by an amount equal to any amount paid by DEVELOPER pursuant to Document Nos. R96-097390 and R97-101174, or by taking such other actions as may be necessary to relieve DEVELOPER from ultimate financial responsibility under Document Nos. R96-097390 and R97-101174. 4.6 FEE & RATE LOCK The types and amounts of fees described in this Section 4 of Exhibit C shall be valid and not subject to increase in connection with the development of the Woodman’s Project during the term of the Annexation Agreement, and shall be valid and not subject to increase in connection with the development of the Outlots for a period of three (3) years following the Effective Date. 5. DORMANT SSA (SECTION 21 OF THE ANNEXATION AGREEMENT). Because the SUBJECT PROPERTY is not being developed as a residential development, Section 21 of the Annexation Agreement shall not apply to the SUBJECT PROPERTY and the VILLAGE shall not establish any Dormant SSA within the SUBJECT PROPERTY to back up Homeowner Association maintenance. However, DEVELOPER shall include provisions reasonably acceptable to VILLAGE in any declaration recorded against the SUBJECT PROPERTY enabling VILLAGE to enforce provisions of the declaration pertaining to the maintenance and upkeep of common areas within the SUBJECT PROPERTY as ultimately developed in the event of the failure or default of the association responsible for the common areas to perform such 304 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 6 of 32 maintenance and upkeep of the common areas, and to recover the costs thereof on a pro rata basis from the then-owners of the SUBJECT PROPERTY. 6. SANITARY SEWER IMPROVEMENTS (SECTION 7 OF THE ANNEXATION AGREEMENT). 6.1 CAPACITY The VILLAGE hereby acknowledges that it has been provided adequate information regarding the sanitary sewer demands of the Development and the VILLAGE warrants that it has the capacity, transmission lines, and other improvements necessary to service such demands and that it will maintain sufficient capacity, transmission lines, and other improvements to serve such demands, subject only to the performance by DEVELOPER of any construction work described below. 6.2 CONSTRUCTION DEVELOPER will construct sanitary sewer lines, mains and other improvements, as shown in the Preliminary Engineering Plans (the “Public Sanitary Sewer Improvements”), subject to DEVELOPER’s preparation and submittal of Final Engineering Plans, and the review and approval of the same by the Village Engineer. VILLAGE has no responsibility to construct any sanitary sewer lines, mains or other improvements under this Annexation Agreement. 6.3 DEDICATION DEVELOPER will dedicate the Public Sanitary Sewer Improvements upon inspection and acceptance by the Village by customary bill of sale. 7. WATER IMPROVEMENTS (SECTION 7 OF THE ANNEXATION AGREEMENT). 7.1 CAPACITY The VILLAGE hereby acknowledges that it has been provided adequate information regarding the water demands of the Development and the VILLAGE warrants that it has the capacity, transmission lines, and other improvements necessary to service such demands and that it will maintain sufficient capacity, transmission lines, and other improvements to serve such demands, subject only to the performance by DEVELOPER of any construction work described below. 7.2 CONSTRUCTION DEVELOPER will construct water lines, mains and other improvements, as shown in the Preliminary Engineering Plans (the “Public Water Main Improvements”), subject to DEVELOPER’s preparation and submittal of Final Engineering Plans, and the review and approval of the same by the Village Engineer. VILLAGE has no responsibility to construct any water lines, mains or other improvements under this Annexation Agreement. 7.3 DEDICATION DEVELOPER will dedicate the Public Water Main Improvements upon inspection and acceptance by the Village by customary bill of sale. 305 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 7 of 32 8. OTHER IMPROVEMENTS. 8.1 ROAD IMPROVEMENTS (A) CONSTRUCTION. DEVELOPER shall construct the road improvements, new traffic signals, upgrades to existing traffic signals and access points into the Development as shown on the Preliminary Engineering Plans and in accordance with Village Ordinances, IDOT requirements and applicable laws (the “Public Road Improvements”). VILLAGE has no responsibility under the Annexation Agreement to construct any road improvements. (1) The VILLAGE agrees to support and assist DEVELOPER in obtaining Illinois Department of Transportation (“IDOT”) approval of the location and signalization of the two signalized main access drives to the SUBJECT PROPERTY on Illinois Route 59 and at 119th Street as depicted on the Preliminary Engineering Plans and any approvals required for such Public Road Improvements. DEVELOPER shall be responsible for construction such road improvements as IDOT may require in connection with the contemplated development of the SUBJECT PROPERTY. (2) The VILLAGE agrees to obtain any necessary rights of way, easements, or other rights from other property owners that may be required to complete any Public Road Improvements depicted on the Preliminary Engineering Plans. If any required right of way, easement, or right has not been obtained by the VILLAGE by the time that DEVELOPER files for building permits for the Development, such that the Public Road Improvements to 119th Street cannot be constructed in accordance with the Preliminary Engineering Plans, then the VILLAGE will cooperate in modifying the Final Development Plan and final engineering plans, to be approved in accordance with applicable Village Ordinances (“Final Engineering Plans”), to permit such Public Road Improvements to be constructed in a manner that reflects the property rights that have been acquired as of such date. (B) DEDICATION. The DEVELOPER agrees to dedicate a portion of the SUBJECT PROPERTY located along the southern boundary of the Subject Property and adjacent to 119th Street as provided in the Preliminary Plat (the “119th Street Dedication Parcel”), as well as the Public Road Improvements. DEVELOPER shall provide a separate Plat of Dedication for the 119th Street Dedication Parcel. DEVELOPER also agrees that it shall dedicate to IDOT such portions of the SUBJECT PROPERTY as IDOT may require for the construction of improvements to Illinois Route 59, its intersection with 119th Street, or the construction of the contemplated signalized access drives to the SUBJECT PROPERTY. 8.2 STORMWATER DEVELOPER shall construct such stormwater management improvements as are shown in the Preliminary Engineering Plans, subject to DEVELOPER’s preparation and submittal of Final Engineering Plans, and the review and approval of the same by the 306 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 8 of 32 Village Engineer. VILLAGE has no responsibility under the Annexation Agreement to construct any stormwater improvements. 9. APPLICABLE RECAPTURE FEES TO BE PAID BY DEVELOPER (SECTION 10 OF THE ANNEXATION AGREEMENT). Except as described in Section 4.5 of this Exhibit C, the VILLAGE represents and warrants that (i) there are no recapture fees applicable to the SUBJECT PROPERTY, and (ii) it shall not impose any recapture fees against the SUBJECT PROPERTY in the future; notwithstanding any other statements, references, or suggestions to the contrary. 10. OVERSIZING REQUIRED (SECTIONS 9 AND 10 OF THE ANNEXATION AGREEMENT). DEVELOPER and VILLAGE acknowledge that a water main to be constructed by the DEVELOPER to serve the SUBJECT PROPERTY is being oversized to accommodate the potential future water needs of an adjacent parcel to the east, identified in Exhibit F hereto, and that the construction of the water line at issue will requiring an extraordinary expense to bore under Illinois Route 59. Accordingly, upon completion of the construction of the water line, VILLAGE shall, consistent with Section 10 of the Annexation Agreement, adopt a recapture ordinance providing that the DEVELOPER shall be entitled to recover the cost of increasing the size of the water main for the benefit of the property identified in Exhibit F, plus a pro rata share based on the relative acreages of the SUBJECT PROPERTY and the property identified in Exhibit F of the cost of boring under Illinois Route 59. Except as identified in the preceding sentence, DEVELOPER shall not be required to construct any municipal water improvements, sanitary sewers, storm water improvements, roadways, traffic signals or other public improvements (“Public Improvements”), or any portion of any Public Improvement, unless the Public Improvement, or portion thereof, is necessary to serve the Development. 11. EASEMENTS (SECTION 15 OF THE ANNEXATION AGREEMENT). The Final Plat shall designate all easements that DEVELOPER shall be required to grant to serve the Development. 12. DEVELOPMENT OF SUBJECT PROPERTY IN ACCORDANCE WITH APPROVED DOCUMENTS. 12.1 DEVELOPER’S GENERAL RIGHTS (A) DEVELOPER shall have the right to develop the SUBJECT PROPERTY in accordance with the following (collectively, the “Approved Documents”): (1) A final development plan (as provided in this Section 12) (“Final Development Plan”), which Final Development Plan shall substantially comply with the Preliminary Development Plan, unless a Minor Change or Major Change (defined below) from the Preliminary Development Plan is approved as provided in Section 12.5; (2) A final plat of subdivision (the “Final Plat”), which Final Plat shall substantially comply with the Preliminary Plat, subject to Section 17 of this Exhibit C; (3) Final Engineering Plans; 307 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 9 of 32 (4) This Annexation Agreement; (5) The PD Ordinance; (6) The Zoning Ordinance; (7) The Design Standards; and (8) Any other document relating to the Development that is approved by the VILLAGE or other governmental agency with jurisdiction over such approval. (B) No further VILLAGE approval shall be required for DEVELOPER to develop the Development in accordance with the Approved Documents, except for building permits and occupancy permits. Without limiting the preceding sentence, DEVELOPER shall not be required to obtain separate site plan approval to develop the SUBJECT PROPERTY, as provided in Section 9-108 and 9-111 of the VILLAGE Zoning Code, with such approval being deemed granted by VILLAGE approval of the Final Development Plan. 12.2 NO OBLIGATION TO DEVELOP The Village acknowledges that no Village Ordinance requires DEVELOPER to proceed with the development of the SUBJECT PROPERTY or to proceed with such development within any required time period. DEVELOPER acknowledges that the rights and obligations set forth herein shall be deemed to be required standards for performance if the SUBJECT PROPERTY is developed by DEVELOPER. 12.3 PHASING OF DEVELOPMENT; TIMING OF FINAL PLAN SUBMITTALS Notwithstanding any provision of the Village Ordinances to the contrary, (i) DEVELOPER shall not be required to submit Final Plan Submittals (defined below), within any particular time period; (ii) the Preliminary Development Plan shall not expire; and (iii) DEVELOPER may develop the SUBJECT PROPERTY in a single phase or in multiple phases. 12.4 FINAL PLAN SUBMITTALS To obtain approval or amendment of the Final Development Plan, DEVELOPER shall submit the following documents to the Village Planner: (i) elevation plans depicting the buildings and other structures to be constructed as part of the Development (“Elevation Plans”); (ii) sign plans depicting the signs to be constructed as part of the Development (“Final Sign Plans”); (iii) Final Engineering Plans; (iv) a Final Plat; (v) a final lighting and photometric plan; (vi) a final landscape plan; (vii) a Declaration of Servitudes that shall be applicable to the Development; and (viii) Final Design Standards (collectively, “Final Plan Submittals”). (A) Any conflicts between the Final Engineering Plans and the approved final landscape plan shall be resolved in favor of the former. By approving theses plans, the VILLAGE shall be deemed to have conclusively determined that the 308 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 10 of 32 plans adequately conform to the requirements of the Design Standards and all applicable Village Ordinances. (B) The Village shall review the site plans, preliminary and final engineering plans, and preliminary and final landscape plans that other parties submit to the VILLAGE from time to time in furtherance of the development of the Outlots (the Outlot Final Plans”) and administratively approve them if they are in substantial conformance with the provisions of this Annexation Agreement, including the Design Standards, and. In other words, the review of such development plans by the Plan Commission and the Corporate Authorities shall not be required. 12.5 REVIEW AND DETERMINATION OF MAJOR AND MINOR CHANGES The Village Planner shall review the Final Plan Submittals and, within 45 days after receipt thereof, shall determine, and notify DEVELOPER in writing, whether there is a difference between (i) the Preliminary Development Plan and the Final Submittals; or (ii) if a Final Development Plan (or portion thereof) has already been approved, the Final Development Plan (or approved portion thereof) and the Final Plan Submittals (a “Plan Difference”) and, if, whether such Plan Difference is a Minor Change or Major Change. (A) A “Major Change” is a Plan Difference that: (1) substantially alters the concept, character, or intent of the Preliminary Development Plan, including the Design Standards, or the Final Development Plan (as the case may be) as a whole; (2) increases by more than 20% any of the following standards set forth in the Design Standards; (a) a Maximum Building Height for a building in the Development; or (b) the gross floor area of any building or the entire Development. (3) decreases the Minimum Setback from a building to the perimeter of the Subject Property, as set forth in the Design Standards; (4) decreases by more than 20% any of the following standards set forth in the Design Standards: (a) the Minimum Lot Size for a lot in the Development; or (b) the Minimum Interior Side Setback or Minimum Rear Setback for a building in the Development; or (5) significantly reduces the number, type, or location of landscaping or existing vegetation throughout the SUBJECT PROPERTY as a whole; or (6) has a significant adverse environmental impact. (B) A “Minor Change” is a Plan Difference that is not a Major Change. 309 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 11 of 32 12.6 APPROVAL OR DENIAL OF FINAL PLAN SUBMITTALS (A) MINOR CHANGE. If a Final Plan Submittal effects no Plan Difference, the Village Planner shall approve the Final Plan Submittal. If a Final Plan Submittal effects a Minor Change, the Village Planner shall review and may approve the same administratively. (B) MAJOR CHANGE REFERRAL. If the Village Planner determines that a Final Plan Submittal effects a Major Change, the Village Planner shall notify DEVELOPER in writing and DEVELOPER shall then elect whether to have the Final Plan Submittal referred to the Village Plan Commission or Corporate Authorities for a public hearing to review the Final Plan Submittal. (1) Plan Commission or Corporate Authorities Action. If the Final Plan Submittals are referred to the Plan Commission or directly to the Corporate Authorities, such body shall: (a) hold a public hearing; (b) make written findings of fact; (c) affirm or reverse the Village Planner’s determination that the Final Submittal is a Major Change; (d) if it reverses the determination that a Final Plan Submittal effects a Major Change, approve such Final Plan Submittal; and (e) if it affirms such determination, then approve, deny, or approve with modifications the Major Change provided for in such Final Plan Submittal. (2) Corporate Authorities Appeal. If the Plan Commission denies or approves with modifications the Major Change, DEVELOPER may appeal such decision to the Corporate Authorities within 30 days after such decision. If DEVELOPER appeals the decision of the Plan Commission, the Corporate Authorities shall, at a public meeting: (a) affirm or reverse the Plan Commission’s denial or approval with modifications; (b) if it reverses the determination that a Final Plan Submittal effects a Major Change, approve such Final Plan Submittal; and (c) if it affirms such determination, approve, deny, or approve with modifications the Major Change provided for in such Final Plan Submittal. 12.7 EFFECT OF APPROVAL Upon approval of a Final Plan Submittal, such Final Plan Submittal shall thereafter be deemed to be a component of the Final Development Plan. 310 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 12 of 32 13. VARIANCES (SECTION 17 OF THE ANNEXATION AGREEMENT). 13.1 GENERALLY The parties acknowledge and agree that, pursuant to the Village Ordinances, the VILLAGE has the authority to approve a planned development and, in conjunction therewith, modify any and all of the normal zoning standards, requirements, and procedures of the Village Ordinances, To the extent that the Final Development Plan, any other Approved Document, or the procedure for the approval of any Approved Document, differs in any way from any Village Ordinance, such Village Ordinance shall be deemed to be varied, modified, or waived as is necessary or desirable to allow the development of the Development in accordance with such Final Development Plan, Approved Document, or procedure and the VILLAGE shall take any action that is necessary or desirable to effectuate such variation, modification, or waiver. 13.2 SUBDIVISION Subject to the provisions of the Illinois Plat Act (765 ILCS 205/1 et seq.), DEVELOPER and future owners and developers of the Outlots who seek to subdivide such Lots will be required to submit to the VILLAGE preliminary and final plats of subdivision and process them for approval in accordance with applicable provisions of the VILLAGE subdivision ordinance. The Village agrees that, notwithstanding the fact that the resulting parcels may be less than one acre in size, DEVELOPER and its successors shall be entitled to the following future lot splits (as also described in Section 3(B) of the Design Standards), and to the extent necessary, the VILLAGE grants a variance of the Village’s subdivision ordinance in the following respects (“Subdivision Variances”): (A) Re-subdivision of Lot 3 will result in the creation of no more than two lots; (B) Re-subdivision of Lot 4 will result in the creation of no more than four lots: (C) Re-subdivision of Lot 7 will result in the creation of no more than three lots; and (D) Lot 8 may not be further subdivided. 14. BUILDING AND OCCUPANCY PERMITS; STOP WORK ORDERS. 14.1 BUILDING PERMITS. (A) DEVELOPER APPROVAL OF PLANS. The VILLAGE shall not issue any building permit for structures within the Development to any applicant unless the applicant has provided to the VILLAGE a letter from DEVELOPER indicating that DEVELOPER has reviewed and approved the plans, specifications, and all other submissions by the applicant to the VILLAGE in support of its application for a building permit. (B) TIME FOR REVIEW. Within twenty one (21) days after DEVELOPER or other applicant submits an application to the VILLAGE for a building permit for structures within the Development, the VILLAGE shall provide to DEVELOPER and the applicant written notice specifically identifying (i) each provision of such application that fails to comply with Village Ordinances (a “BP Application 311 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 13 of 32 Deficiency”); and (ii) the specific citation of any such Village Ordinance. Within thirty (30) days after such an application is submitted to the VILLAGE, the VILLAGE shall issue such permit (provided that any BP Application Deficiency has been corrected). 14.2 CERTIFICATES OF OCCUPANCY. (A) TEMPORARY CERTIFICATE OF OCCUPANCY. If certain improvements generally necessary for the issuance of a certificate of occupancy, including without limitation final grading, landscaping, sidewalks, or driveways, cannot be completed because of weather or other temporary conditions, the VILLAGE shall issue a temporary certificate of occupancy provided that all life safety system are adequate and in place. (B) TIME FOR REVIEW AND INSPECTION. Within 48 hours after DEVELOPER or other applicant submits an application to the VILLAGE for a certificate of occupancy for structures within the Development, the VILLAGE shall conduct an inspection and provide to DEVELOPER and the applicant written notice specifically identifying (i) each deficiency of a structure that fails to comply with Village Ordinances (“C of O Deficiency”); and (ii) the specific citation of any such Village Ordinance. Within five (5) business days after such an application is submitted to the VILLAGE, the VILLAGE shall issue such certificate (provided that any C of O Deficiency has been corrected). 14.3 STOP WORK ORDERS The VILLAGE shall issue no stop order directing work stoppage without (i) detailing the section of the Village Ordinances or portion of the Annexation Agreement violated by DEVELOPER or its agents; and (ii) allowing DEVELOPER five (5) days in which to cure the violation. If a stop work order relates to public safety, however, the VILLAGE may require DEVELOPER to cease all work immediately until DEVELOPER corrects that violation to the reasonable satisfaction of the VILLAGE. 15. PRELIMINARY GRADING AND PREPARATION OF THE PROPERTY FOR DEVELOPMENT. Following annexation of the SUBJECT PROPERTY, and prior to final engineering approval. DEVELOPER shall have the right, but not the obligation, at its risk, to undertake, preliminary grading work, temporary detention, filling and soil stockpiling on the SUBJECT PROPERTY in preparation for the development of the SUBJECT PROPERTY upon submittal and VILLAGE approval of a grading plan and soil erosion plan. No surety need be posted with the VILLAGE by DEVELOPER, notwithstanding Chapter 7, Section 7-142 of the Village Ordinances. 16. TEMPORARY SIGNAGE DEVELOPER shall be permitted to install three (3) temporary marketing signs on the SUBJECT PROPERTY along Illinois Route 59 and 119th Street advertising the Development which (i) may have a maximum face area of 320 square feet per side; (ii) a maximum height of twenty (20) feet; and (iii) shall be removed prior to the grand opening of the Development. Additional temporary signage regarding construction and financing of the Development shall be 312 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 14 of 32 permitted as set forth in the Final Sign Plan. Such temporary signs shall be reviewed by the Village Planner and approved, unless they do not comply with this Section 16. 17. LIQUOR LICENSES Contingent upon compliance with Chapter 4, Article II of the Plainfield Municipal Code, the VILLAGE will make available liquor licenses for the following uses in the Development: (i) Restaurants and related dining and eating establishments including dining in a hotel or theater: up to four (4) licenses in any of Classes E, F, G or H. Otherwise eligible licensees for each restaurant or other dining facility shall also be permitted to apply for outdoor dining area permits. (ii) Grocery store/supermarket: not less than one (1) Class B license, which shall permit on-site sampling in accordance with the terms of the Class B license. Notwithstanding the Class B license regulations, sales from any gas station, fueling center, or associated convenience store shall be prohibited. (iii) Hotel: up to one (1) Class A(1) license, in addition to any license obtained pursuant to (i) above. Eligibility to obtain and retain such a Class A(1) license shall be conditioned upon the underlying licensee’s continuing operation of the associated hotel business. Additional licenses may be issued to applicants within the Development upon the applicant’s compliance with the VILLAGE’S Alcoholic Liquor Ordinance. 18. ECONOMIC INCENTIVE AGREEMENT. By its approval of this Annexation Agreement, the VILLAGE also hereby approves the Economic Incentive Agreement attached to the Annexation Agreement as Exhibit E. 19. AMENDMENTS (SECTION 19 OF THE ANNEXATION AGREEMENT. This Agreement and the other Approved Documents, including the attached exhibits, may be amended by a duly executed written instrument, only with the mutual consent of VILLAGE and the owner(s) of the SUBJECT PROPERTY, or, in the case of an amendment affecting only a portion of the SUBJECT PROPERTY, the owner(s) of the relevant portion of the SUBJECT PROPERTY at issue. Amendments to the Annexation Agreement subsequent to the Annexation Agreement’s adoption shall require a public hearing and procedures in accordance with applicable law. Any future amendment to an Approved Document shall not constitute an amendment to the Annexation Agreement. Major or Minor Changes to the Preliminary Development Plan or Final Development Plan, as provided in Section 12 of Exhibit C, shall not be deemed amendments to the Annexation Agreement or any other Approved Documents. 20. ENFORCEMENT (SECTION 22 OF THE ANNEXATION AGREEMENT). The VILLAGE acknowledges that its obligation to adopt the Annexation Ordinance upon receipt of the Annexation Petition, pursuant to Section 1.2 of this Exhibit C, is a ministerial act and that if it fails to do so, DEVELOPER, in addition to all of its other remedies, may compel such performance pursuant to a writ of mandamus. If a Party to the Annexation Agreement prevails in any lawsuit against another Party to the Annexation Agreement, then the other party shall 313 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 15 of 32 reimburse the prevailing party for all of the fees, costs, and other expenses incurred by the prevailing party related to such lawsuit. 21. RIGHTS AND OBLIGATIONS OF OWNER (SECTION 23 OF THE ANNEXATION AGREEMENT). Any obligations of OWNER pursuant to the Annexation Agreement shall be performed by DEVELOPER, except that OWNER shall cooperate in or execute such further agreements or documents as are necessary to effectuate the purposes of the Annexation Agreement. The OWNER is executing this Annexation Agreement solely because the law may require it, but the OWNER shall have no liability for the performance of any of DEVELOPER’s obligations under this Annexation Agreement. In addition, the Parties hereby waive as to the OWNER and release the OWNER from all claims and rights of recovery for losses, liabilities, costs, and expenses (including attorneys’ fees) that the OWNER may suffer, sustain, or incur as a result of the execution of this Annexation Agreement or a Party’s failure to perform its obligations under this Annexation Agreement. 22. SUCCESSORS IN INTEREST (SECTION 23 OF THE ANNEXATION AGREEMENT). 22.1 BINDING EFFECT OF AGREEMENT This Agreement shall run with the land and shall bind and benefit (i) OWNER and any subsequent owner of record of the SUBJECT PROPERTY or any portion thereof; and (ii) DEVELOPER, immediately upon the Effective Date and until the Acquisition Date, at which time DEVELOPER shall be bound and benefited as an owner of record. Neither OWNER nor DEVELOPER shall be bound by the Annexation Agreement if the Annexation Petition is not filed within one (1) year after the Effective Date and the Annexation Agreement terminates, as provided in Section 1.1 of this Exhibit C. 22.2 RELEASE OF OBLIGATIONS THROUGH CONVEYANCE If an owner of record of the SUBJECT PROPERTY (a “First Owner”) conveys all or any portion of the SUBJECT PROPERTY to another (a “Second Owner”), the First Owner’s rights and obligations arising pursuant to the Annexation Agreement shall devolve upon and be assumed by the Second Owner, and the First Owner shall be released from all such obligations; provided, however, that (i) DEVELOPER shall be benefited by all rights under the Annexation Agreement from the Effective Date to the Acquisition Date and, thereafter, so long as DEVELOPER owns any portion of the SUBJECT PROPERTY; and (ii) no conveyance shall release a First Owner from its obligations under the Annexation Agreement until the Second Owner has posted good and sufficient surety, as determined by the VILLAGE in accordance with Chapter 7, Section 7-142 of the Village Ordinances, to replace any surety that has been posted, and that will be withdrawn, if such surety is required by Village Ordinances to secure the performance of any of the obligations contained in the Annexation Agreement. 23. OTHER DEVELOPMENT SPECIFICS 23.1 CONSTRUCTION OF PROJECT If DEVELOPER proceeds with the construction of the Project, it shall do so in accordance with the Final Development Plan and the provisions of this Annexation Agreement. 314 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 16 of 32 Construction of the remaining portions of the Development shall be undertaken in accordance with the provisions of this Annexation Agreement, including the Design Standards. The VILLAGE and DEVELOPER acknowledge that the Design Standards, in one or more respects, may contain development parameters that are more restrictive or limiting than applicable Village Ordinances and they agree that, in such cases, the Design Standards shall govern and control. The Village further agrees that the owners of the Outlots, and any and all lots created by the re-subdivision of said Lots, shall not have the right to apply for, and the VILLAGE shall not approve, exceptions or variations from the development parameters set forth in the Design Standards or from applicable Village Ordinances (including exceptions or variations from off-street parking requirements) without DEVELOPER prior written consent, which consent DEVELOPER may give or withhold in its sole and absolute discretion. 23.2 SCREENING The Village acknowledges that no board-on-board or other privacy fence or wall screening shall be required for loading docks and refuse areas located along the eastern building elevation of the Food Market provided the landscaping depicted on the Preliminary Landscape Plans is extended along the north property line of [Lot __] across the rear elevation of the Food Market. DEVELOPER agrees to screen its outdoor refuse area at the Gas/Lube Facility on [Lot __] with a fence in the matter depicted on the Preliminary Site Plan. All outdoor refuse areas on the Lots in the Development that are other than [Lot __] and [Lot __] (the Lots upon which the Project is to be constructed) shall be enclosed and all loading docks on such other Lots shall be screened in accordance with the Design Standards. 23.3 OPERATIONS The Village acknowledges and agrees that the Food Market, Gas/Lube Facility and Car Wash may be open for business 24 hours per day, seven days per week, and 365 days per year and that the fueling station at the Gas/Lube Facility, which will have 10 dispensers, will have attended fueling at times and unattended fueling at other times. 23.4 SITE LIGHTING REGULATIONS The Village agrees that if it elects, at any time after the Effective Date, to adopt any so- called “Dark Sky” Village Ordinances, or other ordinances, codes, policies, or regulations akin thereto, they shall not be applicable to the Project or the Development. 23.5 CONSTRUCTION VEHICLE ACCESS The Village acknowledges that DEVELOPER intends to utilize what are to be the easternmost full-access intersection to the Development on Illinois Route 59 and the southernmost access to the Development on 119th Street for construction vehicle access to the Development. The Village, at its cost, agrees to direct its consulting civil engineers to assist DEVELOPER in the procurement from IDOT of the access permits DEVELOPER will need to provide construction vehicle access to the Development at the aforesaid locations. The Village acknowledges that: (i) DEVELOPER may elect not to close on its acquisition of the SUBJECT PROPERTY unless and until it has obtained permits for 315 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT C—SPECIAL TERMS P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 17 of 32 construction access; and (ii) the conditions contained in such permits must be acceptable to DEVELOPER, in its sole discretion. 24. MISCELLANEOUS 24.1 DEFINITIONS The capitalized terms “Party” or “Parties” refer only to the VILLAGE or DEVELOPER or both, as the context reasonably requires—but not the OWNER. 24.2 PRIOR AGREEMENTS The Village represents and warrants that the agreements contained in the following documents that are recorded against title to the SUBJECT PROPERTY are terminated and of no further force or effect, and the Village will cooperate with Developer to have them released of record: (A) Terms, provisions and conditions contained in Annexation Agreement by and between the Village of Plainfield; and MB Financial Bank, N.A., as successor trustee to Bank of Elmhurst, under Trust Agreement 163-0587, dated May 11, 1987, Jeffrey J. Korhan and Leslie N. Korhan, and Chicago Title and Trust Company, as trustee under Trust Agreement 109-0871, dated November 1, 1987; and Poag & McEwen Lifestyle Centers - Plainfield, LLC, attached to Ordinance No. 2667 recorded February 6, 2008 as document R2008016236 and re-recorded June 11, 2008 as document R2008074049. (B) First Amendment to Annexation Agreement for the Shops at the Polo Club attached to Ordinance No. 2773 recorded November 10, 2008 as document R2008135825. 24.3 ESTOPPEL CERTIFICATES The Village, acknowledging that DEVELOPER intends to sell the Outlots for development to third parties, agrees to issue estoppel certificates to DEVELOPER and those parties, when requested to do so by DEVELOPER, which confirms among other things that this Annexation Agreement and the PUD Ordinance remain in full force and effect without any default thereunder. 24.4 RECORD TITLE At the expiration of the term of this Annexation Agreement, the VILLAGE agrees to cooperate with DEVELOPER in causing it to be released as an encumbrance upon record title to the SUBJECT PROPERTY. 316 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT D—FORM OF ORDINANCE P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 18 of 32 [FORTHCOMING] 317 ANNEXATION AGREEMENT—WOODMAN’S PLAINFIELD EXHIBIT E—ECONOMIC INCENTIVE AGREEMENT P:\Cases\2024\2041-010724.AA.REZ.SU.SPR.PP - Woodman's Food Market\Annexation Agreements & Ordinance\Draft Annexation and Redevelopment Agreement Woodman's Plainfield VoP revisions.docx Page 19 of 32 [FORTHCOMING] 318 319 320 HISTORIC URBANIZED CORE SURVEY Plainfield Historic Preservation Commission ADDRESS 14910 S. Bartlett Ave. at the dead-end of Amboy PIN/Property Index Number #06-03-10-307-028-0000 Historic Property Name(s) Common Name(s) Dick and Gwen Krahn House Architectural Style Italianate influence (side bay and entrance) Vernacular Building Type T Plan Construction Date c. 1875 Architect/Builder Historic Use(s) Single Family Residential Present Use(s) Single Family Residential History (associated events, people, dates) J.R. Ashley’s Subdivision. Appears on the 1931 Sanborn map, the first to show this block. Shown with front T-shape, 2/3 rear 1 story wing aligned at the north, and a 1 story porch off that wing to the south. A long rectangular 1 story outbuilding is also indicated to the rear of the house oriented north/south. The property appears the same on the 1944 map. Description Limestone foundation; clapboard walls (painted blue); asphalt shingle gable roof. Cornice and corner boards; no returns. Two stories, T-shape, 3 front/east bays, varied side piles. Left/south door faces front/east out of side gable. Shallow hip hood with large Italianate bracket of left side only. Historic wood screen door. Paired 1/1 double-hung sash in front gable with molded drip caps. Most windows with rare functional shutters. Blind south and north sides of front gable. North side gable with paired (1st story) and two (2nd story) 1/1 double-hung sash. 1 story rear gable wing full width, appears to have enclosed porch on south end with paired smaller 1/1 double-hung sash. South elevation with 1 story rectangular hip bay with Italianate brackets, paired 2/1 double-hung sash. Integrity/Major Physical changes from original construction Most windows; aluminum storm sash added. Rebuilt chimney left slope, front gable. Subsidiary Building(s)/Site Single width asphalt driveway south abuts adjacent driveway for a double width appearance. Modern two car wood sided garage with side storage; pedestrian door front/east. Modern double overhead door. Colonial Revival inspired vent. Front and rear lots with mature trees in a historic setting. Registration & Evaluation National Register of Historic Places: Currently Listed: ___yes X no If not currently listed, recommend: Individually ___yes X no; historic district X yes ___no Contributing X or non-contributing X (garage) Significance statement: An excellent example of the T-Plan vernacular house type which occurs rather oddly with some frequency on N. Bartlett and N. Center, as well as elsewhere in the Village. VP; EP; BA. Village of Plainfield designation: Currently Listed: ___yes X no If not currently listed, recommend: Historic Landmark X yes no; Historic District X yes ___no Contributing X or non-contributing X (garage) Form prepared by: ArchiSearch Historic Preservation Consultants (Alice Novak) Date of Field Survey: 9.12.05 - 104 800 N. Bartlett Ave. 321 HISTORIC URBANIZED CORE SURVEY Plainfield Historic Preservation Commission ADDRESS at the dead-end of Amboy PIN/Property Index Number #06-03-10-307-028-0000 800 N. Bartlett Ave. 14910 S. Bartlett Ave. 322 323 324 325 326 ILLINOIS ROUTE 126 1 234567 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 2425262728 29 30 31 32 33 3435363738 39 40 41 42 43 44 OUTLOT 1 OUTLOT 2 OUTLOT 6 OUTLOT 4OUTLOT 3OUTLOT 5 DRAUDEN ROADC W. YORKSHIRE CIRCLEL C W. YORKSHIRE CIRCLEL C W. YORKSHIRE CIRCLELCLS. HEPWORTHCOURTC W. YORKSHIRE CIRCLELCL W. WAKEFIELD DRIVE LINE LEGEND ABBREVIATIONS LEGEND PROJ. NO.:23.0176-02Final Plat Of Subdivision Of Autumn Glen CLIENT PLAINFIELD, IL. 1 OF 2PROJECT SCALE: 1" = 60'Cage Civil Engineering 2200 Cabot Drive, Suite 325 Lisle IL 60532 2631 GINGER WOODS PARKWAY, STE. 100 AURORA, IL 60502 PHONE: (630) 820-9100 FAX: (630) 820-7030 EMAIL: ADMIN@CLSURVEYING.COM ALTA SURVEYS l TOPOGRAPHY l CONSTRUCTION STAKING FINAL PLAT OF SUBDIVISION OF AUTUMN GLEN AREA SUMMARY 327 PROJ. NO.:CLIENT PLAINFIELD, IL. 2 OF 2PROJECT 2631 GINGER WOODS PARKWAY, STE. 100 AURORA, IL 60502 PHONE: (630) 820-9100 FAX: (630) 820-7030 EMAIL: ADMIN@CLSURVEYING.COM ALTA SURVEYS l TOPOGRAPHY l CONSTRUCTION STAKING SURVEYOR’S AUTHORIZATION TO RECORD SURVEYOR’S CERTIFICATION WILL COUNTY TAX MAPPING CERTIFICATE OWNER'S CERTIFICATE ’ PLAN COMMISSION SURFACE WATER STATEMENT CERTIFICATE WILL COUNTY REORDER'S CERTIFICATE ’ ’PROJ. NO.:23.0176-02Final Plat Of Subdivision Of Autumn Glen2 OF 22631 GINGER WOODS PARKWAY, STE. 100 AURORA, IL 60502 PHONE: (630) 820-9100 FAX: (630) 820-7030 EMAIL: ADMIN@CLSURVEYING.COM ALTA SURVEYS l TOPOGRAPHY l CONSTRUCTION STAKING WILL COUNTY CLERK'S CERTIFICATE BOARD OF TRUSTEES CERTIFICATE AS TO SPECIAL ASSESSMENT FINAL PLAT OF SUBDIVISION OF AUTUMN GLEN ILLINOIS STATE ROUTE 126 DEDICATION Cage Civil Engineering 2200 Cabot Drive, Suite 325 Lisle IL 60532 PUBLIC UTILITY EASEMENT PROVISIONS EASEMENT PROVISIONS NOTARY'S CERTIFICATE 328 DRAUDEN ROADGAS N WASH (IL. ROUTE 126) RENWICK ROADCOUNTY LINE ROADLOCKPORT STREET SUBJECT SITE FOX LANDSCAPE SUPPLY STEINER ROADCONSULTANTS: DESCRIPTION INDEX OF SHEETS SHEET NO. LOCATION MAP SCALE: 1"=600' LANDSCAPE ARCHITECT: GARY R. WEBER ASSOCIATES, INC 402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 CIVIL ENGINEER: CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 Final Landscape Plan AUTUMN GLEN Plainfield, Illinois December 12th, 2023 L1.0 L1.0 COVER SHEET L1.1 OVERALL LANDSCAPE PLAN L1.2 LANDSCAPE PLAN L1.3 LANDSCAPE PLAN L1.4 LANDSCAPE DETAILS L1.5 LANDSCAPE DETAILS L1.6 TYPICAL TOWNHOME FOUNDATIONS L1.7 TYPICAL TOWNHOME FOUNDATIONS L1.8 AMENITY DETAILS L1.9 MONUMENT DETAILS L1.10 TREE PRESERVATION PLAN L1.11 LANDSCAPE SPECIFICATIONS L1.12 LANDSCAPE SPECIFICATIONS 329 WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWOH OH OH OH OH OH OH OH OH OH OH OH OH ONLY ONLY D D D D D D D D D D D DDD D D D D DD D D D ONLY W W W W W W W W W W W W W W W W W W W W W W W W WWWWWWWWWWWWWWWWWWWWWW W WWWWWWWWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W WWWWWWWWW W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W WWWWWWWWWWWWWWWWWWWWW W W W W W W W WWWWW WWWWWWW W W W W W W W W W W W W WWWWWWWWWWW W W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W WWWWWWWWWWWWWWWWWWWWWW W W W W W W W WWWWWWWWW W W W W W W W W W W W W W W W WWWWWWWWWWWWWWWWWWWWWWW W W W W W W W WWWWWWWWWWWWWWWWWWWWWWW W W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE E E E E E E E EEEEEE E E E E E E E E E E E E E E E E E E E GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG G G G G G G G G G G G G G G G G G G GG GGGGGGG GGG G G G G G G G G G G G G G G G G G G G W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W W W W W W W W WW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWW WW WW WWW W WW W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W WWWWWWWWWWWWW W W W WWWWWWWW WW 1 234567 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 2527 2628 293133 32 30 34 35 36 38 3937 41 40 42 43 44 DRAUDEN ROAD(IL. ROUTE 126) LOCKPORT STREET SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE OVERALL LANDSCAPE PLANL1.1AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R 0 40'80'160'240' SCALE: 1"=80'NORTH GENERAL LANDSCAPE NOTES SHEET L1.2 PLANT LIST NATIVE LEGEND SHEET L1.3 PARKWAYS: ±6,250 L.F. 20' LANDSCAPE BUFFER YARDS: NORTH AND EAST PROPERTY LINES ±1,303 L.F; ± 26,060 S.F. (30 PLANT UNITS PER 1,000 S.F.) OPEN SPACES: ±106,340 S.F. (1 PLANT UNITS PER 750 S.F.) PLANT MATERIAL QUANTITIES 330 WWWWWWWWWWWWWWWWWWWWWWWD D D D D D D ONLYWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W WWWWWWWWWW W W W W W W W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W WW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGGGGGGGGGGGGGGGGGGG G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G GGG GGG G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G W W W W W W W W W W W W WW W W W W W W W W W W W WW W WW W W WW WWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W WWWWWWWW 1 234567 8 9 10 2628 32 30 34 35 36 38 3937 41 40 42 43 44 DRAUDEN ROADSHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE PLANL1.2AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R 0 25'50'100'150' SCALE: 1"=50'NORTH MATCHLINE - SEE SHEET L1.3 MATCHLINE - SEE SHEET L1.3 PARK - SEE SEPARATE PLAN SET ENTRANCE DETAIL SEE SHEET L1.4 CENTRAL FEATURE SEE DETAIL SHEET L1.4 PLANTING DETAILS PERENNIALS AND GROUNDCOVERS NOT TO SCALE NOT TO SCALE DECIDUOUS AND EVERGREEN SHRUBS DECIDUOUS TREES NOT TO SCALE EVERGREEN TREES NOT TO SCALE SEATING AREA #2 - SEE DETAIL SHEET L1.4 SEATING AREA #2 - SEE DETAIL SHEET L1.4 331 WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWOH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH OH ONLY D D D D D D D D D D D DD D D WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W W W W W W W W WWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W W W W W W W W W W W W WWWWWWWWWWWWW W W W W W W W W W W W W W W W W W W W W W W W W W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW EEEEEEEEEEEEEEEEEEEEEEEE E E E E E E E E E E E E E EEEEEEEEE E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E E GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW W WW WWWW W W W WW W W WW WWW W W W WW WWW W W W W W W W W WW W W W W W W W W W W W WWWWWWWWWWW W W W 11 12 13 14 15 16 17 18 19 20 21 22 23 24 2527 2628 293133 32 30 DRAUDEN ROAD(IL. ROUTE 126) LOCKPORT STREET SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE PLANL1.3AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R 0 25'50'100'150' SCALE: 1"=50'NORTH MATCHLINE - SEE SHEET L1.2 MATCHLINE - SEE SHEET L1.2 PARK DETAIL - SEE SHEET L1.4 332 WWWWWWWWWWWW W W WWW WWW W WWW WWW W WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWG G G G G G G G G G G G WWWWWWWWWWWWWWGGGGGGGGGGGGGGGGG G G G G G G G G G G G G G GGGGGGGGG GGGGGGGGG G G G G G G G G G G G G G G SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE DETAILSL1.4AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R 0 10'20'40'60' SCALE: 1"=20'NORTH PARK LANDSCAPE DETAIL 0 10'20'40'60' SCALE: 1"=20'NORTH ENTRANCE LANDSCAPE DETAIL 0 10'20'40'60' SCALE: 1"=20'NORTH CENTRAL LANDSCAPE DETAILSEATING AREA #1 LANDSCAPE DETAILSEATING AREA #2 LANDSCAPE DETAIL 0 5'10'20'30' SCALE: 1"=10'NORTH 0 5'10'20'30' SCALE: 1"=10'NORTH 333 WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWDDD D D D D ONLY W W W W W W W W W W W W W W WWWWWWWWWWWWWW W W W WWW WWW EEEE E E E GWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW W WW W W W W W W W W W W W W W W WW WWWW1 22 DRAUDEN ROADSHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE DETAILSL1.5AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call RNATURALIZED STORMWATER BASIN SECTION NOT TO SCALE NSMA SIGN DETAIL NOT TO SCALE 0 20'40'80'120' SCALE: 1"=40'NORTH NATIVE SEEDING NATIVE LEGEND AERATOR SCHEDULE NORTH POND (APPROVED EQUALS ALLOWED - SEND ALTERNATIVES TO LANDSCAPE ARCHITECT AND OWNER'S REPRESENTATIVE FOR APPROVAL) 334 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE TYPICAL FOUNDATION LANDSCAPE PLANSL1.6AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R 0'5'10'20'30' SCALE: 1"=10' TYPICAL FRONT-LOADED 4 UNIT TOWNHOME FOUNDATION PLAN 0'5'10'20'30' SCALE: 1"=10' ALTERNATE END FRONT-LOADED UNIT PLAN (BLDGS. 2, 3, 4, 5, 6, 9, 10, 11, 12, 13, 14, 15, 16 & 22) 4-UNIT TOWNHOME PLANT LIST - A (BLDGS. 1, 7, 8, 17, 18, 19, 20 & 21) 4-UNIT TOWNHOME PLANT LIST - B (BLDGS. 14, 15, 16 & 22) TOWNHOME PLANT LIST - A (BLDGS. 1, 7 & 8) TOWNHOME PLANT LIST - B ALTERNATE END UNIT ALTERNATE END UNIT 335 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE TYPICAL FOUNDATION LANDSCAPE PLANSL1.7AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R (BLDGS. 25, 27, 29, 31, 33, 34, 36, 38, 40 & 42) 4-UNIT TOWNHOME PLANT LIST - A (BLDGS. 23, 24, 26, 28, 30, 32, 35, 37, 39, 41, 43 & 44) 4-UNIT TOWNHOME PLANT LIST - B 0'5'10'20'30' SCALE: 1"=10' TYPICAL REAR-LOADED 4 UNIT TOWNHOME FOUNDATION PLAN 336 WWWWWWWWWWWWG G G G G G G G G G G G G G G SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE AMENITY DETAILSL1.8AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R CENTRAL FEATURE LANDSCAPE LAYOUT DETAIL PARK LANDSCAPE DETAIL NORTH 0'10'20'30' SCALE: 1"=10' SITE FURNISHING SCHEDULE DECORATIVE PAVERS DETAIL SCALE: N.T.S. BENCH DETAIL SCALE: N.T.S. 0'10'20'30' SCALE: 1"=10'NORTH FENCE DETAIL SCALE: N.T.S. 337 UTUMNA LENG WWWWWWWWWWWWWW W W W W W W W W W W W W W W A A' B B' C C' UTUMNA LENG SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE MONUMENT DETAILSL1.9AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R SCALE: 1/2" = 1'-0" MONUMENT ELEVATION SECTION A-A'SECTION B-B'SECTION C-C' SCALE: 1"=10' MONUMENT LAYOUT SIGN PANEL DETAILS SCALE: 1/2" = 1'-0" ´ ´ ´ ´ ENTRANCE MONUMENT SPECIFICATIONS SCALE: 1/2" = 1'-0"SCALE: 1/2" = 1'-0"SCALE: 1/2" = 1'-0" 338 (IL. ROUTE 126) LOCKPORT STREET OH OH OH OH OH OH OH OH OH OH OH OH OH OH D D D D D D D D D D 978 979 980 981 982983 977 976 975 974 973 972 971 970 969 968 967 965 964 966 963 962 961 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE TREE PRESERVATION PLANL1.10AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R TREE TO BE PRESERVED TREE TO BE REMOVED TREE PRESERVATION NOTES TREE PRESERVATION DETAIL (NOT TO SCALE) SEE NOTES TREE INVENTORY 339 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE SPECIFICATIONSL1.11AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R I. GENERAL SPECIFICATIONS A.Scope of Work 1.This work shall consist of preparing the planting beds, seedbed or ground surface, and furnishing, transporting and placing plants, mulch, seed, sod, fertilizer and other materials required in the specified operations. 2. Planting required for this work is indicated on the Landscape Plans and, in general consists of the following: a.The establishment of trees, shrubs, perennials, annuals, lawn and natural areas as shown on the Landscape Plans; b. The provision of post-planting management as specified herein; c.Any remedial operations necessary for conformance with The Landscape Plans as specified in this document; d.The design, furnishing and installation of a complete underground sprinkler system at locations noted on plan. B.General 1.Permits The Landscape Contractor shall be responsible for obtaining any permits required for the completion of the work and shall be responsible for the cost of the same. 2.Field Verification Upon notice to begin work the Landscape Contractor shall verify all existing conditions of the site and shall report any conditions that will impede the beginning of work to the Landscape Architect in writing. The Landscape Contractor shall examine areas, conditions, grades, soils and water levels under which work is to be performed and notify the Landscape Architect of conditions detrimental to the proper and timely completion of the work. 3.Existing Utilities The Landscape Contractor shall verify location of all underground utilities before construction. Contact J.U.L.I.E at 1.800.892.0123; 48 hours prior to digging. Notification of any disturbance of existing utilities shall be given to the Landscape Architect immediately. Should uncharted or incorrect utilities be encountered, notify the Landscape Architect immediately. 4.Inspections of Project During the construction period, all phases of work shall be available for inspections by the Landscape Architect. All plant material shall be subject to inspection and approval, and the Landscape Architect reserves the right to reject any plants which fail to meet the standards of this inspection. The Landscape Architect reserves the right to inspect nursery stock either at place of growth or at site for compliance with requirements of variety, size and quality. C.Quality Assurance 1.The Landscape Contractor shall provide at least one person who shall be present at all times during execution of this portion of the work and who shall be thoroughly familiar with the type of materials being installed and the best methods for their installation and who shall direct all work performed under this Section and shall comply with work site requirements. 2.The Landscape Contractor must verify with the Landscape Architect at the commencement of work that he has the most current set of plans for the project and that one set of the current plans, clearly marked “Field Set”, must be on the jobsite at all times. 3.The Landscape Contractor shall provide protection for structures, utilities, roads, trees and vegetation from damages caused by settlement, undermining, washout and other hazards created by landscape operations. 4.The Landscape Contractor shall provide and maintain fences, planking, guard lights, barricades, warning signs and guards as necessary for protection of material storage, curbs, sidewalks, streets, drives and adjoining property. 5.Any damage to utilities, structures, plantings, or lawns which result from the Landscape Contractor's course of work will be repaired at the Landscape Contractor's expense, to the satisfaction of the Landscape Architect, in a reasonably timely manner with as little inconvenience to the Owner as possible. 6.Existing trees, shrubs and plant material to remain shall be protected. Damage to existing plants which result from the Landscape Contractor's course of work shall be repaired by a qualified nurseryman or replaced with approved material per village ordinance at the expense of the Landscape Contractor. 7.All planting techniques and methods shall be consistent with the latest edition of “Horticulture Standards of Nurseryman” and as detailed on the drawings. 8.Landscape Contractor shall maintain all relevant erosion control devises destroyed or disrupted during landscape installation. Erosion control devises include measures shown on the approved erosion control plans, plus any additional measures deemed necessary by the Owner or public agency having jurisdiction over erosion control. Erosion control devices include, but are not limited to, silt fence, straw bales, erosion control logs, filter fabric in storm structures, filter baskets ditch checks and siltation basins. D.Substitutions 1.Substitution from the approved plans will be accepted only when satisfactory evidence in writing is submitted to the Landscape Architect,showing that the plant specified is not available. 2.Landscape Contractor shall submit request for approval to substitute plant material available and shall include Common and Botanical names and size of substitute material. 3.Only those substitutions of equivalent size and having essential characteristics similar to the originally specified material will be approved. 4.Acceptance or rejection of substitute plant materials will be issued in writing by the Landscape Architect, following approval by Lennar and the governing Municipality or Regulatory Agency. 5.Any unauthorized substitutions will be removed and replaced by the Landscape Contractor at the expense of the Landscape Contractor. E.Submittals 1.Nursery List: In Bid Proposal Form Landscape Contractor shall identify a list of area nurseries from where nursery stock for the job will be obtained. 2.Materials List: Before any plant materials are delivered to the job site, submit to the Landscape Architect a complete list of all plants and other items to be installed and the nursery sources. 3.Certification of Inspection: Shall accompany each shipment of plants as may be required by law for transportation. File certificates with the Landscape Architect prior to acceptance of the material. Inspection by Federal or State authorities at place of growth does not preclude rejection of the plants at the site. 4.Planting Schedule: Submit proposed planting schedule with dates for review and inspection of plants by the Landscape Architect prior to planting. 5.Soil Tests: Submit two (2) copies of soils test of existing topsoil with recommendations for soil amendments for Landscape Architect's review. 6.Seed: Submit seed vendor's certification for required grass seed mixture, indicating percentage by weight, and percentage of purity, germination, and weed seed for each grass species and date tested. 7.Sod: Submit sod grower's certification of grass species. Identify source location in Bid Proposal Form. 8.Mulch and Erosion Control Blankets: Submit two (2) samples of shredded hardwood bark mulch, erosion control blankets, and all other products and materials as specified on plans to Landscape Architect for review and written approval. 9.Maintenance Instructions: Submit to the Landscape Architect typewritten instructions recommending procedures to be established by the Owner for the maintenance of landscape work after preliminary acceptance of plantings and turf areas. Submit prior to beginning of warranty period. Instructions shall include: watering, fertilizing, spraying, mulching and pruning for plant material and trimming groundcover. Instructions for watering, fertilizing and mowing grass areas shall be submitted prior to request for preliminary inspection for acceptance. F.Product Handling 1.Delivery and Storage a.Deliver all items to the site in their original containers with all labels intact and legible at the time of inspection. b.Immediately remove from the site all plants which are not true to name and all materials which do not comply with the provisions of these Specifications. c.Use all means necessary to protect plant materials before, during, and after installation and to protect the installed work and materials of all other trades. d.Cover all plant material transported in open vehicles with a protective covering to prevent windburn. 2.Time of Planting a.All planting shall be performed during favorable weather conditions and only during normal and accepted planting seasons when satisfactory growing conditions exist. b.The planting operations shall not be performed during times of extreme drought, when ground is frozen or during times of other unfavorable climatic conditions unless otherwise approved by the Landscape Architect. The Landscape Contractor assumes full and complete responsibility for such plantings and operations. G.Materials 1.Plant Material Provide plants typical of their species or variety with normal, densely developed branches and vigorous, fibrous root systems. Provide only sound, healthy, vigorous plants free from defects, disfiguring knots, sunscald injuries, frost cracks, abrasions of the bark, plant diseases, insect eggs, borers, and all forms of infestation. All plants shall have a fully developed form without voids and open spaces. a.Balled and burlapped plants shall have a firm natural ball of earth of sufficient diameter and depth to encompass the fibrous and feeding root system necessary for full recovery of the plant. Provide ball sizes complying with the latest edition of the “American Standard for Nursery Stock”. Cracked or mushroomed balls are not acceptable b.Tree spade transplanting is acceptable for plants 6” caliper and larger after acceptance of plant by the Landscape Architect. Tree spade must be of a size generally accepted in the trade to safely move the tree size. c.Container grown stock shall be grown in a container for a sufficient length of time for the root system to have developed to hold its soil together, firm and whole. (i)No plants shall be loose in the container. (ii) Container stock shall not be pot bound. (iii) All container plants used on the project shall conform to the sizes indicated on the plant list and on the drawings. d.No evidence of wounds and/or pruning cuts shall be permitted unless approved by the Landscape Architect. e.When specified by caliper, provide shade and ornamental trees with a single main trunk. When specified by height, provide shade and ornamental trees as multi-stemmed plants with not less than three main trunks and side branches that are generous and well twigged. f.Evergreen trees shall be branched to the ground unless otherwise specified and accepted. g.Provide plants matched in form when arranged in groups. h.All plants shall be nursery grown under climatic conditions similar to those in the locality of the project for a minimum of two years. Comply with sizing and grading standards of the latest edition of “American Standards of Nursery Stock” A plant shall be dimensioned as it stands in its natural position. No plants shall be loose in the container. (i)Shade Tree and Ornamental Tree caliper shall be measured at a point on the trunk six (6) inches above natural ground line for trees up to and including four (4) inches in diameter, and at a point twelve (12) inches above the natural ground line for trees over four (4) inches in diameter. (ii) Height of Evergreen Trees is measured from the natural ground line to the first lateral branch closest to the top. (iii) Height of Clump Ornamental Trees is measured from the natural ground line to the beginning last year's growth. (iv) Shrub and small plants shall meet the requirements for spread and/or height indicated on the plant list and with not less than the minimum number of canes required by ANSI Z60.1 for the type and height of shrub required. 2.Sub-drainage Systems a.Provide piping types and sizes indicated. Provide matching reducers, adapters, couplings, fittings and accessory components to ensure continuity of the sub-drainage system. i)Plastic tubing shall be ASTM F405, corrugated Polyethylene drainage tubing, perforated or solid as required. ii) Sub-drainage fill shall be AASHTO M43 (3/8” to 3/4”) clean uniformly graded stone or gravel. iii) Sub-drainage filter fabric shall be DuPont “Typar” or other non-woven porous polypropylene fabric approved by the Landscape Architect. 3.Grass Seed a.All seeds shall be guaranteed by the vendor to be true to name and variety. b.Seed mixtures shall be fresh, clean new crop with a tolerance for purity and germination established by the Official Seed Analysts of North America. Seed will not contain any noxious weed seeds. c.Seed mixtures shall be proportioned by weight and shall be as specified on the drawings. If no seed mix is specified, the following general turf seed mix shall be used: 65% Improved Kentucky Bluegrass (minimum three (3) varieties) 25% Improved Perennial Ryegrass (minimum two (2) varieties with endophytes) 10% Creeping Red Fescue If this general turf seed mix is used, the Landscape Contractor must submit the vendor's seed varieties, composition and application rate to the Landscape Architect for approval prior to ordering. 4.Erosion Control Blanket a.North American Green seed blanket matting shall be used. Secure with 4” biostakes. 5.Sod Sod used shall be an approved blend of improved Kentucky Bluegrass (such as: Midnight, Allure, Viva, Washington and Liberty) with a mineral back that is adapted to the locality of work. It shall be either nursery grown or field grown and be well rooted. The consistency of adherent soil shall be such that it will not break, crumble, or tear during handling and placing of the sod. Landscape Architect reserves the right to reject unacceptable sod. a.Each piece of sod shall be well covered with turf grass, shall not be less than two (2) years old, shall be free from noxious weeds and other objectionable plants, and shall not contain substances injurious to growth. b.All sod used shall comply with state and federal laws with respect to inspection for plant diseases and insect infestation. c.Each sod shipment shall be accompanied by an invoice from the vendor giving quantity and certifying that the sod received meets all requirements contained in these specifications. 6.Seed Fertilizer a.Fertilizer for seeded areas shall be a granular non-burning product from a commercial source composed of not less than 50% organic slow acting, guaranteed analysis professional fertilizer, uniform in composition, free flowing and suitable for application with approved equipment. Fertilizer types and ratios shall be as follows: i)Starter fertilizer with an approximate analysis of 13-25-12 at the rate of 4 lbs. per 1,000 S.F. or similar composition approved by the Landscape Architect. ii)Post emergent fertilizer with an approximate analysis of 25-0-5 at a rate of 4 lbs. per 1,000 S.F. or similar composition approved by the Landscape Architect. 7.Sod Fertilizer a.Fertilizer for sod areas shall be a granular non-burning professional product from a commercial source, uniform in composition, free flowing and suitable for application with approved equipment. Fertilizer ratio shall be a ratio of 13-25-12 at the rate of 4 lbs. per 1,000 S.F. 8.Plant Fertilizer a.Fertilizer for plants shall be a granular non-burning standard commercial grade product, uniform in composition, free flowing and suitable for application with approved equipment and an analysis of 14-14-14 at the rate of 6 lbs. per 1,000 S.F. 9.Native Planting Mixtures Provide fresh, clean, new crop of the species and proportions as specified. Native seed and live plant material shall be obtained from a reputable supplier (approved by Landscape Architect) that has collected from sources west of the Mississippi River within the same EPA Level III Ecoreqion as the project site (Central Corn Belt Plains). Any material sourced from outside this ecoregion must be approved by the Landscape Architect prior to installation. For each species, the amount of seed indicated on the specifications shall mean the total amount of pure live seed (PLS) per acre. Seed tags and PLS testing information shall be provided to the Landscape Architect prior to seeding. It is the sole responsibility of the Native Landscape Contractor to provide approved seed that meets industry-standard PLS requirements. 10. Mulch a.Mulch for tree and shrub planting beds shall be dark shredded hardwood bark mulch, six month old, not larger than 4” in length and 1/2” in width, free of woodchips and sawdust. Submit sample to Landscape Architect for approval. b.Mulch for perennial flower, annual flower and groundcover planting beds shall be pinebark fines. Submit sample to Landscape Architect for approval. 11. Topsoil a.Topsoil shall be available adjacent to the community site for use on project or in backfill mixes as specified. Initial fine grading to be done by Excavation Contractor. b.Touch up movement and placement of this topsoil shall be at the sole expense of the Landscape Contractor. c.Topsoil stockpile placement will be coordinated with Excavator to ensure easy access to Contractor. 12. Planting Bed Soil Mixture (Perennial, Annual and Groundcover Beds) a.Provide planting soil mixture consisting of equal parts cooled mushroom compost and pinebark fines (Same as Midwest Trading CM30 mix) at 1 C.Y. per 100 S.F. incorporated into all perennial, annual and groundcover areas. Planting pits shall be excavated and filled with friable topsoil (stockpiled at site) to a depth of 8” prior to adding and incorporating planting bed soil mixture. 13. Accessories a.Water: Water provided by the Landscape Contractor shall be free of substances harmful to plant growth. All necessary hose piping, tank truck and other methods of transportation shall be supplied by the Landscape Contractor. b.Downspout Splash Areas: i)Downspout splash areas in lawns shall be 24” concrete splash blocks. ii)Downspout splash areas in mulch shall be washed gravel sub-base 0.5-0.75” diameter and 3-4” diameter granite cobblestone surface with geotextile filter fabric lining sides and bottom of trench. c.Sand: Sand shall be coarse “torpedo” sand. d.Pea gravel: Pea gravel shall be 1/8” to 1/4” washed gravel. e.Retaining Walls: Retaining walls must always be installed in strict compliance with manufacture's recommendations for sizing and reinforcement i)Retaining wall material shall be as specified on the drawings or as approved by the Landscape Architect f.Anti-Desiccant: Anti-Desiccant shall be an applicable emulsion which forms a transparent protective film over plant surface, permeable enough to permit transpiration. (Wilt-Pruf, manufactured by Nursery Specialty Products, Inc. or approved equal). g.Herbicide: Herbicide shall be a granular form of herbicide applied in shrub and ground cover beds in strict accordance with the manufacturer's directions and recommendations. Acceptable products are “Treflan”, “Ronstar” or approved equal. H.Installation and Execution 1.Inspection a.Prior to all work of this Section, carefully inspect the installed work of all other trades and verify that such work is complete to the point where this installation may properly commence. Verify that planting may be completed in accordance with the original design and the referenced standards. Work will commence only when satisfactory conditions exist. b.Check that grading, including spreading of topsoil and all other sub-surface work in lawn areas have been completed and accepted by Lennar. Start of work in this section shall constitute acceptance of grade. Lawn irrigation system must be completed and in operation before seeding and sodding begins. c.Saturate and fill tree and shrub pits with water to test drainage before planting. Provide gravel drains and venting tubes at pits, which are more than half full of water after 24 hours. d.Landscape Contractor shall notify the Landscape Architect prior to plant installation. The Landscape Architect, at his discretion, may inspect all plant material and layout prior to planting. 2.Preparation Trees, Shrubs, Perennials, Annuals and Groundcovers a.Planting shall be performed only by experienced workmen familiar with planting procedures under the supervision of a qualified supervisor. b.Locate plants as indicated or as approved in the field by the Landscape Architect after staking by the Landscape Contractor. If obstructions are encountered that are not shown on the drawings, do not proceed with planting operations until alternate locations have been selected by the Landscape Architect. c.Excavate circular plant pits with tapered sides as shown on the drawing details. In general, all plant pits shall have a rounded bottom with the depth of the pit equal to the depth of the ball to be planted. The diameter of the pit shall be a minimum of two (2) times the width of the ball. d.Excavate all clay and debris to 8” depth beneath all perennial, ornamental grass, annual flower, and groundcover beds. Backfill with 12” amended topsoil, thus resulting in all these areas being elevated or crowned by 4” wherever site drainage allows. Seeding and Sodding a.Seed and sod bed preparation shall not be started until all stones, boulders, debris, and similar material larger than 1 inch in diameter have been removed. The area to be seeded shall be worked to a minimum depth of 6 inches with a disk or other equipment, reducing all soil particles to a size not larger than 1 inch in the largest dimension. Bed prep shall occur on the contour, where possible. The prepared surface shall be relatively free from all weeds, stones, roots, sticks, rivulets, gullies, crusting and caking. Do not overwork or powder final seedbed. b.Upon completion of the above, any rocks or stones larger than one (1) inch in diameter shall be removed from the surface prior to seeding. If excessive amount of rocks are present in native soil Contractor should contact the Landscape Architect immediately. c.Landscape Contractor shall remove all debris and dispose of such material legally off-site. d.The areas to be seeded shall be assumed to be at final grades established by Excavator. The Landscape Contractor, however, shall be responsible for the proper drainage of the entire area. The Landscape Contractor shall fine grade all turf areas including any grading necessary to eliminate ponding of water, ruts or ridges. Limit preparation to areas which will be grassing within 48 hours. e.Immediately prior to the seed and sod bed preparation, specified fertilizer nutrients shall be uniformly spread at the following rate: i)5 lbs. per 1000 S.F. f.Final surface of topsoil immediately before seeding shall be within plus or minus 1/2” of required elevation, with no pockets or low spots in which water can collect. Restore prepared areas to specific condition if eroded, settled, or otherwise disturbed after fine grading and prior to seeding or sodding. Finish grade surface with a drag or rake, Round out all breaks in grade, smooth down all lumps and ridges, fill in all holes and crevices. g.In the event of settlement, re-adjust the work to required finish grade. 3.Planting Plant nursery stock immediately upon delivery to the site and approval by the Landscape Architect. If immediate planting is not possible a holding area on-site must be established in a location approved by Lennar. All plant material in the holding area must have the rootball heeled in damp mulch and be protected from excessive sun and wind. The Landscape Contractor must operate and maintain the holding area in a neat and orderly appearance. All planting shall be performed during favorable weather conditions and only during normal and accepted planting seasons when satisfactory growing conditions exist. The planting operations shall not be performed during times of extreme drought, when ground is frozen or during times of other unfavorable climatic conditions unless otherwise approved by the Landscape Architect. The Contractor assumes full and complete responsibility for such plantings and operations. Trees and Shrubs a.Set plant material in the planting pit to proper grade and alignment. Set plants upright, plumb and faced to give best appearance or relationship to each other or adjacent structure. Set plant material 2” above the adjacent grade. The Contractor is responsible for planting to correct grades and alignment and all plants shall be set so that when settled will bear the same relationship to finished grade as they did before being transported. b.Remove all non-biodegradable strings and twine from top of ball. Remove non-biodegradable burlap from to 1/3 of ball after the tree is set in the planting hole. The wire basket should remain. Fold the top portion of the wire basket into the hole. c.Any topsoil excavated from plant pits shall be used in the backfill soil mixture. No filling will be permitted around trunks or stems. Backfill the pit with topsoil. Do not use frozen or muddy mixture for backfilling. Form a ring of soil around the edge of each planting pit to retain water. d.After setting plants in pit to proper grade compact 6” of soil around base of ball. Fill the entire planting hole with water and allow to soak in. Gradually backfill remaining space around the ball or roots and compact the soil thoroughly using water to eliminate all voids and thoroughly soak the plant root ball. e.Within 24 hours of planting slowly re-water the plant thoroughly soaking the root ball again. f.Install enough topsoil to insure finished grades are met after settling. g.All excess soil, other than topsoil, excavated from pits, shall be removed from the holes and left on site in locations designated by Lennar. h.After planting apply specified commercial pre-emergent herbicide per manufacturer's directions to all shrub beds. Perennials, Ornamental Grasses, Annual Flowers and Groundcovers a.Where perennials, ornamental grasses, annual flowers and groundcovers are specified on the plans, prepare entire plant bed incorporating a 1 C.Y. layer of planting soil mixture per 100 S.F. Incorporate commercial 14-14-14 fertilizer into prepared soil mixture at a approximate rate of 6 lbs. per 1000 S. F. b.Space plants in accordance with dimensions indicated on the plans. Adjust spacing as necessary to evenly fill planting bed with indicated quantity of plants. Plant to within 18” of the trunks of trees and shrubs or at edge of plant ball whichever is closest. Plant to within 12” of edge of bed. c.After planting apply specified commercial pre-emergent herbicide per manufacturer's directions to all planting beds. Confirm herbicide compatibility with all plant material in beds and notify the Landscape Architect immediately if a conflict exists. Seeding a.Install seed under favorable weather conditions unless approved by the Landscape Architect. The conditions of the guarantee apply regardless of the date of installation. The generally accepted times for seeding are: Spring - April 1st to June 15th Fall - September 15th to just before first frost b.Seed indicated areas within contract limits and areas adjoining contract limits disturbed as a result of construction operations. c.Seed with specified seed mix at rate specified on the drawings or at a rate of 5 lbs. per 1000 S.F. d.Broadcast Seeding: Using a broadcast seeder, sow seed evenly over entire area by sowing equal quantities in two directions at right angles to each other. Do not seed when wind speed exceeds five (5) miles per hour. Seeding by hand is not allowed. e.Following seeding the area shall be lightly raked to incorporate seed into top 1/8” to 1/4” of soil. Remove all stones and other debris greater than 1 inch in any dimension which are visible shall be removed and disposed of legally off-site. Areas shall then be smoothed by rolling with a hand roller. f.Mechanical Seeding: Using a “Brillion-type” seeder and cultipacker, sow seed evenly over entire area sowing equal quantities in two directions at right angles to each other. Using this method raking and rolling is not required. g.Following seeding, all seed areas will be covered with specified erosion control seed matting and stapled in place. h.Following seeding, raking and matting, the entire area shall be watered by use of lawn sprinklers or other means approved by the Landscape Architect. Landscape Contractor shall assure initial watering continues until the equivalent of two inches of water has been applied to entire seed surface, at a rate which will not dislodge the seed. i.Landscape Contractor shall assure watering is repeated thereafter as frequently as required to prevent drying of the surface and to ensure proper establishment. j.Landscape Contractor shall mow the lawn area as soon as top growth reaches a 3 inch height. Cut back to 2 inch height. Not more than 33% of grass leaf shall be removed at any single mowing. The contract shall include a minimum of 3 (three) mowings. Repeat mowing as required to maintain specific height until Landscape Architect issues preliminary acceptance of completed work. k.It shall be the Landscape Contractor's responsibility to determine and implement whatever procedures deemed necessary to establish the turf as part of the work. Reseed bare areas and provide erosion control as necessary until complete establishment achieved. l.Areas of seed installation will not be accepted unit it meets the growth coverage specifications detailed by Illinois Department of Transportation. Sodding a.Transport sod in either a closed van or in properly covered open trucks. b.Maintain sod in a moist condition from cutting until placement. Any sod that has dried out, or excessively heated will be rejected and shall be immediately removed and legally disposed of off-site by the Landscape Contractor. Replacement of rejected sod shall be at the expense of the Landscape Contractor. c.Sod shall be placed within 24 hours of cutting. Do not use sod cut for more than 24 hours without the approval of the Landscape Architect. d.Sod shall be placed when the ground is in a workable condition and temperatures are less than 90oF. Do not lay dormant sod or install sod on saturated or frozen soil or during an extended drought. e.The sod shall be placed on the prepared surface with the edges in close contact and alternate courses staggered. Lay sod to form a solid mass with tightly-fitted joints. Butt ends and sides of sod strips. Do not overlay edges. Stagger strips to offset joints in adjacent courses. Remove excess sod to avoid smothering of adjacent grass. Provide sod pad top flush with adjacent curbs, sidewalks, drains, and seeded areas. f.In ditches, the sod shall be placed with the longer dimension perpendicular to the flow of water in the ditch. On slopes, install preliminary row of sod in a straight line, starting at the bottom of the slope, the sod shall be placed with the longer dimension parallel to the contours of the ground. Place subsequent rows parallel to and lightly against previously installed row. The exposed edges of sod shall be buried flush with the adjacent soil. g.All sod shall be rolled with a light drum roller to ensure contact with sub-grade, uniformity and foster root knitting. h.The sod shall be staked on all slopes of 3:1 or steeper to prevent slippage. Sod shall be staked with ±2 stakes per square yard of sod as necessary to stabilize with at least one stake for each piece of sod. i.Sodded areas shall be watered to ensure proper establishment. Sod shall be watered thoroughly with fine spray immediately after laying and not be allowed to dry out. Any sod that has shrunk shall be replaced. Landscape Contractor shall assure initial watering continues until the equivalent of two inches of water has been applied to entire sod surface, at a rate which will not dislodge the sod. j.Landscape Contractor shall assure watering is repeated thereafter as frequently as required to prevent drying of the surface and watering shall continue through preliminary acceptance to ensure proper establishment. k.Landscape Contractor shall mow the lawn area as soon as top growth reaches a 3 inch height. Cut back to 2 inch height. Not more than 40% of grass leaf shall be removed at any single mowing. The contract shall include a minimum of 3 (three) mowings. Repeat mowing as required to maintain specific height until Landscape Architect issues preliminary acceptance of completed work. Native Seeding and Planting a.The period for planting prairie seed shall be between April 1st and June 15th, or as soon thereafter as the soil is free of frost and in workable condition, and from September 15 to freeze up. If these dates are adjusted, it shall be the responsibility of the Landscape Contractor to ensure establishment of the seed. b.Remove existing grass, vegetation and turf. Dispose of such material legally off-site. Do not turn over into soil being prepared for lawns. c.If present, compacted soils shall be disked or raked prior to seeding. Remedial measures for the access area may at the direction of the Wetland Consultant, involve ripping from 12-18 inches of the soil horizon prior to disking. d.Prior to seeding, planting areas shall have at least twelve inches of clean un-compacted topsoil. Clumps, clods, stones of 2” diameter, roots and other extraneous matter shall be removed and disposed of legally offsite. e.Granular mycorrhizal inoculants shall be installed with the seed mix at a rate of 40 lbs\acre. Inoculant can be banded under seed, worked into seed or added into spray tanks. NATIVE AREAS SHALL NOT RECEIVE FERTILIZER. f.Contractor shall be solely responsible for the proper handling and storage of the seed according to the best seed handling and storage practices, including fungicide treatments and stratification considerations. Owner shall make no compensation for damage to the seed because of improper storage, cleaning, threshing or screening operations. 340 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 PHONE: 630-668-7197 www.grwainc.com GARY R. WEBER ASSOCIATES, INC. LAND PLANNING ECOLOGICAL CONSULTING LANDSCAPE ARCHITECTURE LANDSCAPE SPECIFICATIONSL1.12AUTUMN GLENPLAINFIELD, ILLINOIS12.12.2023 LN23145 GEH NKF 1141 E. MAIN STREET SUITE 108 EAST DUNDEE, ILLINOIS 60118 CAGE CIVIL ENGINEERING 3110 WOODCREEK DRIVE DOWNERS GROVE, ILLINOIS 60515 CLIENT CIVIL ENGINEER Know what'sbelow. before you dig.Call R I. GENERAL SPECIFICATIONS CONTINUED g.Seeding operations, including installation of erosion control matting, must be accomplished within 24 hours of any area which is fine graded. Fine grade, plant and cover only areas small enough to be completed within the required time frame. h.Except where site conditions preclude their use, seeding shall be performed using a Truax drill, Truax Trillion seeder, or comparable equipment designed specifically for the installation of native seed. For areas where site conditions preclude the use of specialized equipment, seed may be installed through hand broadcasting and followed by light raking. Hand broadcast seed shall be spread at twice the specified rate. Other methods of seed installation may be used with prior approval from the Landscape Architect. i.Do not seed when wind velocity exceeds five (5) miles per hour. Equipment shall be operated in a manner to insure even distribution of seed and complete coverage of the entire area to be seeded. j.Prior to starting work, all seeding equipment shall be calibrated and adjusted to sow seeds at the proper seeding rate. In general, the optimum seeding depth is 0.25 inch below the soil surface. Areas where the seed has not been incorporated into the soil to the proper depths will not be accepted, and no compensation for materials or labor for the rejected work will be made by the owner. k.Seed mixture shall be as specified on the drawings or the specified Prairie planting mixture. Sow not less than specified rate. l.If a broadcast method of seeding is used, the following requirements shall be met. Within twelve hours, if conditions permit or as soon thereafter as is practical rake prairie seed lightly into top 1/4" of soil, roll at right angles to the run-off with an approved type roller to compact the seedbed and place the seed in contact with the soil. m. If a drill-seed method is used, rolling of the seedbed will not be required. n.After the seeding, raking and rolling operations are completed, water with a fine spray and install specified erosion control blanket per manufacturer's specifications over the entire prairie area. o.The Landscape Contractor shall monitor all seeded areas to insure at least one inch of water per week from a combination of watering and natural rainfall and shall mow plantings to a height of 6-10 inches for the enhancement of native species until preliminary acceptance by the Landscape Architect. p.It shall be the Landscape Contractor's responsibility to determine and implement whatever procedures deemed necessary to establish the turf as part of the work. q.Wet mesic and emergent areas shall be planted and seed allowed to germinate (if possible), prior to the flooding with significant amounts of water. Any areas of significant permanent water located within the planting area will receive live plugs in lieu of seed. r.After seeding operation is completed, install erosion control blanket per manufacturer's specifications. s.Emergent plugs, if used, shall be planted in natural groupings within designed areas containing saturated soils or inundation. Plants within groupings shall be planted at 2 foot centers. t.Emergent plugs shall not be planted less than the specified rate and shall be protected with goose enclosures surrounding all natural groupings of plugs. 4.Preparation of Reconditioned Naturalized Areas The Contractor chosen for the enhancement and maintenance of native areas must be experienced in the restoration, installation, and management of said areas. They must have a minimum of five years' experience in the field and shall be able to identify non-native and native plants by genus and species. It is imperative that a qualified Native Landscape Contractor perform the initial installation and maintenance. A basic work procedure is outlined below. The contractor is required to evaluate all existing conditions prior to bidding the work. Any proposed changes to the work plan shall be submitted to the Landscape Architect as required under Section 1.3 (A)(B) a.Woody Vegetation Removal i. All woody, non-planted species shall be removed from basin slopes and bottoms for existing ponds ii.Contractor will cut all woody species to be removed with hand tools including, but not, limited to gas powered chainsaws, gas powered clearing saws, bow saws, and loppers. iii.All stumps shall be cut flat with no sharp points and to within two inches of surrounding grade. Stumps shall be painted with Garlon 4, or equivalent, immediately after cutting. iv.A supply of chemical absorbent shall be kept on-site. Spills shall be properly cleaned up and reported immediately to the owner. v.The contractor shall maintain copies at the project site of all current pesticide applicator's licenses, herbicide labels, and MSDS's (Material Safety Data Sheets) for all chemicals utilized during completion of work. vi.Cut brush piles shall be disposed of off site legally. No cut brush shall be burned within city limits. vii.A prescribed burn can be conducted on existing basins as per the Maintenance Section 3.4. Following burn, over-seed lower slopes and bottoms of existing basins with Wet Meadow species as necessary (see section 2.4B) viii. Spot treat invasive and undesirable herbaceous species on existing basin slopes with glycophosphate to remove undesirable species in planted areas. Undesirable species are included, but not limited to, species list in 1.5C Guarantees. ix. Over-seed slopes of existing basins with low profile prairie grasses (see section 2.4C) as necessary. Seeding protocol should follow Section 3.2D 8-12 noted below. x. If adequate top soil is not present, top soil can be added to slopes with approval of Landscape Architect. Repair: Repair any damages caused by Contractor during completion of the work. Said damages may include but are not limited to tire ruts in the ground, damage to lawn areas, damage to trails, etc. In the event any vegetation to be preserved is damaged, notify the owner within 24 hours. The Contractor will be liable for remedying damages to plant materials to the satisfaction of the owner. 5.Reconditioning Existing Turf a.Recondition existing turf damaged by Contractor's operations, including storage of materials or equipment and movement of construction vehicles. b.Provide fertilizer, seed and soil amendments as specified for new lawns and as required to provide a satisfactory reconditioned lawn. Provide topsoil as required to fill low areas and meet new finished grades. c.Prior to over-seeding cultivate or rototill bare and compacted areas thoroughly to a depth of four (4) inches. Remove all rocks, stones, turf clumps and other debris larger than one (1) inch in diameter and rake smooth. d.Remove diseased or unsatisfactory lawn areas. Do not bury into soil. Remove topsoil containing foreign materials resulting from contractor's operations, including oil drippings, stone, gravel and other construction materials. e.Where substantial, but thin lawn remains, rake, aerate if compacted, and cultivate soil, fertilize and seed. f.Water newly seeded areas. Maintain adequate soil moisture as specified for new lawns, until new grass is established. 6.Mulching Trees and Shrubs a.Apply the specified mulch to a depth of two (2) inches, evenly spread over the entire area of each tree basin and shrub bed. Maintain exposed root flare at all times. Thoroughly water mulched bed areas. After watering, rake mulch to provide a uniform finished surface. Perennials, Ornamental Grasses, Annual Flowers and Groundcovers a.Apply the specified mulch to a depth of one (1) inch, evenly spread over the entire area of each planting bed using care to keep foliage exposed. Thoroughly water mulched bed areas. 7.Pruning a.Prune branches of deciduous stock, after planting, to preserve the natural character appropriate to the particular plant requirements. Remove or cut back dead and badly bruised branches, broken and tangled branches, damaged and unsymmetrical growth of the new wood, suckers, water sprout growth and unnatural growth habits. No plants will be sheared for any reason. b.Prune with clean, sharp tools. c.Prune trees and evergreens at the direction of the Landscape Architect and in accordance with standard horticulture practice to preserve the natural character of the plant. d.In general, tree pruning requires removing 1/4 to 1/3 of the leaf bearing buds. Prune multiple leader plants to preserve the leader which best promote the symmetry of the plant. Do not apply paint to pruning marks. 8.Care of Existing Trees a.Selectively prune existing trees in construction limits as required, at the direction of the Landscape Architect. Remove shoots, dead, rubbing and damaged branching. b.Clean up miscellaneous organic debris within construction limits and dispose of legally off-site. 9.Clean-up a.The Landscape Contractor shall store materials and equipment, during landscape work, where directed by the landscape architect. b.The Landscape Contractor shall thoroughly clean the project area daily during the progress of work and upon completion of the work. c.Landscape Contractor shall keep pavement clean and all work areas and adjoining areas in an orderly condition. The Landscape Contractor shall remove and clean any excess dirt or mud left on the streets adjacent to the site as a result of this work daily. The Landscape Contractor shall be liable for any future charges incurred to clean streets affected by his work. d.No storing of rubbish or debris will be allowed on the site. e.No debris shall be buried at the site. f.No landscaping debris is allowed on the site dumpsters. g.The Landscape Contractor shall protect the property of the owner and the work of other contractors. h.The Landscape Contractor shall be directly responsible for all damage caused by the Landscape Contractor's activities and shall remove and properly dispose of all resultant dirt, rubbish, debris and other waste materials resulting from the work daily. 10.Inspections In addition to normal progress inspections, the Landscape Contractor shall schedule and conduct the following inspections, giving the Landscape Architect at least 48 hours prior notice of readiness for inspection. a.Inspection of plants and containers prior to planting. b.Inspection of plant locations to verify compliance with the current revisions of the Landscape Plans and As-Built Drawings. c.Preliminary acceptance inspection after completion of planting. Schedule this inspection sufficiently in advance and in cooperation with the Landscape Architect so that the inspection may be conducted in a timely manner. d.Final acceptance inspection at the end of the maintenance period provided that all previous deficiencies have been corrected. e.All other inspections necessary for replacement warranty work and completion of the project. I.Maintenance and Monitoring 1.Traditional Landscaping: Landscape Contractor shall maintain all planting, starting with the planting operations and continuing until all planting for that portion of the project is complete and through preliminary acceptance in writing from the Landscape Architect. a.Maintenance of plants and planting beds shall include resetting plants to proper grades or upright position, restoring planting saucers, tightening and repair of guy wires and stakes, weeding, cultivating, pruning, application of appropriate insecticides and fungicides necessary to keep the plant materials in a healthy growing condition and to keep the planted areas neat and attractive. b.Maintenance of lawn areas shall be as specified, including spot weeding, mowing, application of weed and insect controls and reseeding necessary to promote proper establishment the lawn areas. c.Contractor shall water all sod and plantings for the first two weeks following installation. 2.Native Planting Areas: The Owner shall notify the City upon completion of plantings. The Owner's Environmental Specialist shall inspect the plantings and provide the City with a copy of the planting locations, species, and quantities for verification by applicable regulatory authority. a.Native planting areas shall be maintained as specified below, continue for the three full (3) years after preliminary installation acceptance, and meet annual establishment performance criteria: i.First Season - With the exception of the emergent area, native seeding areas should be mowed to a height of 6” to control annual nonnative and invasive species early in the growing season. Mowing, including weed whipping, should be conducted during prior to weed seed production. Mowing height and timing may need to be adjusted per target species. Small quantities of undesirable plant species, shall be controlled by hand pulling prior to the development and maturity of the plant. Hand removal shall include the removal of all above-ground and below-ground stems, roots and flower masses prior to development of seeds. Herbicide should be applied as necessary by a trained and licensed operator that is competent in the identification of native and nonnative herbaceous plants. Debris and litter shall be removed from the native areas and storm structures shall be inspected and maintained as necessary. ii. Second Season - Control of undesirable plant species during the second growing season shall consist primarily of precise herbicide application. Mowing and weed whipping shall be conducted as needed during the early growing season and as needed to a height of 6 to 8 inches to prevent annual weeds from producing seed. Debris and litter shall be removed from the native areas and storm structures shall be inspected and maintained as necessary. iii. Third Year - Seasonal mowing and herbicide will continue as above but should be reduced over time. Debris and litter shall be removed from the native areas and storm structures shall be inspected and maintained as necessary. At the completion of the third growing season (dependent on fuel availability; dominance of graminoid species; and favorable weather conditions), fire may be introduced to the planted areas as a management tool. b.General performance criteria is outlined below. Contractor is responsible to ensure native areas meet Federal, County and local requirements as necessary. i.1st Full Growing Season: 90% of cover crop shall be established. There shall be no bare areas greater than two (2) square feet in seeded areas. At least 25% of vegetation coverage shall be native, non-invasive species. At least 50% of the emergent species, if planted as plugs shall be alive and apparent. ii.2nd Full Growing Season: All areas with the exception of emergent zones shall exhibit full vegetative cover. At least 50% of the vegetation coverage shall be native, non-invasive species. iii. 3rd Full Growing Season: At least 75% of vegetation coverage shall be native, non-invasive species. Non-native species shall constitute no more than 25% relative aerial coverage of the planted area. Invasive species for this project shall include the following: Ambrosia artemisiifolia & trifida (Common & Giant Ragweed), Cirsium arvense (Canada Thistle), Dipsacus laciniatus (Cut-leaved Teasel), Dipsacus sylvestris (Common Teasel), Lythrum salicaria (Purple Loosestrife), Melilotus sp. (Sweet Clover), Phalaris arundinacea (Reed Canary Grass), Phragmites australis (Giant Reed), Fallopia japonica (Japanese Knotweed), Rhamnus cathartica & frangula (Common & Glossy Buckthorn), Typha sp. (Broadleaf, Narrowleaf, and Hybrid Cattail) Lonicera sp. (Honeysuckle). c.Long Term Wetland and Prairie Management/Maintenance A Long -Term Operation and Maintenance Plan is included in the Home Owner's Association covenants with guidelines and schedules for burning, mowing, application of herbicide, debris/litter removal and inspection schedule for storm structures and sediment removal. i. State and local permits shall be required prior to controlled burning. Burning shall be conducted by trained professionals experienced in managing smoke in urban environments. Prior to a controlled burn, surrounding property owners as well as local fire and police departments shall be notified. A burn plan detailing preferred wind direction and speed, location of fire breaks, and necessary personnel and equipment shall be prepared and utilized in planning and burn implementation. ii.The initial burn shall be dependent on fuel availability which is directly related to the quantity and quality of grasses contained within the plant matrix. Timing of the burn shall be determined based on results of the annual monitoring indicating species composition of the management area and other analysis of management goals. Generally, burns shall be scheduled from spring to fall on a rotational basis. Burn frequency shall also be dependent on the species composition within the management area. Generally, a new prairie restoration area shall be burned annually for two years after the second or third growing season after planting and then every 2-3 years thereafter, burning 50-75% of the area. iii.Owner to provide all supplemental watering and proper care and maintenance of all plant materials, seed and sod areas (except for native planting areas) after preliminary acceptance of the Landscape Contractor's work. J.Preliminary Acceptance 1.When the preliminary landscape work is completed, including maintenance, the Landscape Architect will, upon request, make a preliminary inspection of initial installation to determine acceptability. 2.The inspection for preliminary acceptance of the initial installation will be for general conformance to establishment of turf areas, specified size, character and quality of plant materials, workmanship and maintenance and shall not relieve the Landscape Contractor of responsibility for full conformance of the contract documents, including correct species. 3.It shall be the responsibility of the Landscape Contractor to verify all work is completed for the initial installation and maintained as per plan prior to notifying the Landscape Architect for preliminary inspection. 4.For preliminary acceptance of the initial installation all plant material shall be in a healthy growing condition. Any plants, lawn areas, workmanship, etc. not meeting the standards will be rejected and the Landscape Contractor will be instructed to make the necessary corrections immediately before preliminary acceptance of the initial installation will be granted. 5.Seeded areas will be inspected for acceptance after the first mowing by the Landscape Contractor and will be satisfactory provided requirements, including maintenance, have been complied with and a uniform healthy close stand of the specified grass is established, free of weeds, bare spots exceeding 5 by 5 inches, undesirable grass species, disease, insects and surface irregularities. 6.Sodded areas will be inspected for acceptance after the first mowing by the Landscape Contractor and will be satisfactory provided requirements, including maintenance, have been complied with and when all areas show a uniform stand of the specified grass in a healthy, well-rooted, even-colored, viable lawn condition, free of weeds, undesirable grass species, open joints, bare areas, disease, insects and irregular surfaces. 7.The Landscape Contractor shall assume liability for the correction of his work and liability for any other charges incurred due to the correction of his work. The cost of follow-up inspections of the initial installation required to receive acceptance will be charged to the Landscape Contractor. 8.Upon the receipt of written acceptance of the preliminary inspection of the initial installation the Owner will be responsible for maintenance. 9.The warranty period will begin upon receipt of written acceptance of the preliminary inspection for initial installation from the Landscape Architect. 10.After preliminary acceptance of the initial installation and receipt of notification in writing from the Landscape Architect, the Landscape Architect will recommend the release of payment, less retainers deemed necessary by the Owner, for the completed work. 11.The release of all fees will be at the discretion of Lennar upon receipt of written invoice from the Landscape Contractor. K.Warranty Agreement 1.The Landscape Contractor shall provide a replacement warranty for all plant material and shall guarantee all work free of any defect in quality or workmanship for a minimum period of one (1) year or until final inspection and written acceptance by the Landscape Architect. a.Warranties of native plantings are excluded from this section and shall conform to the specified establishment performance criteria. 2.The warranty period will be from the date of the Landscape Architect's written preliminary acceptance of the initial installation and will continue through the end of the following years growing season upon the final inspection and written acceptance of the work. 3.The warranty shall provide against defects including death, unsatisfactory growth, and provides the material to be in good, healthy and flourishing condition, except for defects resulting from neglect by the owner, abuse or damage by others or unusual phenomena or incidents which are beyond Landscape Contractor's control. For verification of such defects, neglect, abuse or damage by others the Landscape Contractor must notify the Landscape Architect in writing immediately upon identifying said occurrences. 4.Annual increases in the size of required replacements shall serve to maintain the continuity of the landscape design. At the time of the scheduled replacements, the required landscape replacement material shall be increased in size from the original plan to match the new growth size of the surrounding plants. 5.The Landscape Contractor shall make as many periodic inspections as necessary, at no extra cost to the Owner during the warranty period to determine what changes, if any, should be made to the Owner's maintenance program. The Landscape Contractor shall submit, in writing to the Landscape Architect, any recommended changes. 6.During the warranty period, should the appearance of any plant die, indicate weakness and/or probability of dying, the Landscape Contractor shall immediately begin replacement of said plants with new and healthy plants of the same type and size as soon as weather conditions permit and within a specified planting period after notification of such occurrences from the Landscape Architect without additional cost to the Owner. 7.The Landscape Contractor shall make all necessary repairs of damage due to plant replacements. Such repairs shall be done at no extra cost to the Owner. 8.Replacements shall be in accordance with and subject to all requirements of landscape installation, mulching, maintenance, warranty and acceptance procedures. 9.The Contractor is responsible for the watering and maintenance necessary to ensure establishment of the replacement plants until the Landscape Architect inspects the replacement plants and issues preliminary acceptance in writing. 10. The Landscape Contractor, prior to notifying Landscape Architect for preliminary acceptance, shall maintain the replacement plants for a period of 45 days at no additional cost to the owner. 11. The Landscape Contractor shall notify the Landscape Architect in writing, upon completion of replacements and extended maintenance period, for preliminary acceptance and written notification of new warranty period. 12. The Landscape Contractor, upon written preliminary acceptance of the replacements, shall warranty all replacements until the end of the following growing season and written final acceptance. The Landscape Contractor shall notify the Landscape Architect in writing at the end of the warranty period of replacement plants for final inspection and acceptance. 13. The Landscape Contractor shall remove tree wrapping, tree guy wires, stakes and tags from all established plants prior to contacting the Landscape Architect for final acceptance inspection. Tags, tree wrap, guy wires and stakes shall remain on all replacements until completion of additional warranty period. 14. All subsequent inspections required due to unacceptability of the replacements will be at the cost of the Contractor. L.Final Acceptance 1.Inspection of all work will be made by the Landscape Architect at the end of the warranty periods upon written request of the Landscape Contractor. 2.The Landscape Architect shall prepare and submit, to Lennar and the Landscape Contractor, a list of warranty replacement items to be completed before final acceptance shall be deemed to have occurred. The failure to include any items on such list does not alter the responsibility of the Landscape Contractor to complete all work in accordance with the contract. 3.The Landscape Contractor shall complete all warranty replacement work as deemed necessary by the Landscape Architect, shall verify completion of all work required to satisfy the contract and shall notify the Landscape Architect upon completion of all work for review and final acceptance. 4.The Landscape Architect will perform a final inspection of the completed work with the Landscape Contractor and a representative from Lennar. At that time if all work is satisfactory, a written statement will be issued by the Landscape Architect that will constitute final acceptance of completed work to date. 5.After the final inspection and acceptance of the work, the Landscape Architect will notify Lennar in writing and will recommend release of fees in retention for the completed work, except for retention fees deemed necessary by Lennar and the Landscape Architect for work still under additional warranty. 6.The Landscape Architect will make a follow-up inspection of all additional warranty replacements at the written request of the Landscape Contractor and issue a written report accepting satisfactory completion of the warranty obligations and request release of the remaining retention fees. 7.The release of all retention fees will be at the discretion of Lennar after receipt of written notification from the Landscape Architect and upon receipt of written invoice from the Landscape Contractor. 8.The written final acceptance of all work following any necessary replacements shall terminate the Landscape Contractor's plant warranty period. II. DAMAGES: STREET AND SITE 1.The Landscape Contractor shall be responsible for any damages to streets, curbs or site improvements as a result of his work or his employees. The Landscape Contractor shall be responsible for any future charges resulting from the repair/replacement of damage. 2.Curb damage will be billed to the contractor at fault at a rate of $25.00/lineal foot with a ten foot minimum 3.Subcontractor shall not park on any asphalt or concrete driveways at any time. Violators will be fined $500 per occurrence. IV.TRADITIONAL LANDSCAPE MAINTENANCE A.Turf Maintenance 1.Mowing a.All litter (i.e. paper, cans and bottles) will be removed from turf and plant bed areas prior to mowing. b.All lawn areas will be mowed weekly to a height of 3” from April through November, or as needed. No more than 1/3 of the grass blade is to be removed per cutting. Mowing height may be seasonally adjusted depending upon weather conditions in order to reduce stress and promote healthy turf. c.Mowing patterns shall be altered on a weekly basis wherever possible. Mowing patterns shall create straight lines for a more manicured appearance. d.Clippings shall be bagged and removed when clipping buildup is such that the excess clipping lay in an unsightly matted condition on the lawn. e.The turf shall be cut in such a manner as to avoid blowing clippings toward structures, patios, air conditioners, and planting beds. f.If the turf could potentially be damaged by equipment due to weather, mowing should not be performed. g.Turf bordering vertical surfaces such as foundations, fences, and utility boxes shall be trimmed to match the mowing height. h.Clippings shall be removed from all pavement areas. 2.Edging a.Turf areas adjacent to walks, driveways and curbing will be mechanically edged monthly in a uniform manner. b.Shrub beds and tree rings shall be neatly and uniformly edged twice per year; once during the spring cleanup, and again in August or September weather permitting. 3.Fertilizer & Weed Control a.Pesticides must be applied by a licensed individual. b.Notice shall be given to the homeowners association or owner's representative 1 week prior to any pesticide application. c.The lawn shall be fertilized three (3) times with a high quality granular or liquid formula. The applications should be made approximately in April, May and September. Timing, frequency and rate of application shall be adjusted to meet the development's current needs and conditions d.A pre-emergent weed control application for annual grass prevention shall be incorporated into the first turf fertilization in spring. e.The entire turf area will be treated one (1) time with a post emergent broad leaf weed control at the appropriate time of year. Spot treatment should be done as necessary. f.Flags shall be posted throughout the community following each fertilizer application. Remove flags once the application is dry or as directed by the product's label. B.Planting Bed Maintenance 1.Pruning a.Trees, shrubs and evergreens should be pruned, trimmed or sheared at the appropriate time for each species to maintain the plant's proper form. Methods and timing shall conform to standard horticultural practices. The initial spring pruning will include: 1.Removal of dead or injured limbs. 2.Removal of branches that are touching structures. 3.Shaping and internal thinning of the plant to allow for its natural form and habit. b.Shrubs will be pruned two (2) additional times at the appropriate time so as not to interfere with flowering. c.Trees over 6” in diameter will not be pruned other than removal of low branches hazardous to pedestrian traffic and sucker growth which may occur. d.Groundcovers should be pruned twice during the season to maintain a neat appearance. e.Ornamental grasses should be trimmed during the spring cleanup. f.All pruning debris shall be removed from the site by the contractor immediately after the work is complete. 2.Fertilizer & Weed Control a.Pesticides must be applied by a licensed individual. b.Notice shall be given to the homeowner's association 1 week prior to any pesticide application. c.Pre-emergent weed control shall be applied at the beginning of the growing season. d.Post emergent applications or hand pulling shall be used on any weeds that appear throughout the season. e.Trees, shrubs and groundcover shall be fertilized one (1) time during the season. The application rate will be determined by the specific needs of the plant material. C.Spring & Fall Cleanup 1.Spring Cleanup a.Lawn areas and planting beds will be raked as necessary to remove leaves, dead branches, litter and debris. b.All mulch beds shall be cultivated to break up any existing compaction in the mulch. c.Fresh mulch should be applied to any bare spots in the planting beds. d.Monitor plant health and notify homeowner's association or owner's representative of any dead plants. e.Debris generated during the cleanup shall be disposed of legally off site. 2.Fall Cleanup a.All lawn areas will have leaves removed either by raking or through the mowing process so as to prevent leaf buildup on the turf on a weekly basis. b.All planting beds will have leaves and debris removed at the end of the season. c.Perennials without winter interest shall be cut back. d.Monitor plant health and notify homeowner's association or owner's representative of any dead plants. e.Debris generated during the cleanup shall be disposed of legally off site. IV. PERSONAL CONDUCT / SAFETY 1.Consumption of alcoholic beverages or drugs on the job site is strictly prohibited. 2.Any offensive or obnoxious behavior (loud radio, profanity, etc.) is strictly prohibited. 3.Reckless operation of vehicles or equipment by Subcontractor's employees while in the subdivision will not be tolerated. 4.Hard hats to be worn by all employees at all times. 5.Failure to comply with Lennar's Safety Policy, OSHA or any other presiding safety institution could result in fines starting at $100.00 per occurrence. 6.Subcontractor to provide a competent person trained in OSHA requirements on site at all times. Landscape Contractor Name ___________________________________________________ Landscape Contractor Company________________________________________________ Landscape Contractor Signature______________________________ Date______________ 341 Page 1 of 12 PLANNED UNIT DEVELOPMENT RESIDENTIAL STATEMENT OF INTENT & AGREEMENT (Autumn Glen) This STATEMENT OF INTENT AND AGREEMENT is entered into this _______ day of ____________, 2024 (hereafter referred to as the “AGREEMENT”), by and between the VILLAGE OF PLAINFIELD, a municipal corporation, located in Will County, Illinois (hereafter referred to as “VILLAGE”), and CALATLANTIC GROUP, LLC, a Delaware limited liability company (hereafter referred to as “DEVELOPER”). WHEREAS, DEVELOPER is the contract purchaser of real estate described in Exhibit A and commonly referred to as the Onyx on Drauden Subdivision (hereafter referred to as “DEVELOPMENT”); and WHEREAS, the DEVELOPMENT is subject to a certain Annexation Agreement For Onxy on Drauden recorded in Will County as Document No. R2022061478 on August 12, 2022 (herein after referred to as “ANNEXATION AGREEMENT”), which approved the DEVELOPMENT of 176 residential townhomes; and WHEREAS, on August 1, 2022, the VILLAGE granted approval of a site plan, planned development, preliminary subdivision plat, preliminary engineering, preliminary landscape plan, and rezoning to R-3 Townhouse Residential District for the DEVELOPMENT as attached to the ANNEXATION AGREEMENT Group Exhibit D; and WHEREAS, this DEVELOPMENT is a Planned Development allowing for innovation, creativity, and design efforts; and WHEREAS, the VILLAGE Zoning Ordinance provides for Planned Developments that meet the following objectives: (1) To stimulate creative approaches to the residential, commercial and industrial development of land. (2) To provide more efficient use of land. (3) To preserve natural features and provide open space areas. WHEREAS, the ANNEXATION AGREEMENT permits assignment of said ANNEXATION AGREEMENT; and 342 Page 2 of 12 NOW, THEREFORE, in consideration of the mutual promises and agreements set forth herein, the parties hereto agree as follows: 1. INCORPORATION OF RECITALS AND EXHIBITS The foregoing recitals are hereby incorporated into the body of this AGREEMENT as if fully set forth and repeated herein. Any exhibit referred to in this AGREEMENT and attached hereto shall also be considered incorporated herein by express reference. The Village hereby confirms the DEVELOPMENT has been zoned R-3 Townhouse Residential District consistent with the terms of the ANNEXATION AGREEMENT. 2. ARCHITECTURAL DESIGN PROVISIONS The approved elevations that may be constructed in the DEVELOPMENT pursuant to Exhibit C, Paragraph 1 titled, “Land Use” of the ANNEXATION AGREEMENT are attached hereto as Exhibit B. Modification to the approved elevations attached hereto as Exhibit B may be proposed by DEVELOPER and shall be approved by staff with no requirement of plan commission or VILLAGE board review provided said additional elevations are consistent with the established character of the approved elevations attached hereto as Exhibit B. 3. EFFECT OF THIS AGREEMENT The parties acknowledge that, as of the date of approval of the AGREEMENT, DEVELOPER is the contract purchaser of the DEVELOPMENT. It is the intent of the parties that this AGREEMENT shall only become effective upon DEVELOPER or its assign acquiring title to the DEVELOPMENT. This AGREEMENT along with the final plat of subdivision approval ordinance shall not be recorded unless and until DEVELOPER or its assign acquires title to the DEVELOPMENT. If DEVELOPER or its assign fails to obtain title to the DEVELOPMENT within two hundred seventy (270) days of the date the VILLAGE approves this AGREEMENT, then this AGREEMENT shall be deemed null and void, having no further force or effect, and shall not thereafter be recorded. 4. EXCEPTIONS The exceptions to the strict adherence of the Subdivision Control Regulations and the Zoning Ordinance are permitted as identified on the attached Exhibit C. Any deviations from the Zoning Ordinance or VILLAGE Code not identified in Exhibit C, but shown or depicted on the Final Plans is also hereby granted. 343 Page 3 of 12 5. FEES AND RECAPTURE The ANNEXATION AGREEMENT sets forth comprehensively all of the fees, charges and costs that will be assessed by the VILLAGE associated with the DEVELOPMENT and construction of single-family attached dwelling units as approved under the ANNEXATION AGREEMENT. A. Park and School Donations. DEVELOPER shall pay the following Park and School Donations: i. Park Impact Fee. The DEVELOPER shall enter into a Park Dedication and Improvement Agreement with the Park District to formalize the terms of meeting the park obligation for development of the TERRITORY consistent with the terms of the ANNEXATION AGREEMENT. ii. School Impact Fee. DEVELOPER shall pay the School Land Cash Fee at the time of issuance of a building permit for each lot to be improved with a dwelling unit. Said fees will be paid in the amounts listed on the schedules attached to the ANNEXATION AGREEMENT. 6. FINAL DEVELOPMENT PLAN APPROVALS The VILLAGE hereby approves the following plans attached hereto as Exhibit B: Approved Elevations prepared by CalAtlantic Group, LLC, dated June 30, 2023, Final Plat of Subdivision prepared by Cage Civil Engineering dated November 15, 2023 and last revised December 12, 2023, Final Engineering Plan prepared by Cage Civil Engineering dated December 12, 2023, and Final Landscape Plan prepared by Gary Weber and Associates dated December 12, 2023, and Temporary Signage Plan prepared by Gary Weber and Associates (collectively “Final Plans”). The VILLAGE shall not require the DEVELOPER to include any oversized utilities, off-site utility extensions, roadway improvements, or other public improvements not generally depicted in the Final Plans other than as specified in the subsequent paragraph. Any improvements not reflected in the Final Plans or stated below shall not be the responsibility of the DEVELOPER. As part of the VILLAGE’S final engineering plan review for the TERRITORY, it may require that DEVELOPER extend an existing 12” water main south from a current termination point on the west side of Steiner Blvd across from the Greenbriar Subdivision to the existing 8” water main at the southwest corner of Illinois Route 126 and Steiner Blvd/Drauden Road. In addition, the VILLAGE may require that DEVELOPER extend the existing 12” water main that currently terminates just west of the Gas and Wash property on the south side of Illinois 344 Page 4 of 12 Route 126 to a point at or near the northwest corner of the TERRITORY. (“Off- Site Water Main Extensions”) The VILLAGE may require that the Off-Site Water Main Extensions be an obligation of the DEVELOPER as part of development of the TERRITORY. Subject to the conditions of this paragraph, the DEVELOPER will agree to undertake said Off-Site Water Main Extensions. The DEVELOPER and VILLAGE agree that DEVELOPER shall be permitted to undertake the Off- Site Water Main Extensions as a stand-alone project and that installation of said water mains shall not be a condition of DEVELOPER being permitted to move forward with any other aspects of DEVELOPMENT of the TERRITORY, including site development, other utility connections, recording of the final plat of subdivision as well as building and occupancy permit issuance for the residences to be built in the TERRITORY. DEVELOPER shall also be permitted to submit separate engineering plans for said Off-Site Water Main Extensions and the VILLAGE shall issue separate permits for the Off-Site Water Main Extensions. The common objective being to make sure that no aspect of development of the TERRITORY is delayed pending DEVELOPER’S installation of the Off-Site Water Main Extension. Additionally, DEVELOPER shall not be required to post any form of surety to guaranty completion of said Off-Site Water Main Extensions. Additionally, the VILLAGE agrees that within 30 days of the VILLAGE’s inspection, approval and acceptance of the completed Off-Site Water Main Extensions the VILLAGE shall reimburse DEVELOPER up to the sum of $174,473.75 which is currently being held in an unencumbered escrow by the VILLAGE. If said $174,473.75 escrow is insufficient to cover DEVELOPER’s costs incurred with regard to the Off-Site Water Main Extensions, the VILLAGE agrees to grant DEVELOPER a free credit applied against its water and sewer connection fee obligations which shall be applied on a pro-rata basis at building permit issuance until DEVELOPER is reimbursed in full for all costs incurred with the Off-Site Water Main Extensions. Reimbursement from the VILLAGE to the DEVELOPER shall include not only construction costs, but also all design, engineering and other incidental costs included by DEVELOPER associated with the Off-Site Water Main Extensions. Notwithstanding anything herein to the contrary, DEVELOPER’s agreement to install said Off-Site Water Main Extensions is expressly contingent upon the VILLAGE’s owning the requisite right-of-way to provide for the installation of the Off-Site Water Main Extensions specified herein. In the event, in the opinion of the DEVELOPER, the requisite right-of-way does not exist, DEVELOPER shall be under no obligation to undertake the Off-Site Water Main Extensions. Additionally, in the event DEVELOPER proceeds with the Off-Site Water Main Extensions as anticipated herein, the VILLAGE agrees to coordinate with DEVELOPER and reasonably approve interim water main looping options so that DEVELOPER may proceed with development and obtain occupancy permits for homes within the TERRITORY prior to DEVELOPER completing the Off-Site Water Main Extensions. Any costs associated with DEVELOPER’s interim water main improvements, including, but not limited to said looping shall also be subject to reimbursement from the VILLAGE as specified above. 345 Page 5 of 12 7. DEVELOPMENT A. Covenants, Conditions and Restrictions. DEVELOPER shall cause to be recorded against the SUBJECT PROPERTY a Declaration of Covenants, Conditions and Restrictions to govern the use of the DEVELOPMENT (the “Declaration”). The Declaration shall be recorded following the recordation of the Final Plat of Subdivision. The Declaration shall establish a Homeowner’s Association which shall be responsible for enforcement of the terms of the Declaration. B. Early Grading. Prior to approval of any final plan or plat, the VILLAGE agrees to issue grading and storm sewer installation approvals for the DEVELOPMENT upon proper and complete application therefor. Issuance of such permits is subject to the following terms and conditions: a. DEVELOPER has taken title to the DEVELOPMENT, and this AGREEMENT has become effective. b. DEVELOPER shall proceed under this subsection at its own risk. In the event that any work performed pursuant to this subsection does not comply with final plan or plat approval (including final engineering plans and specifications) or the VILLAGE Code, DEVELOPER shall correct such work to come into compliance. VILLAGE shall not be obligated to grant any relief for such non- compliance. c. In order to begin outside agency review of the DEVELOPMENT, the DEVELOPER has requested that the VILLAGE execute permit applications for the IEPA. The VILLAGE shall execute such applications under the following conditions: i) such execution shall not be deemed to provide final approval of the plans being used for the permit submittal, and such plans may still be amended during the final review and approval by the VILLAGE; ii) in the event there are changes that are required to the plans, the DEVELOPER shall make such corrections and the VILLAGE shall not be obligated to grant any relief for non-compliance. C. Foundation Only Permits. DEVELOPER may obtain foundation-only permits for up to ten (10) dwelling units once the Final Plat of Subdivision has been approved by the VILLAGE Board, final engineering plans have been approved by the VILLAGE Engineer, and surety has been posted in accordance with VILLAGE requirements. DEVELOPER acknowledges, however, that building permits shall not be issued by the VILLAGE, and no framing shall be started on dwelling units for which foundation-only permits have been issued (other than model homes in accordance herewith) until, at a minimum, water mains and fire hydrants necessary to provide fire protection have been constructed, connected, tested and approved by the VILLAGE, and provision has been made for 346 Page 6 of 12 emergency vehicle access thereto on a roadway with a gravel base sufficient to support the weight of emergency vehicles, all in a manner acceptable to the Fire Protection District. D. Construction Access. Access to the SUBJECT PROPERTY for the purposes of construction shall be limited to one or more of the access points located along Drauden or some other acceptable access location mutually agreed upon by the VILLAGE and DEVELOPER. E. Models/Sales and Office Trailers. DEVELOPER shall have the right to construct model homes beginning after: i) VILLAGE approval of a final plat and prior to the recording thereof; ii) construction of a gravel driveway to said models; and iii) the posting of the necessary surety guaranteeing the public improvements. No model homes shall be used as a model home or sales office until a temporary certificate of occupancy is issued for such purpose by the VILLAGE’S Building Department. Two transportable modular trailers may be utilized for on-site construction offices provided that the trailers have potable water and temporary sanitary facilities (i.e., holding tanks, not septic fields), and up to four portable trailers may be utilized to store materials on-site (subject to approval as to their number and location by the VILLAGE Engineer). F. Temporary Occupancy. The VILLAGE shall issue temporary or final occupancy certificates within two (2) business days of application therefor or issue a letter of denial within said period informing DEVELOPER as to what corrections are necessary as a condition to the issuance of a certificate and specifying the section of any applicable code relied upon by the VILLAGE in its request for correction. DEVELOPER’S inability, due to adverse weather conditions, to install driveways, service walks, sidewalks, stoops, landscaping and final grading shall not delay the issuance of a temporary certificate of occupancy provided DEVELOPER delivers security to the VILLAGE to assure the completion of said unfinished items. Once unfinished items have been completed and approved by the VILLAGE Engineer and Building Commissioner, the VILLAGE shall issue final occupancy certificates within the time prescribed herein and release the above-described security. 8. AMENDMENTS This AGREEMENT, including the attached exhibits, may be amended only with the mutual consent of the parties by a duly executed written instrument. In the case of the VILLAGE, the written instrument may only be in the form of an ordinance duly adopted in accordance with applicable laws. Modifications subsequent to this AGREEMENT’S adoption shall require a public hearing and procedures consistent with the law. 9. ENFORCEMENT 347 Page 7 of 12 This AGREEMENT shall be enforceable by any action at law or in equity, including actions for specific performance and injunctive relief. The laws of the State of Illinois shall control the construction and enforcement of this AGREEMENT. The parties agree that all actions instituted on this AGREEMENT shall be commenced and heard in the Circuit Court of Will County, Illinois, and hereby waive venue in any other court of competent jurisdiction. Before any failure of any party to perform any obligation arising from this AGREEMENT shall be deemed to constitute a breach, the party claiming the breach shall notify the defaulting party in writing, by way of certified mailing, and demand performance. No breach of this AGREEMENT shall have been found to have occurred if performance is commenced to the satisfaction of the complaining party within thirty (30) days of the receipt of such notice. 10. EFFECT OF SUCCESSORS This AGREEMENT shall be binding upon and inure to the benefit of the VILLAGE and its successor municipal corporations and corporate authorities. This AGREEMENT shall be binding upon and inure to the benefit of DEVELOPER and their grantees, lessees, assigns, successors and heirs. 11. SEVERABILITY If any provision, covenant, agreement, or portion of this AGREEMENT or its application to any person, entity or property is held invalid, such invalidity shall not affect the application or validity of any other provision, covenant, agreement or portion of this AGREEMENT, and this AGREEMENT is declared to be severable. 12. EFFECT OF THIS AGREEMENT The provisions of this AGREEMENT shall supersede the provisions of any ordinances, codes, policies or regulations of the VILLAGE which may be in conflict with the provisions of this AGREEMENT. Any notice or demand hereunder from one party to another party or to an assignee or successor in interest of either party or from an assignee or successor in interest of either party to another party, or between assignees or successors in interest, shall be provided in writing and shall be deemed duly served if mailed by prepaid registered or certified mail addressed as follows: If to the VILLAGE: John F. Argoudelis Josh Blakemore Village President Village Administrator 24401 W. Lockport St. 24401 W. Lockport St. Plainfield, IL 60544 Plainfield, IL 60544 348 Page 8 of 12 With copies to: Richard Vogel, Village Attorney Tracy, Johnson & Wilson 2801 Black Road, 2nd Floor Joliet, IL 60435 If to any owner of record of any real property located within the subject property, or the OWNER/DEVELOPER: CalAtlantic Group, LLC Attn: Scott Guerard 1700 E. Golf Road, #1100 Schaumburg, IL 60173 With copies to: Rosanova & Whitaker, Ltd. 445 Jackson Avenue Naperville, Illinois 60540 Attn: Vincent M. Rosanova vince@rw-attorneys.com Or to such address as any party hereto or an assignee or successor in interest of a party hereto may from time to time designate by notice to the other party hereto or their successors in interest. IN WITNESS WHEREOF, the parties have caused this AGREEMENT to be executed the day and year first above written. THE VILLAGE OF PLAINFIELD, BY:____________________________ BY:__________________________________ Village President ATTEST:_______________________ ITS:__________________________________ Village Clerk 349 Page 9 of 12 DEVELOPER CALATLANTIC GROUP, LLC, a Delaware limited liability company By:___________________________ ITS:___________________________ RECORD & RETURN TO: Village of Plainfield Village Clerk 24401 W. Lockport St. Plainfield, IL 60544 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 Page 10 of 10 EXHIBIT C DEVIATIONS 1. Section 9-23: Model Homes. To permit sales signage as depicted on the Temporary Sign Plan. 2. Section 9-52: Residential Density. To increase the permitted residential density from 6 dwelling units per acre to 6.12 dwelling units per acre. 3. Section 9-54: Minimum Lot Size. To reduce the minimum lot size from 12,000 square feet to 5,753. 4. Section 9-54: Minimum Front Yard Setback. To reduce the minimum front yard setback from 30’ to 25’. 5. Section 9-54: Minimum Corner Yard Setback. To reduce the minimum corner side yard setback from 30’ to 25’. 6. Section 9-54: Minimum Interior Side Yard Setback. To reduce the minimum interior side yard setback from 7’ with total of both side yards equaling at least 20’ to permit side to side minimum building separation of 20’. 7. Section 9-54: To Permit Building Coverage and Impervious Area Coverage as follows: BUILDING AREA COVERAGE (PER LOT) o 60 % coverage IMPERVIOUS AREA COVERAGE (PER LOT) o 75% coverage 413 VILLAGE OF PLAINFIELD RESOLUTION NO. ______ DATE OF PASSAGE: ___________ A RESOLUTION PROPOSING THE ESTABLISHMENT OF A SPECIAL SERVICE AREA NUMBER 48 AUTUMN GLEN SUBDIVISION WILL COUNTY IN THE VILLAGE OF PLAINFIELD AND PROVIDING FOR A PUBLIC HEARING AND OTHER PROCEDURES IN CONNECTION THEREWITH WHEREAS, special service areas are established pursuant to subsection (1) of Section 7 of Article VII of the Illinois Constitution of 1970, and the Special Service Area Tax Law (35 ILCS 200/27-5 et seq) and the Property Tax Code (35 ILCS 200/1-1 et seq); and WHEREAS, it is in the public interest that the territory described in the Notice set forth in paragraph 2 hereof be established as a Special Service Area for the purposes set forth herein, an accurate map of said territory being attached hereto as Group Exhibit “A-1”; and WHEREAS, said Area is compact and contiguous and constitutes a principal residential area of the Village; and WHEREAS, said Area is zoned for residential purposes and will benefit specially from the municipal services to be provided which include the maintenance, repair and replacement of certain entry monuments landscaped easements, common areas and stormwater retention areas, all in accordance with the final landscape and engineering plan and final plat of subdivision for the Area; and the proposed municipal services are unique and in addition to municipal services provided to the Village of Plainfield as a whole, and it is, therefore, in the best interests of said Area and the Village of Plainfield as a whole, that the levy of special taxes against said Area for the services to be provided be considered. NOW, THEREFORE, BE IT RESOLVED, by the Village Board of the Village of Plainfield, Illinois, as follows: 1. That a public hearing shall be held on the 1st day of April, 2024, at 7:00 p.m. in the Village Board Room of the Village Hall, 24401 W. Lockport, Plainfield, Illinois, to consider the creation of Special Service Area Number 48 of the Village of Plainfield, in the territory described in the Notice set forth in Paragraph 2 hereof. At the hearing, there will be considered the levy of an annual tax not to exceed an annual rate of twenty one-hundredths percent (.20%, being 20 cents per $100) of the equalized assessed value of the property in said Area, said tax to be levied for an indefinite period of time from and after the date of the Ordinance establishing said Area. Said taxes shall be in addition to all other taxes provided by law and shall be levied pursuant to the provisions of the Property Tax Code. Said levies are intended to produce approximately $442,400.00 annually for the cost for said services. Notwithstanding the foregoing, taxes shall not be levied hereunder and said Area shall be “dormant” and shall take effect only if the 414 Homeowners Association fails to maintain, repair or replace the aforesaid required items and the Village is forced to assume said responsibilities. 2. Notice of hearing shall be published at least once not less than fifteen (15) days prior to the public hearing in a newspaper in general circulation in the Village of Plainfield. In addition, notice by mailing shall be given by depositing said Notice in the U.S. Mails addressed to the person or persons in whose name the general taxes for the last preceding year were paid on each lot, block, tract or parcel of land lying within the proposed Special Service Area. Said Notice shall be mailed not less than ten (10) days prior to the time set for the public hearing. In the event taxes for the last preceding year were not paid, the Notice shall be sent to the person last listed on the tax rolls prior to that year as the owner of said property. The Notice shall be substantially the following form: NOTICE OF HEARING VILLAGE OF PLAINFIELD SPECIAL SERVICE AREA NUMBER 48 AUTUMN GLEN RESIDENTIAL SUBDIVISION NOTICE IS HEREBY GIVEN that on the Monday, April 1, 2024, at 7:00 p.m., a public hearing will be held by the Village Board of the Village of Plainfield in the Village Board Room of the Village Hall, 24401 W. Lockport, Plainfield, Illinois, to consider the establishment of a Special Service Area consisting of the subject property located general at the southwest corner of Lockport Street and Drauden Road (PINs 06-03-18-200-005-0010 and 06-03-18-200-005-0020) in Will County, Illinois and legally described as follows: That Part Of The East Half of The Northeast Quarter of Section 18, Township 36 North, Range 9 East Of The Third Principal Meridian, In Will County, Illinois. An accurate map of said territory is on file in the Office of the Village Clerk and available for public inspection. All interested persons affected by the formation of Special Service Area Number 48 will be given an opportunity to be heard regarding the formation of the boundaries of the Area and may object to the formation of the Area and the levy of taxes affecting said Area. The purpose of the formation of Special Service Area Number 48 in general is to provide for the maintenance, repair and replacement of certain entry monuments, landscaped easements and stormwater retention areas in said Area, all in accordance with the final landscape and engineering plan and final plat of subdivision for the Area, and the proposed municipal services are unique and are in addition to the improvements provided and/or maintained by the Village generally. At the hearing, all persons affected will be given an opportunity to be heard. At the hearing, there will be considered the levy of an annual tax of not to exceed an annual rate of twenty one- 415 hundredths percent (.20%, being 20 cents per $100) of the equalized assessed value of the property in the proposed Special Service Area Number 48, said tax to be levied for an indefinite period of time from and after the date of the Ordinance establishing said Area. Said taxes shall be in addition to all other taxes provided by law and shall be levied pursuant to the provisions of the Property Tax Code. Said levies are intended to produce approximately $442,400.00 annually for the cost for said services. Notwithstanding the foregoing, taxes shall not be levied hereunder and said Area shall be “dormant” and shall take effect only if the Homeowners Association fails to maintain, repair or replace the aforesaid required items and the Village is forced to assume said responsibilities. The hearing may be adjourned by the Village Board to another date without further notice other than a motion to be entered upon the minutes of its meeting fixing the time and place of its adjournment. If a petition signed by at least fifty-one percent (51%) of the electors residing within the proposed Special Service Area Number 48 and by at least fifty-one percent (51%) of the owners of record of the land included within the boundaries of the proposed Area is filed with the Village Clerk within sixty (60) days following the final adjournment of the public hearing objecting to the establishment of the Area, then enlargement thereof, or the levy or imposition of a tax for the provision of special services to the Area, no such Area may be established or enlarged, or tax levied or imposed. By order of the Corporate Authorities of the Village of Plainfield, Will and Kendall Counties, Illinois. MICHELLE GIBAS Village Clerk Case No. 2037-121223.FP.SSA Date this ________ day of _______, 2024. SIGNED BY: __________________________________________ VILLAGE CLERK: PASSED AND APPROVED THIS ____ day ________, 2024. AYES ______ NAYS _____ NOT VOTING _______ _____________________________ Mayor 416 ATTEST: _____________________________ Village Clerk TRUSTEES: _____________________________ ______________________________ _____________________________ ______________________________ _____________________________ ______________________________ 417 GROUP EXHIBIT A-1 AUTUMN GLEN SUBDIVISION LOCATION MAP 418 419 420 421 422 423 424 425 W. 143RD STREET S. STEINER ROADWALLIN DRIVELINCOLN ELEMENTARY SCHOOL LOCKPORT STREET LINCOLN HWYSUBJECT SITE LINEROADCONSULTANTS: DESCRIPTION INDEX OF SHEETS SHEET NO. 0 COVER SHEET 1 OVERALL LANDSCAPE PLAN 2 LANDSCAPE PLAN 3 LANDSCAPE PLAN 4 LANDSCAPE DETAILS 5 TYPICAL FOUNDATION LANDSCAPE PLANS 6 TYPICAL FOUNDATION LANDSCAPE PLANS 7 SITE AMENITY PLANS & DETAILS 8 MONUMENT DETAILS 9 MONUMENT DETAILS 10 TREE PRESERVATION PLAN 11 LANDSCAPE SPECIFICATIONS LOCATION MAP SCALE: 1"=800' LANDSCAPE ARCHITECT: GARY R. WEBER ASSOCIATES, INC 402 W. LIBERTY DRIVE WHEATON, ILLINOIS 60187 Final Landscape Plan LOCKLEY PARK Plainfield, Illinois January 19, 2024 CIVIL ENGINEER: CEMCON, LTD. 2280 WHITE OAK CIRCLE, SUITE 100 AURORA, ILLINOIS 60502 426 LOT 1LOT 2LOT 3LOT 4LOT 5LOT 6LOT 7LOT 8LOT 9LOT 10LOT 11LOT 12LOT 13LOT 14LOT 15LOT 16LOT 17LOT 18LOT 19LOT 29LOT 20LOT 21LOT 22LOT 23LOT 24LOT 25LOT 26LOT 27LOT 28LOT 30LOT 31LOT 32LOT 34LOT 35LOT 36LOT 37LOT 38LOT 40LOT 41LOT 42LOT 43LOT 44LOT 45LOT 46LOT 33LOT 39143RD STREETSTEINER ROADALABASTER CIRCLETILDEN PLACEEMORY LANEDAISY LANEALABASTER CIRCLEPRESIDENTIALAVENUESHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: OVERALL LANDSCAPE PLAN1050'100'200'300'LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallRGENERAL NOTESPERENNIALS AND GROUNDCOVERSNOT TO SCALENOT TO SCALEDECIDUOUS AND EVERGREEN SHRUBSDECIDUOUS TREESNOT TO SCALEEVERGREEN TREESNOT TO SCALEPARKWAYS: ±7,394 L.F.TREE REPLACEMENT20' LANDSCAPE BUFFER YARDS:NORTH, EAST, AND SOUTHPROPERTY LINES±3,609 L.F; 72,179 S.F.(30 PLANT UNITS PER 1,000 S.F.)OPEN SPACES:±603,138 S.F.(EXCLUDES GAS PIPELINE RIGHT-OF-WAY)(1 PLANT UNITS PER 750 S.F.)SCALE: 1"=100'NORTHSHEET 2SHEET 3PLANT MATERIAL QUANTITIESPLANTING DETAILSNATIVE AREA PLANT LIST427 TILDEN PLACEEMORY LANEDAISY LANEALABASTER CIRCLELOT 1LOT 2LOT 3LOT 4LOT 5LOT 6LOT 7LOT 8LOT 9LOT 10LOT 11LOT 12LOT 13LOT 14LOT 15LOT 16LOT 17LOT 18LOT 19LOT 20LOT 21LOT 22LOT 43LOT 44LOT 45LOT 46143RD STREETSTEINER ROADSHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: LANDSCAPE PLAN2LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallR025'50'100'150'SCALE: 1"=50'NORTHMATCHLINE - SEE SHEET 3WEST ENTRANCE -SEE DETAIL SHEET 4NORTH ENTRANCESEE DETAIL SHEET 4NATIVE LEGENDPARK AREASEE DETAILSHEET 4MATCHLINE - SEE SHEET 3428 ALABASTER CIRCLETILDEN PLACEALABASTER CIRCLEPRESIDENTIALAVENUELOT 29LOT 20LOT 21LOT 22LOT 23LOT 24LOT 25LOT 26LOT 27LOT 28LOT 30LOT 31LOT 32LOT 34LOT 35LOT 36LOT 37LOT 38LOT 40LOT 41LOT 42LOT 33LOT 39STEINER ROADSHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: LANDSCAPE PLAN3LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallR025'50'100'150'SCALE: 1"=50'NORTHMATCHLINE - SEE SHEET 2WESTENTRANCESEE DETAILSHEET 4NATIVE LEGENDPLANT COMMUNITY SECTIONNOT TO SCALENOT TO SCALENATURALIZED AREA SIGNMATCHLINE - SEE SHEET 2429 STEINER ROADTILDEN PLACEALABASTER CIRCLE 143RD STREETDAISY LANE SHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: LANDSCAPE DETAILS4LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallR010'20'40'60'SCALE: 1"=20'NORTH010'20'40'60'SCALE: 1"=20'NORTHNORTH ENTRANCE DETAILWEST ENTRANCE DETAIL010'20'40'60'SCALE: 1"=20'NORTHPARK DETAIL430 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:TYPICAL FOUNDATION LANDSCAPE PLANS5FOUNDATION LANDSCAPE PLAN SCALE: 1"=10' TYPICAL FRONT-LOAD 4 UNIT TOWNHOME LOCKLEY PARKPLAINFIELD, ILLINOIS01.19.2024 MI23232 CLE/MNW DHS OF 11 2135 CITY GATE LANE, SUITE 620 NAPERVILLE, IL 60563 CEMCON, LTD. 2280 WHITE OAK CIRCLE SUITE 100 AURORA, ILLINOIS 60502-9675 CLIENT ENGINEER Know what'sbelow. before you dig.Call R FOUNDATION LANDSCAPE PLAN SCALE: 1"=10' TYPICAL FRONT-LOAD 3 UNIT RANCH (BUILDING 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42) FRONT-LOAD 3 UNIT RANCH (BUILDINGS 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41) FRONT-LOAD 3 UNIT RANCH PLANT LIST A PLANT LIST B (BUILDING 1, 3, 5, 7, 9, 15, 17, 44) FRONT-LOAD 4 UNIT TOWNHOME (BUILDINGS 2, 4, 6, 8, 10, 16, 18, 46) FRONT-LOAD 4 UNIT TOWNHOME PLANT LIST A PLANT LIST B 431 SHEET NO. REVISIONS DRAWN CHECKED DATE PROJECT NO.PLOT CONFIG:XREFS:TYPICAL FOUNDATION LANDSCAPE PLANS6 LOCKLEY PARKPLAINFIELD, ILLINOIS01.19.2024 MI23232 CLE/MNW DHS OF 11 2135 CITY GATE LANE, SUITE 620 NAPERVILLE, IL 60563 CEMCON, LTD. 2280 WHITE OAK CIRCLE SUITE 100 AURORA, ILLINOIS 60502-9675 CLIENT ENGINEER Know what'sbelow. before you dig.Call R FOUNDATION LANDSCAPE PLAN SCALE: 1"=10' TYPICAL FRONT-LOAD 5 UNIT TOWNHOME (BUILDINGS 11, 12, 13) FRONT-LOAD 5 UNIT TOWNHOME (BUILDINGS 14, 19, 43, 45) FRONT-LOAD 5 UNIT TOWNHOME PLANT LIST A PLANT LIST B 432 LOT 32STEINER ROAD143RD STREETSHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: SITE AMENITY PLANS & DETAILS7LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallR010'20'40'60'SCALE: 1"=20'NORTHPARK DETAILMARKETING SIGN010'20'40'60'SCALE: 1"=20'NORTHWEST SIGN LOCATION MAP010'20'40'60'SCALE: 1"=20'NORTHNORTH SIGN LOCATION MAPBENCH DETAILNOT TO SCALENOT TO SCALEDECOMPOSED GRANITENOT TO SCALE433 OCKLEYLARKPAA'CC'BB'STEINER ROADTILDEN PLACESHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: MONUMENT DETAILS8LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallRMONUMENT ELEVATIONSCALE 3/4"=1'010'20'40'60'SCALE: 1"=20'NORTHWEST ENTRANCEMONUMENT PLANMONUMENT SECTION A-A'SCALE 3/4"=1'MONUMENT SECTION B-B'SCALE 3/4"=1'MONUMENT PLAN SECTION C-C'SCALE 3/4"=1'434 143RD STREETDAISY LANE LPAA'BB'SHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: MONUMENT DETAILS9LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallRMONUMENT ELEVATIONSCALE 3/4"=1'010'20'40'60'SCALE: 1"=20'NORTHWEST ENTRANCEMONUMENT PLANMONUMENT SECTION A-A'SCALE 3/4"=1'MONUMENT PLAN SECTION B-B'SCALE 3/4"=1'435 LOT 1LOT 2LOT 3LOT 4LOT 5LOT 6LOT 7LOT 8LOT 9LOT 10LOT 11LOT 12LOT 13LOT 14LOT 15LOT 16LOT 17LOT 18LOT 19LOT 29LOT 20LOT 21LOT 22LOT 23LOT 24LOT 25LOT 26LOT 27LOT 28LOT 30LOT 31LOT 32LOT 34LOT 35LOT 36LOT 37LOT 38LOT 40LOT 41LOT 42LOT 43LOT 44LOT 45LOT 46LOT 33LOT 39ALABASTER CIRCLETILDEN PLACEEMORY LANEDAISY LANEALABASTER CIRCLESHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: TREE PRESERVATION PLAN9035'70'140'210'SCALE: 1"=70'NORTHTREE PRESERVATION NOTESTREE PRESERVATION DETAIL(NOT TO SCALE)SEE NOTESLOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallRLEGENDTREE TO BE PRESERVEDTREE TO BE REMOVED436 SHEET NO.REVISIONSDRAWNCHECKEDDATEPROJECT NO.PLOT CONFIG:XREFS: LANDSCAPE SPECIFICATIONS10LOCKLEY PARK PLAINFIELD, ILLINOIS 01.19.2024MI23232CLE/MNWDHS OF 112135 CITY GATE LANE, SUITE 620NAPERVILLE, IL 60563CEMCON, LTD.2280 WHITE OAK CIRCLESUITE 100AURORA, ILLINOIS 60502-9675CLIENTENGINEERKnow what'sbelow.before you dig.CallR”437 VILLAGE OF PLAINFIELD RESOLUTION NO. ______ DATE OF PASSAGE: ___________ A RESOLUTION PROPOSING THE ESTABLISHMENT OF A SPECIAL SERVICE AREA NUMBER 50 LOCKLEY PARK SUBDIVISION WILL COUNTY IN THE VILLAGE OF PLAINFIELD AND PROVIDING FOR A PUBLIC HEARING AND OTHER PROCEDURES IN CONNECTION THEREWITH WHEREAS, special service areas are established pursuant to subsection (1) of Section 7 of Article VII of the Illinois Constitution of 1970, and the Special Service Area Tax Law (35 ILCS 200/27-5 et seq) and the Property Tax Code (35 ILCS 200/1-1 et seq); and WHEREAS, it is in the public interest that the territory described in the Notice set forth in paragraph 2 hereof be established as a Special Service Area for the purposes set forth herein, an accurate map of said territory being attached hereto as Group Exhibit “A-1”; and WHEREAS, said Area is compact and contiguous and constitutes a principal residential area of the Village; and WHEREAS, said Area is zoned for residential purposes and will benefit specially from the municipal services to be provided which include the maintenance, repair and replacement of certain entry monuments landscaped easements, common areas and stormwater retention areas, all in accordance with the final landscape and engineering plan and final plat of subdivision for the Area; and the proposed municipal services are unique and in addition to municipal services provided to the Village of Plainfield as a whole, and it is, therefore, in the best interests of said Area and the Village of Plainfield as a whole, that the levy of special taxes against said Area for the services to be provided be considered. NOW, THEREFORE, BE IT RESOLVED, by the Village Board of the Village of Plainfield, Illinois, as follows: 1. That a public hearing shall be held on the 1st day of April, 2024, at 7:00 p.m. in the Village Board Room of the Village Hall, 24401 W. Lockport, Plainfield, Illinois, to consider the creation of Special Service Area Number 50 of the Village of Plainfield, in the territory described in the Notice set forth in Paragraph 2 hereof. At the hearing, there will be considered the levy of an annual tax not to exceed an annual rate of twenty one-hundredths percent (.20%, being 20 cents per $100) of the equalized assessed value of the property in said Area, said tax to be levied for an indefinite period of time from and after the date of the Ordinance establishing said Area. Said taxes shall be in addition to all other taxes provided by law and shall be levied pursuant to the provisions of the Property Tax Code. Said levies are intended to produce approximately $165,000.00 annually for the cost for said services. Notwithstanding the foregoing, taxes shall not be levied hereunder and said Area shall be “dormant” and shall take effect only if the 438 Homeowners Association fails to maintain, repair or replace the aforesaid required items and the Village is forced to assume said responsibilities. 2. Notice of hearing shall be published at least once not less than fifteen (15) days prior to the public hearing in a newspaper in general circulation in the Village of Plainfield. In addition, notice by mailing shall be given by depositing said Notice in the U.S. Mails addressed to the person or persons in whose name the general taxes for the last preceding year were paid on each lot, block, tract or parcel of land lying within the proposed Special Service Area. Said Notice shall be mailed not less than ten (10) days prior to the time set for the public hearing. In the event taxes for the last preceding year were not paid, the Notice shall be sent to the person last listed on the tax rolls prior to that year as the owner of said property. The Notice shall be substantially the following form: NOTICE OF HEARING VILLAGE OF PLAINFIELD SPECIAL SERVICE AREA NUMBER 50 LOCKLEY PARK RESIDENTIAL SUBDIVISION NOTICE IS HEREBY GIVEN that on the Monday, April 1, 2024, at 7:00 p.m., a public hearing will be held by the Village Board of the Village of Plainfield in the Village Board Room of the Village Hall, 24401 W. Lockport, Plainfield, Illinois, to consider the establishment of a Special Service Area consisting of the subject property located general at the southeast corner of 143rd Street and Steiner Road (PIN 06-03-08-100-001-0000) in Will County, Illinois and legally described as follows: That Part Of The Northwest Quarter Of The Northwest Quarter Of Section 8, Township 36 North, Range 9 East Of The Third Principal Meridian, Bounded And Described As Follows: Beginning At The Northwest Corner Of Liberty Grove Unit Seven According To The Plat Thereof Recorded As Document R2003036189, Said Corner Being Coincident With The Northeast Corner Of Said Quarter- Quarter Section; Thence South 01 Degrees 43 Minutes 20 Seconds East (Bearing Assumed For Description Purposes), 1325.43 Along The West Line Of Said Unit Seven, Along The West Line Of Liberty Grove Unit Six According To The Plat Thereof Recorded As Document R2003036260, Both Being Coincident With The East Line Of Said Quarter-Quarter Section To The South East Corner Of Said Quarter- Quarter Section; Thence South 88 Degrees 40 Minutes 06 Seconds West, 1263.22 Feet Along The South Line Of Said Quarter-Quarter Section To The Southeast Corner Of Property Conveyed Per Document R2006210270 (The Following Four Courses Are Along The Easterly Line Of Property Conveyed Per Document R2006210270); 1) Thence North 01 Degrees 44 Minutes 40 Seconds West, 1242.90 Feet; 2) Thence North 43 Degrees 28 Minutes 57 Seconds East, 70.43 Feet; 3) Thence North 88 Degrees 41 Minutes 18 Second East, 90.00 Feet; 4) Thence North 01 Degrees 44 Minutes 40 Seconds West, 33.00 Feet To The North Line Of The Northwest Quarter Of The Northwest Quarter, Aforesaid; Thence North 88 Degrees 41 Minutes 18 Second East, 1123.73 Feet Along Said North Line To The Point Of Beginning, In Will County, Illinois. 439 An accurate map of said territory is on file in the Office of the Village Clerk and available for public inspection. All interested persons affected by the formation of Special Service Area Number 50 will be given an opportunity to be heard regarding the formation of the boundaries of the Area and may object to the formation of the Area and the levy of taxes affecting said Area. The purpose of the formation of Special Service Area Number 50 in general is to provide for the maintenance, repair and replacement of certain entry monuments, landscaped easements and stormwater retention areas in said Area, all in accordance with the final landscape and engineering plan and final plat of subdivision for the Area, and the proposed municipal services are unique and are in addition to the improvements provided and/or maintained by the Village generally. At the hearing, all persons affected will be given an opportunity to be heard. At the hearing, there will be considered the levy of an annual tax of not to exceed an annual rate of twenty one-hundredths percent (.20%, being 20 cents per $100) of the equalized assessed value of the property in the proposed Special Service Area Number 50, said tax to be levied for an indefinite period of time from and after the date of the Ordinance establishing said Area. Said taxes shall be in addition to all other taxes provided by law and shall be levied pursuant to the provisions of the Property Tax Code. Said levies are intended to produce approximately $220,000.00 annually for the cost for said services. Notwithstanding the foregoing, taxes shall not be levied hereunder and said Area shall be “dormant” and shall take effect only if the Homeowners Association fails to maintain, repair or replace the aforesaid required items and the Village is forced to assume said responsibilities. The hearing may be adjourned by the Village Board to another date without further notice other than a motion to be entered upon the minutes of its meeting fixing the time and place of its adjournment. If a petition signed by at least fifty-one percent (51%) of the electors residing within the proposed Special Service Area Number 50 and by at least fifty-one percent (51%) of the owners of record of the land included within the boundaries of the proposed Area is filed with the Village Clerk within sixty (60) days following the final adjournment of the public hearing objecting to the establishment of the Area, then enlargement thereof, or the levy or imposition of a tax for the provision of special services to the Area, no such Area may be established or enlarged, or tax levied or imposed. By order of the Corporate Authorities of the Village of Plainfield, Will and Kendall Counties, Illinois. MICHELLE GIBAS Village Clerk Case No. 2043-011924.FP.SSA Date this ________ day of _______, 2024. 440 SIGNED BY: __________________________________________ VILLAGE CLERK: PASSED AND APPROVED THIS ____ day ________, 2024. AYES ______ NAYS _____ NOT VOTING _______ _____________________________ Mayor ATTEST: _____________________________ Village Clerk TRUSTEES: _____________________________ ______________________________ _____________________________ ______________________________ _____________________________ ______________________________ 441 GROUP EXHIBIT A-1 LOCKLY PARK SUBDIVISION LOCATION MAP 442 MEMORANDUM To:Mayor Argoudelis and Trustees CC: Joshua Blakemore – Village Administrator From: Lonnie Spires – Building and Code Compliance Director Date:March 4, 2024 Re: Rental Registration and Crime Free Ordinance Background Findings Staff has taken the direction from the board that was given at the Committee of the Whole meetings on September 11, 2023, and December 11, 2023, and February 5, 2024 Village of Plainfield Board Meeting has modified the code language to reflect the respective recommendations. Staff is recommending approval of a Rental Registration and Crime Free Ordinance. Financial Considerations The current staff that is employed in the Building and Code Enforcement Department and the Police Department will be utilized to perform the necessary work in order to enforce this ordinance. Staff is not seeing any need at this time for any additional funds for this ordinance. Recommendation Staff is seeking Board consideration of a motion to approve an Ordinance Chapter 2.5 Article XIV – Rental Registration and Crime Free Ordinance Sections 2.5-511 through and including Section 2.5-542 and amended ordinance, Chapter 2.5 Article XII – fees to enact Section 2.5 – 504 Rental Regulation Fees. 443 VILLAGE OF PLAINFIELD ORDINANCE NO. _____ AN ORDINANCE ENACTING CHAPTER 2.5, ARTICLE XIV OF THE CODE OF ORDINANCES OF THE VILLAGE OF PLAINFIELD An Ordinance creating a Rental Regulation Ordinance; Crime Free Housing Ordinance; Vacant Property Registration Ordinance; Commercial Property Registration Ordinance ADOPTED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD THIS ____ DAY OF _____ 2024. Published in pamphlet form by the authority of the President and Board of Trustees of the Village of Plainfield, Will and Kendall Counties, Illinois this ____ day of _____ 2024. 444 ORDINANCE NO. _____ AN ORDINANCE ENACTING CHAPTER 2.5, ARTICLE XIV OF THE CODE OF ORDINANCES OF THE VILLAGE OF PLAINFIELD NOW, THEREFORE, BE IT ORDAINED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL AND KENDALL COUNTIES, ILLINOIS AS FOLLOWS: I.That Chapter 2.5, Article XIV is hereby enacted with the following: 2.5-511 Title These regulations consisting of Sections 2.5-511 through and including Section 2.5-542 shall be known as the Rental Regulation and Crime Free Ordinance. 2.5-512 Purpose The purpose of this ordinance is to provide for the annual licensing of residential rental property, so as to protect the public health, safety, and welfare of the village, including but not limited to: Providing minimum standards for the maintenance, operation, use and appearance of residential rental properties. Preventing living conditions that adversely affect or are likely to affect the life, safety, health, and general welfare of persons occupying rental dwelling units. Preserving the value of land and buildings throughout the village 2.5-513 Application The ordinance shall be held to be minimum requirements adopted for the protection of the public health, safety, and welfare. This ordinance, the International Property Maintenance Code (IPMC) adopted by the Village and the Village of Plainfield Code and ordinances shall apply as minimum standards for maintenance of all residential properties in the village that are rented or leased, including any residential dwelling unit, rooming unit, or such other residential building or structure wherein the owner or owner’s agent allows an individual to occupy space while charging a fee for the privilege of occupying the space. Where the requirements of this ordinance vary from any other lawfully adopted state laws, rules, regulations, ordinances, 445 codes, deed restrictions or covenants, the more restrictive or that imposing the higher standards shall govern. The village does not enforce any private covenants, contract, or agreements between landowners or tenants. 2.5-514 Definitions For the purpose of this Chapter and Article, the following definitions shall apply unless the context clearly indicates or requires a different meaning: Abatement - the reduction or cessation of a nuisance through actions by the property owner that show a substantial and/or measurable decrease or alleviation of a nuisance. Aggravated Nuisance Activities - any of the following activities, behaviors, or conduct as defined by federal, state, or municipal statute and/or ordinance where a citation is given, an arrest is made, or a violation has been documented. A citation, arrest, or violation on its own does not qualify or create a nuisance activity, but proof by a preponderance of the evidence that the underlying conduct occurred: Homicide; Kidnapping; Criminal housing management; Possession of explosives or in substance violations; Production, sale, distribution or possession of cannabis in violation of the Cannabis Control Act; Gang activity violations as described in the Illinois Street gang Terrorism Omnibus Prevention Act, or any violation of Trafficking in persons, involuntary servitude, and related offenses Chapter 720 ILCS 5/10-9. Apartment –the dwelling units in a multiple family dwelling as defined herein. Appropriate Authority – That person within the Village or other relevant unit of government who is charged with the administration of the code at issue. Building Official –The director of the Villages code enforcement department or his designee. Bed and Breakfast –A private owner-occupied business in a single-family residence where overnight accommodation and a morning meal are provided to transients for compensation. Building (structure) – means any physical edifice that is built or installed and is located on and affixed to the land and used for or intended for supporting or sheltering any use or occupancy. The terms “building” and “structure” as used in this article shall be synonymous and shall include any portion thereof. Current Occupants –Any individual living or sleeping in a building or having possession of a space within a building. 446 Code Enforcement Officer – The official who is charged with the administration and enforcement of this chapter, or any duly authorized representative. Commercial Property – Buildings and land that are intended for profit-generating activities rather than regular residential purposes. Common Area – Common areas shall include, but are not limited to, all hallways, stairways, lobbies, utility rooms, laundry rooms, storage rooms, recreation rooms, grounds, refuse areas, parking areas, building extensions, signs and other areas designated for common use by dwelling unit occupants, or which are subject to an exclusive right to possess of a dwelling unit occupant. Condominium – Shall mean any dwelling unit under individual ownership in multi-unit structure as provided in the Condominium Property Act of the Illinois Compiled Statutes, 765 ILCS 605/1 et. seq. Condominium Association –Shall mean any organization or association which governs the operation of common areas or services for two (2) or more condominiums. Crime Free Liaison –A sworn Law Enforcement Officer assigned the responsibility of information sharing with the Code Enforcement Department in relation to rental properties in the event of a potential violation of the RRO. Dilapidated –No longer adequate for the purpose or use for which it was originally intended. Days – Means consecutive business days, with a business day being any day other than Saturday, Sunday, or legal holidays on which the Village offices are closed for business. Department – Means code enforcement department of the Village. Dwelling - A building, or portion of a building, used for residential occupancy, including single- family detached dwellings, two-family dwellings, duplexes, single-family attached dwellings, multiple- family dwellings, boarding and rooming houses, dormitories, and apartment hotels, but excluding cabins, tents, hotels, motels, trailers, and recreational vehicles. Dwelling Unit –A single unit providing complete, independent living facilities for one or more persons, including permanent provisions for living, sleeping, eating, cooking and sanitation. Dwelling, Multiple Family –A building or portion thereof, designed for occupancy by three (3) or more families living in individual dwelling units. 447 Dwelling, Single Family - A building designed exclusively for occupancy by one family, detached from all other dwellings, and surrounded by open space, but not including manufactured housing. Dwelling, Two Family- A building designed or arranged to be occupied by two families living independently, with the structure having only two dwelling units. Dwelling Rental – A building, dwelling unit or room occupied and leased by a tenant. Evidence of Vacancy -Means any condition that on its own, or combined with other conditions present, would lead a reasonable person to believe that the property is vacant. Such conditions may include, but are not limited to, overgrown or dead vegetation; past due utility notices or disconnected utilities; utility usage inconsistent with regular and continuous human occupancy; accumulation of trash, junk or debris; abandoned vehicles, auto parts or materials; the absence of furnishings or personal items consistent with habitation or occupancy; the presence of an unsanitary, stagnant swimming pool; the accumulation of newspapers, circulars, flyers or mail; statements by neighbors, passersby, delivery agents or government agents; or the presence of boards over doors, windows or other openings in violation of applicable codes. Family -Two (2) or more persons related to each other by blood, marriage, or legal adoption living together as a single housekeeping unit; or two (2) unrelated persons and their children living together as a single housekeeping unit; or any of various social units differing from but regarded as equivalent to the common definition of family; or a group of not more than four (4) persons who need not be related by blood, marriage or legal adoption, living together as a single housekeeping unit and occupying a single dwelling unit. Guest –An individual who shares a dwelling unit in a nonpermanent status for not more than thirty (30) days. Group Home Exempt -A dwelling or facility used to provide a socially dependent family environment for developmentally or mentally disabled patients, as specified in the 1988 Fair Housing Act Amendments of the Civil Rights Act of 1968. For purposes of this ordinance, this definition shall not include "halfway houses," uses for the recovering chemically dependent, prison work release programs or any use that does not house solely the developmentally or mentally disabled. Such dwellings or facilities are exempt from the RRO. Garbage –The animal or vegetable waste resulting from the handling, preparation, cooking and consumption of food. 448 Homeowners Association (HOA) –a non-profit organization made up of volunteers and a governing body that makes and enforces rules for a subdivision of homes, condominium complex, or planned unit development. Hotel/Motel –Any business or entity subject to the tax imposed by Chapter 7.7, Article 3 of this Code. Such businesses or entities are exempt from the provisions of the RRO. Infestation –The presence, within or contiguous to a structure or premises of insects, rodents, vermin, or other pests. Inspection-An inspection performed by the Code Enforcement Department of the Village of a rental dwelling to verify the conditions within the rental dwelling. Landlord –A person who rents land, a building, or an apartment to a tenant. Land Trust-Any express agreement or arrangement whereof a use, confidence or trust is declared of any land, or of any charge upon land, for the use or benefit of any beneficiary, under which the title to real property, both legal and equitable, is held by a trustee, subject only to the execution of the trust, which may be enforced by the beneficiaries who have the exclusive right to manage and control the real estate, to have the possession thereof, to receive the net proceeds from the rental, sale, hypothecation or other disposition thereof, and under which the interest of the beneficiary is personal property only. Let for Occupancy or Let –To permit, provide or offer possession or occupancy of a dwelling, dwelling unit, rooming unit, building, premise or structure by a person who is or is not the legal owner of record thereof, pursuant to a written or unwritten lease, agreement, or license, or pursuant to a recorded or unrecorded agreement of contract for the sale of land. Local Agent –the agent designated by the owner upon registration as required under this article, must have a permanent address located no more than thirty (30) miles from the village border. Life Safety Violations –Any violation from the following Unsafe Conditions sections: 304.1.1; 305.1.1; 306.1.1; or State of Illinois Plumbing Code, Chapter 6 Mechanical and Electrical, Chapter 7 Fire Safety; or other violation which the Code Official determines to present an imminent threat to life/safety that requires vacation of occupancy. Manager –see property manager. Meaning of Certain Words –Whenever the words “dwelling”, dwelling unit”, “premises”, or “structure” are used in this chapter, they shall be construed as though they were followed by the words “or any part thereof”. Words used in the singular include the plural and the plural the singular; masculine gender includes the feminine and the feminine the masculine. 449 Neglect-The lack of proper maintenance for a building or structure in violation of applicable Village codes and ordinances. Nuisance Activities -means any of the following activities, behaviors, or conduct, as defined by federal, state, or municipal statute and/or ordinance where a citation is given, an arrest is made, or a violation has been documented. A citation, arrest, or violation on its own does not qualify or create a nuisance activity, but proof by a preponderance of the evidence that the underlying conduct occurred: Unlawful assembly; Assault; Battery; Prostitution, Soliciting or patronizing a prostitute; Keeping a house of prostitution; Pandering; Obscenity; Sexual assault and sexual abuse; Public indecency; Disorderly conduct; Illegal gambling; Keeping or maintaining a place of illegal gambling; Unlawful possession of gambling devices; Arson; Criminal damage to property; Illegal consumption, sale or possession of alcohol; Theft; Interference with public/peace officer; Harassment; Indecent exposure; Zoning violations; Loitering; Unlawful possession, sale, distribution or use of fireworks; Aiding and abetting; Conspiracy; Trespass; Drug paraphernalia; Violation of noise ordinance; Occupancy violations; Vandalism or graffiti; Violations of any animal regulations; any violation of Chapter 720 ILCS 5/37-1. Nuisance Property -any property on which the police department has had one (1) official police report of an aggravated nuisance activity, or two (2) or more official police reports of nuisance activity which has occurred within a six-month period, arising out of the property. Nursing homes and Assisted Living Facilities –Shall mean and include Nursing homes, retirement centers, rest homes, or hospices licensed, inspected, and governed by state or federal laws, rules, or regulations, residential rental dwelling units located in a subdivision or development, the occupancy of which is intended or operated for persons aged 55 or over, in accordance with the federal "Housing for Older Persons Act" or other applicable law, or assisted living facilities governed by state or federal laws, rules, or regulations. Nursing homes and Assisted Living Facilities as defined herein shall be exempt from the RRO. Occupancy Certificate-A document certifying that a rental dwelling has passed the inspection required by the RRO and occupants are able to occupy the structure. Owner - The word "owner," applied to a building or land, shall include any part owner, joint owner, tenant in common, tenant in partnership, joint tenant, or tenant by the entirety, of the whole or of a part of such building or land. Operate -To own, manage, maintain, rent, lease, advertise, or offer for rent or lease any residential rental property or dwelling unit therein for the purpose of renting to others. Operator –Any person who has charge, care or control of a structure or premises that is let or offered for occupancy. 450 Person -The word "person" shall refer to associations, clubs, societies, firms, companies, entities, partnerships, limited partnerships, organizations, and bodies politic and corporate as well as individuals. Premises –Means a lot, plot or parcel of land including any structures thereon. Property -any property, including land and that which is affixed, incidental, or appurtenant to land, including, but not limited to, any business or residence, parking area, loading area, landscaping, building or structure or any separate part, unit, or portion thereof, or any business equipment, whether or not permanent. For property consisting of more than one unit, property may be limited to the unit or the portion of the property on which any nuisance activity has occurred or is occurring but includes areas of the property used in common by all units of property, including, without limitation, other structures erected on the property and areas used for parking, loading, and landscaping. Property Agent –A person designated in writing to the village as having authority to manage a residential rental property including the authority to receive notices or citations. Property Manager –Any person either residing in or on rental property and functioning as an agent for nonresidential rental property owners. Registry -means a database of searchable real property records, used by the village to allow mortgagees and owners the opportunity to register properties and pay applicable fees as required in this article. Responsible Party –Any and all owners, tenants, occupiers, property manager, and lessees of any building, whether residential or commercial, alone, or jointly or severally. Rubbish –Combustible and noncombustible waste materials, except garbage: the term shall include the residue from the burning of wood, coal, coke and other combustible materials, paper, rags, cartons, boxes, wood, excelsior, rubber, leather, tree branches, yard trimmings, tin cans, metals, mineral matter, glass, crockery and dust and other similar materials. Rent –To provide or offer for possession or occupancy a dwelling unit to a person who is not the legal owner of record thereof, pursuant to an agreement, written, oral or implied, for the consideration or pursuant to articles of agreement for deed or similar agreement, if not recorded with the Recorder of Deeds of Will / Kendall Counties, Illinois. Notwithstanding the absence of a traditional written or oral lease, a dwelling unit or shall nonetheless be deemed to be rented within the meaning of the RRO, where, under the totality of the circumstances, it appears that the property is intended to be used and occupied by persons other than the real or substantial owner thereof. Factors relevant to the determination that a property is rented within the meaning of the RRO shall include, but not necessarily be limited to the following: a) the identity of the persons or entities shown on the tax bill for the property in question, b) the 451 identity of the person or entity shown on the bills or accounts for utility services to the property in question, c) whether the occupant(s) of the property in question have provided any form of periodic or other consideration to any other party as a condition of the ability of the occupant to occupy the property in question, d) the identity of the person or entity responsible for repairs and maintenance to the property in question, whether such person or entity occupies the property in question, and whether such person or entity receives compensation for performing repairs and maintenance to the property in question, e) whether the property in question is occupied by persons collectively holding a majority of the beneficial interest in any land trust in which title to the property in question is held together with the power of direction over such land trust, or whether the property is occupied by persons collectively holding a minority of the beneficial interest in any land trust in which title to the property in question is held, without the power of direction over such land trust, f) the relative proportions of beneficial interest in any land trust holding title to the property in question held by occupants of the property in question as compared to non-occupants of the property in question, and g) the absence of any familial relationship between the occupants of the property and the non- occupant holders of beneficial interest in any land trust holding title to the property in question, h) the relative proportion of ownership interest or title to the property held by owner-occupants as compared to the proportion of ownership interest or title to the property held by non-occupant owners of the property in question, regardless of the form or means by which such ownership or title interests are held, i) whether the property in question is occupied by persons collectively holding a majority of the ownership interest in or title to the property, regardless of the form or means by which such ownership interests or title is held, and j) the presence or absence of any familial relationship between the occupant-owners and the non- occupant owners, regardless of the form or means by which such ownership or title interests are held. This definition shall be deemed incorporated into other terms defined in the RRO referring to “rental” in the context of dwelling units or properties. Rental License -A license required for any owner of a residential building, structure, dwelling or dwelling unit who rents, leases, or controls any portion of the property, building, or structure to another person, business, corporation, or entity for any fixed period of time. Residential Rental Property –A dwelling unit that is rented to persons other than the person(s) holding legal or equitable title to the property. A dwelling unit occupied by a purchaser under the provisions of articles of agreement for deed or similar agreement shall be considered a residential rental property unless the articles of agreement or similar agreement have been recorded with the Recorder of Deeds of Will/ Kendall Counties, Illinois. There shall be a presumption that any dwelling that is not occupied by the owner is a residential rental property. 452 Rental Unit -Any dwelling unit that is either a multi-family dwelling unit, townhome structure, single-family detached residence that is rented, leased or subleased to an occupant or intended for occupancy by other than the owner. Stagnant Water –Shall mean any accumulation of water in any developed or improved area not intended or designed to hold or retain water that has not dispersed within seven (7) days of the last recorded local rainfall. Short Term Residential Rental –A dwelling unit offered for rent for a period, which does not exceed thirty (30) consecutive days. The term “short-term residential rental” shall not include hotels/motels, bed and breakfast establishments, or boarding facilities. Short-Term Residential Rental Property Owner –the individual or entity, which has title to the property, which is the subject of a short-term residential rental. Sleeping Unit–A room or space in which people sleep, which can also include permanent provisions for living, eating and either sanitation or kitchen facilities, but not both. Such rooms and spaces that are also part of a dwelling unit are not sleeping units. Tenant –Any adult person granted use of a rental dwelling unit or room pursuant to a lease with the owner of the rental dwelling unit. Utilities and Services -services means any utility or service that is essential for a building to be habitable or perform a service necessary to comply with all village codes. This includes, but is not limited to, electrical, gas, water, sewer, lawn maintenance, pool maintenance, and snow removal. Village Administrator -The village administrator of the village or his designated representative. Village -The word "village" shall mean the Village of Plainfield, Illinois. 2.5-515 Residential Rental License Required (A) No person shall rent any multi-family, single-family, two-family dwelling, or rental dwelling unit whether it is for long or short term unless they hold a current, unrevoked rental license issued by the Building Official or a designee in his name for the specifically named dwelling or dwelling unit. Rental Licenses shall be issued by the Village Code Enforcement Department for a period of one year from September 1 to August 31st. Any landlord license may be transferred to another person, subject to a completion and approval of a new license application by new licensee. Only one license fee, however, shall be required per landlord. 453 (B) This licensing requirement shall not apply to: a. Single family dwellings occupied by a member of the owner's immediate family. b. Hotels, Motels, and Bed and Breakfast establishments c. Nursing homes, retirement centers, rest homes, or hospices licensed, inspected, and governed by state or federal laws, rules, or regulations. d. Group homes governed by 405 Illinois Compiled Statutes 35/1 et seq., as amended, Specialized Living Centers Act, dealing with the developmentally disabled, or other similar uses governed by state or federal laws, rules, or regulations. (C) Application: No residential rental license shall be issued except upon a receipt of a completed village residential license application. Such applications shall be submitted with the appropriate fees to the Village Code Enforcement department no later than August 15th preceding the license year being applied for. License applications submitted after August 15 preceding the license year may be subject to delays in processing and may not ensure timely license issuance; in such a case, there shall be no proration of the applicable license fee. (D) Each owner of a residential rental dwelling shall file a written application with the village and shall submit the following information on the application provided by the village: a. Name, address, and home and business telephone numbers of the owner of the property, appropriate corporate or partnership information, including the name of the registered agent, president, manager or managing partner. The name, address, and phone number of the property manager or management company, and local agent representing the owner. b. All residential rental dwellings are required to have a local agent. The local agent shall be reasonably accessible to the village and have a telephone number which shall be available to the village at any time. An office will be located no more than thirty (30) miles from the Village border for contact. c. Name, address (no P.O. boxes or Bank Trust Addresses), business, and home telephone numbers, cell phone numbers and email addresses of the owner and property agent to be contacted when potential violations of municipal ordinances occur. d. Telephone number of the owner or agent to be contacted when an emergency exists. e. In the event any of the information requested should change, it shall be the obligation of the owner to notify the village in writing within ten days of the change. 454 f. All information on the application shall be correct and current. Any falsification of the application will result in the rental license being revoked. g. Proof that the applicant has attended and completed the crime free housing seminar required under Section 2.5-531 of this Code. 2.5-516 Issuance of License (A) Rental licenses shall be good for one (1) year from the date of issuance. (B)No license shall be issued or renewed unless the owner agrees in the application to inspections pursuant to this ordinance. (C)No license shall be issued or renewed unless the owner is in compliance with the Federal Fair Housing Act, Illinois Human Rights Act, and/or the Illinois Civil Rights Act. (D)No license shall be issued or renewed unless the application is filled out in its entirety. (E) No license will be issued or renewed unless all licensing fees and inspection fees have been paid to the Village.Failure to pay any balance will serve as grounds to deny further permits or licenses from being issued by the village. (F) In the event the property changes ownership, and the new owner intends on keeping the property as a rental dwelling, the new owner will apply for a rental license within 10 days of taking ownership of the property.The property may be required to be inspected before a new license can be issued. After inspection, no such license shall be issued unless the location is found to meet all applicable requirements of this article and applicable rules and regulations of the village. (G)License fees shall be payable in accordance with the fee schedule set forth in Chapter 2.5, Article XII of this Code. 2.5-517 Revocation/Suspension of License Cause for revocation, suspension, or refusal to renew a Rental License shall include, but is not limited to, the following: (1) Failure to correct violations of applicable ordinances or provisions of this code noted during the rental inspection process. (2) 3 or more violations of applicable Village ordinances within a two (2) year time period. (3) Conditions of the unit pose an immediate threat to the life and safety of the occupants and the conditions have not been remediated within the time frame required under Village ordinances, order of court, or order of Hearing Officer. (4) Failure to register a dwelling as a rental. (5) Found to be in violation of the Federal Fair Housing Act, Illinois Human Rights Act, and/or the Illinois Civil Rights Act. 455 (6) Nonpayment on licensing fees or inspection as required by the fee schedule set forth in Chapter 2.5, Article XII of this Code. (7) The rental dwelling unit or the lot on which dwelling is located has been declared a nuisance under the provisions of Section 6-227 et. seq. of the Village Code of Ordinances. 2.5-518 Hearing Procedures for Revocation, Suspension or Nonrenewal of A Rental Occupancy Certificate and/or Rental License (A) Upon the determination by the Building Official that there is reasonable cause to believe that a Rental License should be revoked, suspended, or not renewed because of a violation of this Article, notice of a hearing, together with a written statement of charges, shall be sent to the owner, operator and the tenant(s) in accordance with Village Code Chapter 2 Article VII Administrative Adjudication. The Hearing Officer designated under Village Code Chapter 2 Article VII Administrative Adjudication shall act as the Hearing Officer. Such a hearing shall be held not less than five (5) business days after notice of time, place and subject of the hearing has been received by the owner, operator and tenant, at their last known address or business address. The Village's representative shall present evidence in support of the suspension, revocation, or nonrenewal, and the owner, operator and/or tenant shall be permitted to rebut such evidence and present any other evidence that is relevant and material. Based on the evidence presented at the hearing, the Hearing Officer shall issue a written decision. The Hearing Officer's decision shall be final and binding unless appealed as hereinafter provided. The suspension or revocation of any Rental License shall not release or discharge the owner from paying any fees due under this Article, nor shall such owner be released from prosecution for violating this Article or this Code. (B) If the Hearing Officer determines that a violation has occurred, the Hearing Officer may fine the violator and may also revoke, suspend, or refuse to renew the Rental License, or may allow more time for abatement of any violation or nuisance. If more time is given by the hearing officer, the Code Enforcement Officer will perform a reinspection of the property to determine if the violation or nuisance has been corrected or abated. (C) The Hearing Officer may also authorize the Village to recover any expenses incurred by the Village in remediating a public nuisance where authorized by the applicable ordinance or statute. (D) Any final decision by a Hearing Officer that a Code violation or nuisance does or does not exist, or to suspend, revoke, or not renew a license under this Chapter shall constitute a final determination for purposes of judicial review under the Illinois Administrative Review Act (5 ILCS 100/1-1 et seq.). 456 2.5-519 Reinstatement of license after Suspension, Revocation or Non- renewal: If, upon reinspection the property is now in compliance with this article and with the applicable ordinances, rules and regulations, a recommendation of the reinstatement of the license may be made to the Village Administrator after the expiration of the applicable suspension period in the case of suspended licenses or after the expiration of one year from the date of revocation in the case of revoked licenses; non-renewed licenses may be reinstated after a compliant reinspection without the passage of any particular time period. A reinstatement fee equal to the initial license fee will be required in all such cases. 2.5-520 Inspections of Rental Premises (A) All areas of the residential dwelling unit to which the lessee or renter has the right of use or access shall be subject to inspection for compliance with the applicable codes and ordinances of the village. An inspection will be performed by the Code Enforcement Officer to ensure that all applicable code requirements which include but are not limited to the International Building Code, the NFPA 70 Electric Code, the Illinois Plumbing Code, the International Mechanical Code, the International Fire Code, the International Residential Code, the International Property Maintenance Code, the International Fuel Gas Code, the International Energy Conservation Code, the Swimming Pool and Spa Code, latest adopted editions and any amendments to such codes as are adopted by the village have been met. In addition to the Codes, the following protocols are in place in regard to Inspections: 1. No rental property shall be scheduled for an inspection or inspected unless a current rental license has been issued to the owner of the property for which inspection is sought. 2. Rental inspections will be performed on a move in/move out basis. 3. Whenever upon inspection of a rental dwelling the Code Enforcement Officer finds a violation of the provisions listed within this Chapter or any applicable codes thereto, a notice is to be served to the owner and operator detailing the violations. The owner and operator will be given a reasonable amount of time in which to remediate the violations found. 457 4. If it is found upon re-inspection that that the violations listed are not remediated within the time frame given, a fine of no less than $75.00 and not more than $750.00 per day the violations still exist and a request to the Village Administrator to suspend the license may be made. 5. No tenant is allowed to move into a unit or dwelling if any life safety violations have been found. 6. Rental inspection fees will be in accordance with the fee schedule set forth in Chapter 2.5, Article XII of this Code. 7. Rental inspection performed while tenants are in the dwelling will incur an extra cost as a fully furnished dwelling require extra steps for the inspection. 8. If a rental dwelling is found and the owner has not made the Village aware of the rental a fine of not less than $75.00 per day nor more than $750.00 per day shall be imposed until the proper application has been turned in to the Village. An inspection fee of double the amount of the original inspection fee will also be incurred. 9. If in the course of an inspection of an occupied dwelling an immediate threat to life safety of the occupants is found the dwelling will be required to be vacated immediately. The owner/property manager will be given a reasonable time frame in which to remediate the issue. 10. If there is a need for a reinspection for any violations that were found, an inspection fee will be charged for each reinspection. Payments must be made in full prior to the license being renewed, prior to the issuance of any occupancy certificate, or prior to the issuance or reinstatement of any residential rental license. 11. The owners and/or operators shall be responsible for informing their tenants of any scheduled inspection or re-inspection of any rental dwelling; and they shall be responsible for requesting permission from any person whose consent is necessary for the code enforcement officer to enter the property if that person is not home at the time of the inspection or re-inspection. The village shall provide notice to both the owner and/or operator and the tenant, on a form provided by the village, of the tenant's right to refuse consent to the occupancy permit inspection. If any tenant, occupant, or other person in control and/or possession and whose consent to inspect is necessary concerning a residential rental dwelling contained therein fails or refuses to consent to access and entry to the property or dwelling unit under his or her control for any residential licensing inspection required by this article, the code enforcement officer may apply to the circuit court for an administrative search warrant. The application for the administrative search warrant to determine whether there are any violations of the minimum standards of the village. Nothing 458 set forth herein shall limit the right of a tenant to grant the village access to the dwelling unit. (B) In addition to the inspections required by Section 2.5-520(A) above, the rental dwelling unit in question shall also undergo a fossil fueled equipment inspection prior to the issuance of an occupancy certificate, consistent with the following: 1. Prior to inspection the owner, agent or manager of residential rental units, who is responsible for renting or leasing the rental dwelling, shall have all fossil fueled equipment inspected by a qualified service person registered with the village in order to ensure safe operation of all appliances and appurtenances attached thereto. 2. A fossil fueled equipment inspection report shall not be required when the equipment has been inspected and approved less than 12 months prior to the inspection of the dwelling. 3. The owner, agent or manager of the dwelling shall submit documentation to the Code Enforcement Department certifying the fossil fueled equipment is in compliance, and a rental occupancy permit shall not be issued until such documentation is submitted. 4. If any areas have been found to be deficient, a qualified service person registered with the village shall repair the deficiency immediately or take such other action as is necessary to make the condition safe. When this is not possible, the device’s operation shall be terminated immediately. 2.5-521 Occupancy Certificate No owner or operator in charge of an existing rental dwelling shall rent a unit or allow any person to occupy the same as an occupant or lessees unless such person has been issued an occupancy certificate by the Code Enforcement Department certifying that the rental dwelling has been inspected and found to be in reasonable compliance with all of the provisions of the currently adopted International Property maintenance Code as well as any applicable Village Codes and Ordinances. Any change of occupancy shall require a new certificate. 2.5-522 Application for and Content of an Occupancy Permit The rental occupancy certificate must be completed and signed by the tenant or lessee before the date of occupancy. No rental occupancy certificate may be signed or issued without a residential rental license having been issued to the owner/landlord of the premises, and without an inspection of the premises having been satisfactorily completed in accordance with the requirements of this Chapter and Article. The rental occupancy certificate will remain confidential. The rental occupancy certificate may be completed at the Code Enforcement Department or completed in the presence of the owner or operator before the time of occupancy. A rental occupancy certificate 459 completed in the presence of the owner or operator must contain the signature of owner or operator following a certification that the application form was completed in his presence and contains true and accurate information regarding the tenants who will be occupying the rental dwelling. All rental occupancy certificates must be submitted to the Code Enforcement Department no later than seven days after completion. The rental occupancy certificate shall state the full names of all adult residents, relationships and the number of total people who will occupy the rental dwellings including minor children. It is unlawful for any person to knowingly make any false statement in his application for a rental occupancy certificate as to the names, relationships, or number of occupants of the rental dwelling. No more than one family, as defined in the village zoning ordinance, shall occupy a rental dwelling. All persons who occupy the premises of a dwelling, including persons who are added to the household following the initial occupancy of the rental dwelling, with the exception of minor children born to the family must be listed on the occupancy certificate. Each tenant or lessee shall adhere to the provisions of the International Property Maintenance Code in relation to occupant responsibility. 2.5-523 Multi Family Common Area Inspections The Code Enforcement Department shall perform yearly inspections of common areas of multi-family dwelling units for any life safety issues and to ensure compliance of all codes and ordinances that have been adopted by the Village. The inspection of common areas shall include but is not limited to, all hallways, stairways, lobbies, utility rooms, laundry rooms, storage rooms, recreation rooms, grounds, refuse areas, parking areas, building extensions, signs, and other areas designed for common use by rental dwelling occupants, or which are not subject to the right of exclusive possession of any particular dwelling occupant. 2.5-523.5 Prohibition of Retaliation It shall be a violation of the RRO for a landlord to terminate the lease agreement of a tenant or otherwise retaliate against any tenant because that tenant complained or otherwise notified the Village police department or code enforcement department about code violations and/or nuisance activities at the owner's premises where such termination violates the Retaliatory Eviction Act, 765 ILCS 720/.01. 2.5-524 to 2.5-530Reserved. 2.5-531 Criminal Nuisance Abatement and Crime Free Housing —Intent The intent of this ordinance is that landlords and the Village of Plainfield will abide by the Federal Fair Housing Act, the Illinois Human Rights Act, and the Illinois Civil Rights Act. The Crime Free Housing Ordinance is not intended to be in conflict of these acts. 460 The purpose of this ordinance is to have a program that utilizes a collaborative approach to responsible crime free living within occupied rentals. It is the goal of the Village to join with tenants and owners in the common goal of keeping drugs, illegal activity, and nuisance activity off rental properties to help maintain a safe environment and the high quality of living standards within the Village. Therefore, the Village of Plainfield is enacting a Crime free Housing Program for all within the Village, which will also include provisions for the definition and elimination of criminal nuisance rental properties. The provisions of this Code from Section 2.5-531 through and including Section 2.5-537 shall be referred to as the Crime Free Housing Ordinance or CFHO. 2.5-532 Crime Free Housing Seminar Any owner of property, which property is being rented out for residential purposes, shall attend, and complete a Village Crime Free Housing Program Seminar ("Seminar"). The owner or operator of a new rental unit shall attend the Seminar prior to obtaining or being issued a new Village Rental Dwelling License under the RRO. The agent or operator cannot for the purposes of the Seminar be the renter. The Code Enforcement Department and Police Crime Free Housing Liaison may maintain a list of other municipalities who offer similar Crime Free Housing Program Seminars. The Code Enforcement Department and Police Crime Free Housing Liaison may accept these Seminars as compliant with this Ordinance provided the training received elsewhere has occurred within twelve (12) months prior to acceptance, mirrors Plainfield’s Seminar, and meets the program copyright guidelines. Acceptance of other municipality’s Crime Free Housing Seminars will be at the discretion of the Code Enforcement Department and Police Crime Free Housing Liaison. A.An operator shall be considered an agent of the owner. If a new operator is hired and is replacing the previous operator who was the representative at the Seminar, the new operator shall have 90 days after proof of change to attend the Village's Crime Free Program Seminar ("Seminar"). B.Any owner or operator shall attend the Seminar once, and a refresher course after three (3) years and be compliant with this Ordinance prior to the expiration of a license for that particular year., or unless otherwise ordered by an administrative hearing. C.The Code Enforcement Department and the Police Crime Free Liaison shall maintain a list of owners and/or operators who have attended the Seminar, with the date of attendance and verification that the owner or operator has complied with the Ordinance and is eligible to obtain, maintain or renew the rental license. 461 2.5-533 Crime Free Lease Agreement Provisions; Additional Lease Requirements (A)Crime Free Lease Agreement Provisions. Owners or operators also must include the below language, or substantially similar language in an addendum to all residential property leases or rental agreements or the renewal of residential property leases or rental agreements. Such addendums to property leases and rental agreements must be signed and dated by all of the adult tenants occupying the rental property. Alternatively, the lease itself may contain substantially equivalent language. Owners or operators who utilize oral leases or no lease agreements must provide a notice to tenants that contains wording substantially similar to the below language. Owners or operators must keep a copy of the notice, signed and dated by the tenant, which acknowledges receipt of said notice and shall also tender a copy of a signed affidavit provided by the Village acknowledging that they have completed one of the above options for the Crime Free Lease Provision to the Village to the Code Enforcement Department as part of the licensing requirements. The below mandatory lease provisions shall be effective for any extension, renewal, or modification of the initial lease. Notice of Village of Plainfield Ordinances: The Village of Plainfield has adopted a Crime Free Housing Ordinance that prohibits criminal nuisance activity or near residential real properties leased to tenants, or on or near the common areas or appurtenances thereof, or on or near the public ways in reasonable proximity thereto. Violations of the Crime Free Housing Ordinance may result in the eviction of the tenant who committed, allowed, or facilitated the violation. Tenants and all persons who reside in the leased premises, by assuming possession of the same, agree that the owner or operator may release to the Code Enforcement Department and Police Crime Free Liaison any information concerning the identity of all occupants. In consideration of the execution or renewal of a lease of the rental unit identified in this lease, Owner (or Operator) and tenant agree as follows: 1.Tenant, any member of the tenant's household, a guest or invitee in the unit or on the common grounds, or any other person in the unit or on the common grounds invited there in any way by the tenant or a member of tenant's household, shall not engage or in any way be involved in, any criminal activity, including drug related criminal activity, on or near the said premises. “On or near the said premises” includes activity occurring on or near the common areas or appurtenances thereof, or on or near the public ways in reasonable proximity thereto. Criminal activity shall include, but is not limited to, drug-related criminal activity. "Drug-related criminal activity" means illegal manufacture, sale, distribution, use or possession with intent to 462 manufacture, sell, distribute or use of a controlled substance, cannabis, or methamphetamine in violation of applicable state or federal law. 2.Tenant, any member of the tenant's household, a guest, or invitee at the unit, on or near the said premises or on the common grounds, or any person in the unit or on the common grounds invited there in any way by the tenant or a member of the tenant's household shall not engage in any act intended to facilitate or that does facilitate criminal activity, including drug- related criminal activity, or on the said property. 3.Tenant, and every member of the household shall not permit the rental unit to be used for criminal activity, or to facilitate criminal activity, in the unit or on the common grounds, or on or near the said premises, including drug-related criminal activity, regardless of whether the individual engaging in such activities is a member of the household, a guest or invitee, and regardless of whether the tenant is present during any such offense. 4.Tenant, and members of the tenant's household, a guest, or invitee in the unit or on the common grounds or on or near the said premises, or any other person in the unit or on the common grounds invited there in any way by tenant or a member of tenant's household, shall not engage in the unlawful manufacturing, selling, using, storing, keeping or giving of a controlled substance, cannabis, or methamphetamine at any location on the property. 5.Tenant, any members of the tenant's household, a guest, or invitee in the unit or on the common grounds or on or near the said premises, or any other person in the unit or on the common grounds invited there in any way by the tenant or a member of the tenant's household, shall not engage in any illegal activity, including prostitution as defined in the Illinois Compiled Statutes, criminal street gang activity as defined in the Illinois Compiled Statutes, threatening or intimidating as prohibited in the Illinois Compiled Statutes, assault as prohibited in the Illinois Compiled Statutes, including but not limited to the unlawful discharge of firearms on or near the dwelling unit or common grounds, or any breach of the lease agreement that otherwise jeopardizes the health, safety and welfare of the landlord, his agent or other tenants or involving imminent or actual serious damage as defined in the Illinois Compiled Statutes. 6.Violation of any of the above provisions shall be a material and irreparable violation of the lease and good cause for termination of the tenancy, provided, however, a tenant shall not be retaliated against nor evicted when merely a victim of any criminal act prohibited herein, including domestic violence, but shall be responsible for the acts of his/her guests and household members. A single violation of any of the provisions hereof shall be deemed a serious violation and material noncompliance with the lease. It is understood and agreed that a single violation shall be good cause for immediate termination of the lease under the Illinois Compiled Statutes. 463 7.Notwithstanding the foregoing, no action of the tenant shall be a violation of the lease or grounds for termination of the tenancy where such action of the tenant is protected by the provisions of 65 ILCS 5/1-2-1.5(b). 8.Unless otherwise provided by law, proof of violation shall not require criminal conviction, but shall be by a preponderance of the evidence. Tenant consents to venue in any justice court precinct within the county wherein the unit is located in the event Owner initiates legal action against the tenant. Tenant hereby waives any objection to any venue chosen by Owner. 9.To the extent permitted by law, tenant agrees that service of process of any legal proceeding, including but not limited to, a special detainer or forcible detainer action, or service of any notice to tenant, shall be effective and sufficient for purposes of providing legal service and conferring personal jurisdiction upon any Illinois court as to any tenant, co-signor, occupant or guarantor, if served upon any occupant or other person of suitable age and discretion who is present at the premises and residing therein, notwithstanding the fact that a tenant, co-signor, occupant or guarantor may reside at a different location other than the property address described in the lease agreement. This agreement regarding service is in addition to, and not in lieu of, any manner of service authorized under Illinois law or rule. By signing this lease, the undersigned hereby waives any objection to service carried out under the terms of this agreement. (B) Additional Lease Requirements. All owners or operators shall incorporate into the body of all leases or rental agreements, or renewals of leases or rental agreements, the first and last names of all individuals who will reside at the subject property during the term of the lease. All such owners or operators shall also require their tenants, as a condition of their lease, to provide written notice containing the first and last names of any guests who will be temporarily residing at the subject property for more than thirty (30) consecutive days. Owners or operators shall provide, upon either oral or written request, copies of the information required to the Code Enforcement Department. Any such oral request shall be followed by a written confirmation of the oral request from the interested party to the Code Enforcement Department. 2.5-534 Nuisance Activity (A) Any residential rental unit or property on which nuisance activity occurs may be declared a nuisance property. No property shall be declared a nuisance property unless it is proven by a preponderance of the evidence that there have been three (3) or more instances of nuisance activity within six-month period of time arising out of or arising from the property. 464 (B) Any property on which aggravated nuisance activity occurs may be declared an aggravated nuisance property. No property shall be declared an aggravated nuisance property unless it is proven by a preponderance of the evidence that there has been one (1) or more instances of aggravated nuisance activity within a six-month period of time. (C) Any owner or operator who 1.encourages or permits a property to become a nuisance property. 2.allows a property to continue as a nuisance property; and 3.fails to implement reasonable and warranted measures, as specified by this ordinance, shall be in violation of this article. 4.Each day that a violation of this article continues shall be considered a separate and distinct offense. (D) Criminal nuisances shall exclude the following enumerated actions, pursuant to 65 ILCS 5/1- 2-1.5: 1.Contacts made to police or other emergency services: a)With intent to prevent or respond to domestic violence or sexual violence; or b)Where intervention or emergency assistance was needed to respond to or prevent domestic violence or sexual violence; or c)Contacts made by, on behalf of, or otherwise concerning an individual with a disability, for a purpose related to that individual's disability; or 2.An incident or incidents of actual or threatened domestic violence or sexual violence against a tenant, household member, or guest occurring within the Village; or 3.Public nuisances (which include criminal activity or a local ordinance violation as defined in 65 ILCS 5/1-2-1.5) occurring in the Village that is directly related to domestic violence, engaged in by a tenant, member of a tenant's household, guest or other party and against a tenant, household member, guest or other party. (E) Not excluded under the circumstances described above are violations of Section 15.2 of the Emergency Telephone System Act, 50 ILCS 750/15.2, Article 26 (Disorderly Conduct) of the Criminal Code of 2012, 720 ILCS 5/26-1 et seq., and Article IX (Forcible Entry and Detainer) of the Code of Civil Procedure, 735 ILCS 5/9-101 et seq.). 465 2.5-535 Nuisance Abatement and Enforcement Procedures When the Police Department receives one (1) or more documented occurrences of nuisance activities on a property, they will, independently review such reports to determine whether they describe the activities, behaviors or conduct enumerated under the violations. Upon such a finding the Police Liaison will do the following: (A)Notify Code Enforcement that the property is in danger of becoming a nuisance property. When the Code Enforcement Department sends such notice, the notice shall contain the following information: 1.The street address of the property or a legal description for identification of the property; 2.A statement that the Village of Plainfield has information that the property is in danger of becoming a nuisance property along with a concise description of the nuisance activities that exist or that have occurred. (B)When the Code Enforcement Department receives documentation of the occurrence of additional nuisance activity on the same property after notice has been given, The Code Enforcement Department, will do the following: 1.Notify the person in charge, in writing, that the property has been determined to be a nuisance property. The notice shall contain the following information: a.The street address of the property or a legal description sufficient for identification of the property. b.A statement that the matter is being brought before an administrative hearing officer, as defined in section of this Code, for a hearing on a date certain which is not sooner than ten (10) days from the date of the issuance of the notice. 2.If the owner or operator notifies the Code Enforcement Department immediately, upon receipt of the notice and agrees to abate the nuisance within ten (10) days, or take other agreed upon, timely, and warranted measures, The Code Enforcement Department may, at their discretion, and with notice to the owner or operator, postpone referring the matter to adjudication. 3.Service of notice shall be made either personally or by first-class mail, postage prepaid, addressed to the owner or operator at the address of the nuisance property, or such other place which is likely to give the owner or operator notice of the determination of the Code Enforcement Department. 466 4.A copy of the notice shall be served to the owner listed on the rental license, or mailed to the last known address of the owner of the rental dwelling as recorded on the most recent tax assessment of the county in which the property is located, and/or the occupant at the address of the property, if these persons are different than the owner or operator, and shall be made either personally or by first-class mail, postage prepaid. 5.The failure of any person to receive notice, as provided above, shall not invalidate, or otherwise affect the proceedings under this chapter. 2.5-536 Nuisance Administrative Hearing (A)At the hearing before the administrative hearing officer, the Village shall have the initial burden of proof to show, by a preponderance of evidence that the property is a nuisance property. (B)If a property owner is summoned before the hearing officer due to nuisance property, he shall give notice, in writing, to at least one of his tenant(s) on that property. Said notice shall provide the following: The physical address of the property; the date and time that the property owner is to appear before the hearing officer; the fact that the appearance is due to alleged nuisance activity; and the possible sanctions that may be imposed upon the property owner. The notice shall be delivered, either personally or by U.S. mail. (C)Such a hearing shall be held in accordance with the procedures as specified in Chapter 2 of this this Code. The Village's representative shall present evidence in support of its claim that the property is a nuisance property. The owner or operator shall be permitted to rebut such evidence and present any other evidence that is, in the discretion of the hearing officer, relevant and reliable. (D)At the conclusion of the hearing, the hearing officer shall make a determination on the basis of the evidence presented at the hearing, whether or not a violation of this ordinance exists. The determination shall be in writing and shall be designated as the findings, decisions, and order. The hearing officer's decision shall be final and binding, except that the administrative review law, as specified in section of this Ordinance, shall be applicable. The findings, decision and order shall include the hearing officer's findings of fact, a decision whether or not a violation of this code exists based upon the finding of fact, and an order for abatement of the nuisance activity or sanctioning the owner/operator/occupant, as specified in subsection (a) below, or dismissing the case in the event a violation is not proven. 467 1.A copy of the findings, decision, and order shall be served upon the owner /occupant if different than the operator, within ten (10) business days. Service shall be in the same manner as specified in procedure for notice of violation. 2.Payment of any penalty or fine shall be made to the Village finance department within thirty (30) calendar days of the service of the findings, decision and order. 3.In the event that the order provides for the abatement of nuisance activity, the hearing officer shall establish a status date, which would be after the date established for the abatement of the nuisance activity, in order to determine whether there has been compliance with the order. At such time, the hearing officer shall hear testimony and accept any evidence relevant to the compliance with the order and continued abatement of the nuisance activity. 4.If the hearing officer makes a finding that a property was, or is, a nuisance property, he may impose any or all of the following remedies: a.Fine the owner /occupant of the property if those persons are different than the operator, not more than $750 for each violation of this section. Each day a nuisance activity occurs or continues shall be considered a separate and distinct violation. The hearing officer may, at his discretion, impose such a fine for each day the nuisance activity goes unabated. No person shall be found in violation of this section unless the Village proves by a preponderance of the evidence that the owner/operator/occupant failed to take reasonable and warranted measures to abate the nuisance activity. In establishing the amount of any fine, the hearing officer may consider any of the following factors: i)The actions taken by the owner/operator/occupant to mitigate or correct the nuisance activities at the property. ii)The repeated or continuous nature of the problem. iii)The magnitude or gravity of the problem. iv)How cooperative the owner/operator/occupant is with the Village. v)The cost to the Village of investigating, correcting, or attempting to correct the nuisance activities. vi)Any other aggravating or mitigating factor deemed relevant by the hearing officer. Evidence of a property's general reputation and/or the reputation of the persons in or frequenting it shall be admissible. 468 b.Order the owner/operator/occupant to take reasonable, timely and lawful measures to abate the nuisance activity, including specifying deadlines for the same, and in furtherance thereof, may order a period of continued compliance wherein the matter will be returned before the hearing officer to update him/her as to the continued nuisance-free status of the property for a period of up to one (1) year. c.Suspend/revoke the rental license for the rental dwelling(s) involved in the nuisance or aggravated nuisance activity if such property is rented or leased. The hearing officer may order that said rental dwelling(s) be closed and secured against all unauthorized access, use, and occupancy for a period of no less than one (1) year. If the hearing officer suspends or revokes the rental license for the rental dwelling(s) involved in the nuisance activity, the owner /occupant of the rental dwelling(s) if those persons are different than the operator, shall receive written notice from the Village Administrator that the license to operate said rental property or the right to lease said unit(s) is suspended or revoked, as the case may be. The suspension or revocation of any license, or any right to lease unit(s), shall not release or discharge the license holder from paying fees or fines under this Code, nor shall such license holder be released from criminal prosecution or further civil proceedings. d.Order that a vacant or unused nuisance property of whatever use or a vacant lot which is a nuisance property, whether residential or commercial, be closed and secured against all unauthorized access, use, and occupancy. The hearing officer may order that the property be closed and secured against all unauthorized access, use, and occupancy for a period of up to one (1) year. The hearing officer may further require that the nuisance property be fenced and/or gated to physically restrict access. He may also require the hiring of security personnel to assure there is no unauthorized access, use, and occupancy. e.Issue an order to close and secure any rented or leased, non-licensed, residential property against all unauthorized access, use, or occupancy for a period of not less than sixty (60) days, nor more than one (1) year. f.If the landlord receives two (2) or more violations within an eighteen (18) month period, for separate incidents stemming from separate rental agreements from the same unit, that require the landlord to abate the nuisance, the license can be suspended indefinitely, or revoked in a proceeding brought for such purpose before the Hearing Officer. The eighteen (18) month period begins from the date of the first violation issued to the landlord. 469 g.The hearing officer may require each landlord who is found to have violated this article to attend the next available crime-free training class as administered by the Village of Plainfield or any other entity designated by the Village. h.Upon determining that a property at issue is a nuisance property, the hearing officer may also allow the Village to present evidence of costs incurred by the Village to pursue nuisance abatement and enforcement against the nuisance property, and order the landlord or property owner to pay such costs to the Village as restitution to the Village. i.If the owner or operator of any occupied residential dwelling unit found to be a nuisance property by the Hearing Officer decides to abate the nuisance by eviction, the owner or operator must notify the tenant prior to the initiation of any eviction proceedings that the tenant may request, within 15 business days of receiving notice, an administrative hearing to be conducted of the Village’s decision to enforce the Ordinance and may present any additional evidence to the Hearing Officer at that time. 2.5-537 Enforcement Exemption Notwithstanding anything to the contrary in this ordinance, the Village shall not enforce the Crime Free Housing Ordinance (including the nuisance provisions thereof) based on the following actions: a.Contact made to police or other emergency services, i.if the contact was made with the intent to prevent or respond to domestic violence or sexual violence; ii.the intervention or emergency assistance was needed to respond to or prevent domestic violence or sexual violence; or iii.the contact was made by, on behalf of, or otherwise concerns an individual with a disability and the purpose of the contact was related to that individual's disability; 1.an incident or incidents of actual or threatened domestic violence or sexual violence against a tenant, household member, or guest occurring in the dwelling unit or on the premises; or 2.criminal activity or a Village ordinance violation occurring in the dwelling unit or on the premises that is directly relating to domestic violence or sexual violence, engaged in by a tenant, member of a tenant's household, guest, or other party, and against a tenant, household member, guest, or other party. 470 b.However, nothing with respect to this Section: i.Limits enforcement of Section 15.2 of the Illinois Emergency Telephone System Act, Article 26 of the Criminal Code of 2012, or Article IX of the Code of Civil Procedure; ii.Prohibits the Village from enacting or enforcing its crime free housing program and ordinance to impose penalties on the basis of the underlying criminal activity or Village ordinance violation not covered by Section (h) subsections (1), (2), and (3) and to the extent otherwise permitted by existing State and federal law; or iii.Limits or prohibits the eviction of or imposition of penalties against the perpetrator of the domestic violence, sexual violence, or other criminal activity. 2.5-538 to 2.5-540 Reserved 2.5-541 Vacant Building Registration Vacant buildings can become an attractive nuisance within a neighborhood as they can become dilapidated, unsecure, and neglected. This can cause property values within the neighborhood and the community to go down and can also have a negative impact on the social perception of that area. Absentee owners make it difficult for the Village to be proactive on property maintenance matters. Therefore, all owners of vacant buildings within the Village shall register the same in accordance with this Vacant Building Registration Ordinance or VBRO within 10 days of any building, structure, unit, or dwelling becoming vacant, regardless of whether the same is used for residential, commercial, industrial or other purposes. (A)All vacant building owners are required to provide the name, address, and home and business telephone numbers of the owner of the property and appropriate corporate or partnership information, including the name of the registered agent, president, manager or managing partner, as well as the name, address, and phone number of the property manager or management company, and local agent representing the owner. (B)A property manager shall be designated by the vacant building owner to perform the work necessary to bring the vacant building into compliance with the applicable codes and ordinances of the Village, and the property manager information must be on file with the Village Code Enforcement Department and Police Department with a name and a 24-hour contact telephone number. (C)If the vacant building is sold or transferred, the new owner is subject to all the terms of this article. Within ten days of the transfer, the new owner shall register the vacant building or update the existing registration. The previous owners will not be released 471 from the responsibility of paying all previous unpaid fees, fines, and penalties accrued during that owner's involvement with the vacant building by reason of the transfer. (D)Failure of the owner to properly register or to modify the registration to reflect a change of circumstances as required by this article is a violation of this article and shall be subject to enforcement by any of the enforcement means available to the village. (E)If any vacant building is in violation of the ordinances of the Village and the owner will not remediate or abate the violations, the village may take the necessary action to abate the violations and place a lien on the property for the cost incurred to bring the property into compliance. The lien shall be substantially in the form contemplated by Section 2.5-206 of this Code. (F)If the vacant building is found to not be registered in a timely manner, the owner, property manager, or operator shall be subject to a fine of not less than seventy- five dollars ($75.00) or more than seven hundred fifty dollars ($750.00)for each day the property is not registered until registration occurs. (G)All vacant buildings shall adhere to all applicable code requirements which include but are not limited to the Village of Plainfield Code, the International Building Code, the NFPA 70 Electric Code, the Illinois Plumbing Code, the International Mechanical Code, the International Fire Code, the International Residential Code, the International Property Maintenance Code, the International Fuel Gas Code, the International Energy Conservation Code, the Swimming Pool and Spa Code, latest adopted editions and any amendments to such codes. (H)Vacant buildings requiring boarding up to prevent unauthorized entry may not remain boarded up and in an unrepaired condition for longer than six months without the approval of the Village Building Department. 2.5-542 Commercial Property Registration (A)It is unlawful for any owner, manager, or agent thereof to knowingly permit the occupation of any leased or rented commercial property for any purpose until the same has been registered with the Village. The registry shall be maintained by the Village Code Enforcement Department. (B)This registry requirement shall not apply to: 1.Hotels and motels. 472 2.Nursing homes, retirement centers, rest homes, assisted living facilities or hospices licensed, inspected and governed by state or federal laws, rules or regulations. 3.Group homes governed by 405 Illinois Compiled Statutes 35/1 et seq., as amended, Specialized Living Centers Act, dealing with the developmentally disabled, or other similar uses governed by state or federal laws, rules, or regulations. (C)Each owner of a commercial property shall file a written registration with the village and shall submit the following information the form provided by the village. 1.Name, address, and home and business telephone numbers of the owner of the property, appropriate corporate or partnership information, including the name of the registered agent, president, manager or managing partner. The name, address, and phone number of the property manager or management company, and local agent representing the owner. 2.All commercial properties are required to have an operator. The operator shall be reasonably accessible to the village and have a telephone number, address (No P.O. Box or bank trust addresses ), and email address which shall be available to the village at any time. For the purposes of violations of municipal ordinances or emergencies. 3.In the event any of the information requested should change, it shall be the obligation of the owner to notify the village in writing within ten days of the change. This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as required by law. This Ordinance shall be numbered as Ordinance No. ______. PASSED THIS _____DAY OF ______2024. AYES: NAYS: ABSENT: 473 APPROVED THIS _____DAY OF _____ 2024. VILLAGE PRESIDENT ATTEST: VILLAGE CLERK 474 VILLAGE OF PLAINFIELD ORDINANCE NO. _____ AN ORDINANCE AMENDING CHAPTER 2.5, ARTICLE XII - FEES OF THE CODE OF ORDINANCES OF THE VILLAGE OF PLAINFIELD AN ORDINANCE AMENDING CHAPTER 2.5, ARTICLE XII – FEES TO ENACT SECTION 2.5 – 504 – RENTAL REGULATION FEES ADOPTED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD THIS ____ DAY OF _____ 2024. Published in pamphlet form by the authority of the President and Board of Trustees of the Village of Plainfield, Will and Kendall Counties, Illinois this ____ day of _____ 2024. 475 ORDINANCE NO. _____ AN ORDINANCE AMENDING CHAPTER 2.5, ARTICLE XII – FEES TO ENACT SECTION 2.5 – 504 – RENTAL REGULATION FEES NOW, THEREFORE, BE IT ORDAINED BY THE PRESIDENT AND BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL AND KENDALL COUNTIES, ILLINOIS AS FOLLOWS: I.That Chapter 2.5, Article XII is hereby enacted with the following: Section 2.5-504—Rental Regulation fees License Fee per Building 1-4 buildings- $100.00 5-9 buildings - $150.00 10-24 buildings- $300.00 25 or more buildings- $500.00 Inspection Fees per Unit First inspection - $100.00 Reinspection - $50.00 Additional reinspection will double with each occurrence. This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as required by law. This Ordinance shall be numbered as Ordinance No. ______. PASSED THIS _____DAY OF ______2024. AYES: NAYS: ABSENT: APPROVED THIS _____DAY OF _____ 2024. VILLAGE PRESIDENT ATTEST: VILLAGE CLERK 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 MEMORANDUM To: Scott Threewitt, Director of Public Works From: Arlan Schattke, Lead Engineer Date: February 28, 2024 Re: FY24 and FY25 Pavement Patching Program Contract Award Background Findings The item under consideration by the Village Board pertains to the FY24 and FY25 Pavement Patching Program. The request for bids was publicly advertised on February 13, 2024, within the Herald News, and on February 27, 2024 the Village received seven (7) bids for the FY24 and FY25 Pavement Patching Program. The work consists of asphalt pavement patches at various locations throughout the Village as previously determined by staff. The Engineer’s Estimate for this work is $273,400.00. Detailed bid tabulation for all bidders is attached. Policy Considerations The project supports the Village’s Transportation Plan by maintaining the Village’s roadway network condition through efficient maintenance activities. The areas selected for this program are best suited for isolated pavement patches as opposed to curb-to-curb resurfacing. According to Section 2-76(d)(5) of the Village Code of Ordinances, the Village Administrator shall make a recommendation to the President and Board of Trustees on purchases over the $10,000 statutory limit. The Board has the right to accept or reject any or all proposals. Financial Considerations A line item for Pavement Patching is included in the budget within the Capital Improvement Fund, 11-00-91-9164. This contract will utilize standard IDOT procedures for bonding, insurance requirements, and material specifications. In addition, this contract includes work to be completed in the 2023-2024 fiscal year, before April 30, 2024, and work to be completed in the 2024-2025 fiscal year, after May 1, 2024. Recommendation Staff has reviewed and verified the bids and recommends the award of the project to the low qualified bidder, Schroeder Asphalt Services, Inc. Shroeder Asphalt Services, Inc. is pre-qualified through IDOT for the work required as part of this contract and has met the bid proposal requirements. Shroeder Asphalt Services, Inc. has completed the Village’s Pavement Patching Program in past years and their work has been of good quality. It is our recommendation that the Village Board authorize the Village President to award the FY24 and FY25 Pavement Patching Program to Shroeder Asphalt Services, Inc., the low qualified bidder, in an amount of $222,500.00, plus a $20,000.00 contingency, for a total contract amount not to exceed $242,500.00. 491 FY24 AND FY25 Pavement Patching Program (#8968609)Owner: Plainfield IL, Village ofSolicitor: Plainfield IL, Village of02/27/2024 10:00 AM CSTItem CodeItem DescriptionUofMQuantityUnit PriceExtensionUnit PriceExtensionUnit PriceExtensionUnit PriceExtensionUnit PriceExtensionUnit PriceExtensionUnit PriceExtensionUnit PriceExtension1HMA SURFACE REMOVAL AND REPLACEMENT - 2 INCH (ROADWAY)Sq Yd9200$27.00$248,400.00$22.50$207,000.00$23.50$216,200.00$23.00$211,600.00$30.00$276,000.00$39.00$358,800.00$41.50$381,800.00$46.00$423,200.002CLASS D PATCHES, 3 INCHES (BIKE PATHS)Sq Yd500$50.00$25,000.00$31.00$15,500.00$37.00$18,500.00$50.00$25,000.00$41.00$20,500.00$78.00$39,000.00$50.00$25,000.00$63.00$31,500.00Base Bid Total: $273,400.00 $222,500.00 $234,700.00 $236,600.00 $296,500.00 $397,800.00 $406,800.00 $454,700.00Austin Tyler Const. , IncEngineer EstimateLOW BIDSchroeder Asphalt Services, Inc.P.T. Ferro Construction Co. D. Construction, Inc.MANEVAL CONSTRUCTIONGallagher Asphalt CorporationBrothers Asphalt Paving, Inc.492 MEMORANDUM To: Scott Threewitt, Director of Public Works From: Tony Torres, Street Superintendent Date: February 28, 2024 Re: 2024 Ford Explorer XLT 4WD SUV Background Findings Due to a recent hire within the Building Department, an additional vehicle is necessary to support their staffing growth. A Public Works vehicle that was previously scheduled to go to auction is currently being utilized by the Building Department. After the Building Department has coordinated their vehicle requirements with Fleet Maintenance, a 2024 Ford Explorer XLT 4WD SUV with minimal equipment and maximum safety is recommended to satisfy their needs and provide a versatile unit to the fleet. Policy Considerations This SUV falls under the State Bid Purchasing program. According to Section 2-76(d)(5) of the Village Code of Ordinances, the Village Administrator shall make a recommendation to the President and Board of Trustees on purchases over the $10,000 statutory limit. The Board has the right to accept or reject any or all proposals. Financial Considerations A line item for Machinery and Equipment (11-00-91-9120.008) is included in the 2024 fiscal year budget within the Capital Improvement Fund. Recommendation Staff recommends that the Village Board direct the President to authorize the purchase of one 2024 Ford Explorer XLT 4WD SUV from Ron Tirapelli Ford at a total cost not to exceed $43,206.03. 493 02/26/2024 Fuel Economy and Environment SmartphoneQR Code™fueleconomy.gov Calculate personalized estimates and compare vehicles Annual fuel cost Fuel Economy & Greenhouse Gas Rating (tailpipe only)Smog Rating (tailpipe only) Yo u over 5 years compared to the average new vehicle. 23 20 27 4.3 Standard SUVs range from 13 to 102 MPG. The best vehicle rates 140 MPGe.$2,000 $2,350 2 B^^^BjmZab MvG<B^^^B 37:9+@F@t&R7rcdR2' *6 bDVczVWB * *A/yLXq8R(>FPyA @!///!@w6gO )oe *~hOrG AAAAAAAAAAAAAAAAAAA This vehicle emits387 grams CO per mile. The best emits 0 grams per mile (tailpipe only). Producing and distributing fuel also create emissions; learn more at fueleconomy.gov. Actual results will vary for many reasons, including driving conditions and how you drive and maintain your vehicle. The average new vehicle gets 28 MPG and costs $9,750 to fuel over 5 years. Cost estimates are based on 15,000 miles per year at $3.60 per gallon. MPGe is miles per gasoline gallon equivalent. Vehicle emissions are a significant cause of climate change and smog. Fuel Economy combined city/hwy MPG city highway gallons per 100 miles spend more in fuel costs ĀÂÞÞÞÂĀêÅ°ÐòÛاàÂÏáÔĀÂÞÞÞÂĀ ¦¯¦¥«¢à¨è¹äáÇչר¯ýÁ½À¸¹ ñ±ìð§¼Ö°¾êÌûÇÚ¥ßÄÁõüºü¿¶ Ìû¬é¡»ÏÈòÇ°ü§éè ùÛÙÀíªî ý õõõ ýµù± ½ÑñýÙåµýÙùÁÙÑÉÅáé SCAN OR TEXT TO1FRGA40436 48028 Msg & Data rates may apply. Text HELP for help www.ford.com/help/privacy-terms/ 1FMSK8DH2RGA40436 ĬēĂĐėĝĕĉĎĒăĜđċąāąĄćĬ CHI-008801 IL 9-NORMAL,NB,108801,RB061 2109 120240216BLEND 4731 UTC U W IL CERT CERT CERT TRD RAMP BUMP CAMP BOOK EXFL ROTA 1FMSK8DH2 RGA40436 NB GU13 VEHICLE DESCRIPTION EXPLORER RG A40436 2024 EXPLORER XLT 4WD EXTERIOR 119" WHEELBASE STAR WHITE MET TRI-COAT 2.3L ECOBOOST I-4 ENGINE INTERIOR 10-SPEED AUTO TRANSMISSION EBONY UNIQUE CLOTH SEATS 1202402164731 ƬōƈĻŰľƥŚƦĴƂŐƦņƒţƚœŸœżļŽŗŮŗƬőľƬŎŹŖıŮƝijƁŵŀŖŮşŃƑōźľƕŌłƂƬŘƟƥŹƎŽƓŮłŋžƩƓŦƌƬōƙĿİŢƄŐŐŗƩĹŹƉřőıũĹšıƩƁƑƁƩıƩƉšıőřƑƑƁ021746 1670/2185 TOTAL MSRPRon Tirapelli Ford, Inc. 4355 W Jefferson St Shorewood IL 60404 41D 432 CC06 SOLD TO RAMP ONE SHIP TO (IF OTHER THAN SOLD TO)RAMP TWO SHIP THROUGH $42,640.00 FINAL ASSEMBLY PLANT CHICAGO METHOD OF TRANSP. CONVOY ITEM #: 41-4512 O/T 2 RB061 N RB 2X 425 008801 02 06 24 INCLUDED ON THIS VEHICLE EQUIPMENT GROUP 200A OPTIONAL EQUIPMENT/OTHER 2024 MODEL YEAR STAR WHITE MET TRI-COAT 795.00 .18" 5-SPOKE PAINTED ALUM WHLS .P255/65R18 A/S BSW TIRES 4WD REGIONAL DISCOUNT NO CHARGE 50 STATE EMISSIONS NO CHARGE 4G LTE WI-FI HOTSPOT CREDIT - 20.00 REAR AUXILIARY CNTRLS CREDIT - 100.00 FRONT LICENSE PLATE BRACKET NO CHARGE PRICE INFORMATION BASE PRICE $40,670.00 TOTAL OPTIONS/OTHER 675.00____________ TOTAL VEHICLE & OPTIONS/OTHER 41,345.00 DESTINATION & DELIVERY 1,595.00____________ TOTAL BEFORE DISCOUNTS 42,940.00 4WD REGIONAL DISCOUNT - 300.00 TOTAL SAVINGS - 300.00 RESIDENCY RESTRICTIONS APPLY TO DISCOUNTS/SAVINGS - BASED ON CUSTOMER ZIP CODE. SEE DEALER FOR DETAILS. (MSRP)(MSRP) STANDARD EQUIPMENT INCLUDED AT NO EXTRA CHARGE EXTERIOR DOOR HANDLES - BODY COLOR EASY FUEL® CAPLESS FILLER HEADLAMPS - AUTO LED LED SIGNATURE LIGHTING MIRRORS-MAN-FOLD DUAL PWR HEATED WITH APPROACH LAMPS POWER LIFTGATE PRIVACY GLASS - REAR DOORS REAR INT WIPER/WASH/DFRST REAR SPOILER, BODY COLOR ROOF-RACK SIDE RAILS-BLACK TAILLAMPS-LED TRAILER SWAY CONTROL VARIABLE INTERVAL WIPERS INTERIOR 1TOUCH UP/DOWN DR/PASS WIN 3RD ROW - 50/50 FOLD FLAT DUAL ILLUM VIS VANITY MIRR HEATED CLOTH FRONT SEATS IP CLUSTER 6.5" LCD SCREEN LEATHER WRAPPED STR WHEEL POWER DRIVER SEAT - 10 WAY POWER PASS SEAT - 4-WAY POWERPOINTS - 12V ROTARY GEAR SHIFT DIAL TILT/TELESCOPING STEERING W/WHEEL MOUNTED CONTROLS TRI-ZONE ELECTRNC TMP CTRL USB A(1) AND C(1)-1ST ROW FUNCTIONAL 4-DR INTELL ACCESS LOCK/ UNLOCK W/PUSH-BUTTON START AM/FM/MP3, 6 SPEAKERS BRAKES, 4-WHEEL DISC/ABS FORD CO-PILOT360™ FORDPASS™ CONNECT HILL START ASSIST REAR PARKING SENSORS REAR VIEW CAMERA REFRESH95 SIDE-WIND STABILIZATION SIRIUSXM® - SVC N/A AK&HI SYNC®3 8" SCRN W/APPLINK® SAFETY/SECURITY ADVANCETRAC™ WITH RSC® AIRBAG-DRIVER/PASS KNEE AIRBAGS - DUAL STAGE FRONT AIRBAGS - FRONT SEAT MOUNTED SIDE IMPACT AIRBAGS - SAFETY CANOPY® INDIV TIRE PRESS MONIT SYS LATCH CHILD SAFETY SYSTEM PERIMETER ALARM PERSONAL SAFETY SYSTEM™ SOS POST-CRASH ALERT SYS™ WARRANTY 3YR/36,000 BUMPER / BUMPER 5YR/60,000 POWERTRAIN 5YR/60,000 ROADSIDE ASSIST 494 Ron Tirapelli Ford 4355 W Jefferson St Shorewood, IL 60404 P: (815) 725-3033 F: (815) 725-5731 rontirapelliford.com Date Printed: Sold To:ID:Ship To: Village of Plainfield 14400 S. Coil Plus drive Plainfield, IL 60544 P.O.#A/R Cust #Sales Person Cust Type Date Invoice # Payment Distributions Account Description Amount STOCK #Payment Description Sub-Total Sales Tax Special Tax HazMat Charge Freight Misc Chrg/ Disc Freight Charge Notes:Total Payment Method 2/26/2023 Joey Madia 815-230-2038 Phone:Phone: Phone: 2024 EXPLORER 2470172/26FLTJoeyVoP 1FMSL8DH2RGA40436 43,206.03 x -$ 43,206.03$ CHECK Payment Terms: Check to be presented with in 10 days after delivery of vehicles. Any issue's are to be forwarded to the sales person as soon as possible to avoid late charges on payment. Thank You ! Distribution:-$ Customer Type:Government -$ 43,206.03$ -$ -$ -$ Customer Signature: 495 MEMORANDUM To: Scott Threewitt, Director of Public Works From: Randall Jessen, Superintendent of Public Improvements Date: February 28, 2024 Re: Village Facilities-ComEd Energy Efficiency Report and LED Conversions Background Findings The item under consideration by the Village Board relates to the conversion of existing facility lighting fixtures over to high efficiency LED fixtures on various properties. Through ComEd’s External Affairs Manager, staff contacted ComEd to perform an energy audit of the properties to see what energy savings could be achieved. This task was occurring at the same time our consultant was performing the Facility Condition Index (FCI), which is close to being in draft form. This particular scope of work is also identified in the FCI study. Additionally, the Village submitted and was awarded an Energy Efficiency and Conservation Block Grant (EECBG) in the amount of $76,500.00, which this work is eligible for. ComEd sent their preferred contractor, Green Sky Consulting, out to meet with David Doty, Facility Maintenance Crew Leader. Together they inspected the properties and reviewed the original construction drawings and specifications to develop the LED conversion project. Scheduling and logistics were also worked out during this process. The resulting reports include all the information obtained from their efforts. Attached is a spreadsheet summarizing the different sites. Between the ComEd incentives and bonuses and the EECBG contribution, the net investment by the Village is $0.00. The benefits will be as follows: the net reduction in energy usage will go down 578,891 kWh/year and the annual electric cost will go down $46,311.00/year. The environmental impact will result in an annual reduction of 282 metric tons of carbon dioxide being released into the air, which is the equivalent of removing 61 cars from the road. Another benefit to the Village is that the new lights will have warranties which will in turn reduce future maintenance. Staff currently has a difficult time sourcing in-kind replacements as the older technology lighting is no longer supported by manufacturers. The individual reports show two locations that would have a potential payback period. That analysis would be if each location was done as a standalone effort. By combining them at the same time, the payback period is eliminated, and the Village will see an immediate reduction in our electric bills going forward. Policy Considerations Per previous direction from the Village Board, staff has coordinated with ComEd to perform the Energy Audit for the public buildings. According to Section 2-76(d)(5) of the Village Code of Ordinances, the Village Administrator shall make a recommendation to the President and Board of Trustees on purchases over the $10,000 statutory limit. Financial Considerations Funding for the LED retrofit project has been budgeted in the Capital Improvement Fund/Building Improvements line item, 11-00-91-9105. Combining the ComEd incentives and bonuses and the EECBG contribution will result in zero cost to the Village. The EECBG is a reimbursable voucher program. The Village will pay a portion up front and then submit for reimbursement. Recommendation Staff recommends that the Village Board authorize the Village President to sign the individual agreements (Village Hall, Law Enforcement Center, Public Works, Wastewater Treatment Plant, and Well Houses) with Green Sky Consulting for the LED lighting conversion project. 496 LocationCurrent Use Post Use Savings Cost of Retrofit ComEd Incentives ComEd Bonus Total Incentives Net Cost Estimated Cost Savings CO2 Reduction Car Equivalent(kWh/yr.) (kWh/yr.) (kWh/yr.) (Annual) (Years) (Metric Tons) (Annual)Village Hall200,000 142,116 57,884 $91,358.00$24,249.60$3,637.44$27,887.04$63,470.96$4,630.7413.70286Law Enforcement2,200,000 1,879,356 320,644 $110,070.80$100,070.80$10,000.00$110,070.80$0.00$25,651.50-15634Public Works150,000 46,078 103,922 $46,865.00$41,148.30$6,172.25$47,320.55($455.55)$8,313.75-5111Wastewater Facility400,000 321,815 78,185 $58,600.00$40,061.70$6,009.26$46,070.96$12,529.04$6,254.822.00388Well Houses120,000 101,744 18,256 $17,430.55$15,157.00$2,273.55$17,430.55$0.00$1,460.51-92TOTAL3,070,000 2,491,109 578,891 $324,324.35$220,687.40$28,092.50$248,779.90$75,544.45$46,311.32-28261 Environmental ImpactEnergy UseCostsComEd Energy Efficiency Report - SummaryEstimated Payback497 Assessment Report Dave Doty • Plainfield Village Hall 24401 Lockport Street, Plainfield, IL 60544-2313 Wednesday, January 17, 2024 Annual Energy Usage Benefit The figures below represent your current energy use and where you'll end up after installing the recommended improvements. Current Energy Usage 200,000 kWh/yr After Installing Your Selected Improvements 142,116 kWh/yr Financial Benefit ComEd provides instant incentives to reduce your upfront project costs. The table below shows your project costs before and after your instant incentives. Cost of Selected Improvements $91,358.00 Total Instant Incentives from ComEd*- $24,249.60 Bonuses from ComEd - $3,637.44 Project Cost Due to Your Service Provider $63,470.96 *All incentives are subject to change and must be reserved to be guaranteed Benefits Overview Total Incentives $27,887.04 Estimated Payback Period After Incentives 13.7 years Estimated Annual Cost Savings $4,630.74 Estimated savings based on average retail price of $0.08 per kWh and $0.70 per therm for commercial customers. † † Environmental Impact‡ Your project can result in an annual reduction of 28 metric tons of CO That's the equivalent of taking 6 cars off the road annually! Estimated CO reduction assumes 4.872 * 10 metric tons CO e not emitted per kWh reduced. Estimated car removal assumes 1 vehicle removed from service reduces the same amount of CO e as reducing electricity production by 9444 kWh / year 2 ‡2 -4 2 2 Let's Explore Small Business Assistance Program DX Tune-Up Small Business and Multi- Family Loan Program Networked Lighting Controls Distributed Generation Rebates (Solar) Prepared By Green Sky Consulting Scott Baloun 815-355-5651 sbaloun@greenskyconsulting.net Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 1 498 Applicant Information You acknowledged that pursuant to Section 16-128B of the Illinois Public Utilities Act, ComEd cannot issue certain incentives or rebates unless it is provided with: Customer Information Company name: Plainfield Village Hall Contact name: Dave Doty Title: Facilities Manager Address: 24401 Lockport Street, Plainfield IL, 60544 - 2313 Mailing address: Same as facility address Telephone: 815-671-2353 Email: ddoty@goplainfield.com ComEd account number: XXXXX67890 Name as it appears on electric bill: placeholder Service Provider Information Contracting company name: Green Sky Consulting Contact name: Scott Baloun Title: Owner Telephone: 815-355-5651 Email: sbaloun@greenskyconsulting.net Address: 1142 Dovercliff Way, Crystal Lake IL, 60014 Illinois Commerce Commission Certification 1. Certification that the measure was self-installed by the ComEd customer, or 2. Evidence that the measure was installed by an installer certified by the Illinois Commerce Commission Reminder: All removed equipment must be recycled to ensure inefficient equipment is removed from the market. You may qualify for more incentives from the ComEd Energy Efficiency Program. If so, we may contact you. For more information, visit ComEd.com/BizIncentives. You can also reach us by phone at 855-433-2700 or email us at BusinessEE@ComEd.com. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 2 499 Program Offering Agreement Work with your Service Provider to review this customized project plan. These improvements were identified during your free energy assessment. Receive an instant incentive on these improvements by completing the application, signing the program agreement and scheduling installation with your Service Provider. Your project will be installed by your Service Provider and you will only pay the balance after the incentives are applied. Program Agreement for: Plainfield Village Hall Service Provider company: Green Sky Consulting Valid: November 10, 2023 - September 30, 2024 Representative: Scott Baloun ** Must Include L&B Retrofit Energy-Saving Improvements Selected for Installation Improvement Type Yearly Energy Cost Savings Quantity Total Cost TLED (Type C)$953.86 92 $9,200.00 LED Fixtures - T8/T5 to LED $3,202.16 261 $45,675.00 LED Fixtures - T8/T5 to LED $404.87 33 $5,775.00 Networked Lighting Controls $69.85 33 $4,290.00 Additional Costs Selected for Installation Cost Type Yearly Energy Cost Savings Quantity Total Cost Other N/A 1 $26,418.00 Energy-Saving Improvements Cost $64,940.00 Additional Costs $26,418.00 Instant Incentives*- $24,249.60 Bonuses from ComEd - $3,637.44 Final Cost Payable To Service Provider $63,470.96 *Projects must be approved and incentives reserved before any work begins. If the program does not approve the project, the customer is not required to proceed with the project. Incentives stated in this report are valid for 30 days from date of assessment. If you choose to pursue identified energy-saving improvements after 30 days, please contact the program for a revised list of eligible improvements and pricing. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 3 500 Terms and Conditions Commonwealth Edison Company (“ComEd”) is offering the ComEd Energy Efficiency Program (“Program”) to eligible customers to facilitate the identification and implementation of cost-effective energy-efficiency improvements available for eligible non-residential customers (commercial, industrial, local governments, municipal corporations, public school districts, public universities, state and federal facilities). This Agreement sets forth the terms and conditions applicable to customer’s participation in the Program. By signing below, Customer agrees to comply with and be bound by these terms. Program Year Program incentives are offered from November 10, 2023 until September 30, 2024 or when approved funding is exhausted, whichever comes first. Funds are limited and applications are accepted on a first-come, first- served basis. If funding is exhausted in a given calendar year or the Program or an offering is cancelled, only projects which have received a written pre-approval will be considered for payment of incentives. Program Administrator ComEd has contracted and authorized Resource Innovations (“Program Administrator”) to administer the Program including such activities, but not limited to; review, processing, and approval of customer applications; pre and post inspections of customer facilities and facilitate project information requests from customers, and Contractors; completion of energy assessments at customer facilities; and measurement and verification activities. Contractors As a convenience to customers, ComEd may provide a list of Service Providers, distributors, manufacturers, and other organizations (“Contractors”) that may assist customers with the Program. Customer acknowledges that Contractors are independent contractors with respect to the Program, and that Contractors are not authorized to make representations or incur obligations on behalf of ComEd. Participation as a Contractor does not constitute an endorsement by ComEd, nor does it certify or guarantee the quality of work performed. Customer Eligibility Commercial, Industrial and Public customers on non-residential rate/ accounts must meet these requirements: • • • • Customer Information By signing this application, Customer authorizes and acknowledges that ComEd may duplicate, disseminate, release and disclose Customer’s information relating to Customer’s application (including the entirety of its contents), and any other information related to the Customer’s participation in the Program, including but not limited to account 0 - 400 kW Peak Demand for private Commercial and Industrial Businesses 0 - 400 kW Peak Demand for public sector customers such as local, township, county, state and federal government facilities, public schools, community colleges, public universities, etc. Within the ComEd service territory and receive electricity over ComEd wires regardless of retail electric supplier Pay into the Energy Efficiency and Demand Response Adjustment (Rider EDA) information, billing data, and energy usage to Program Administrator, Contractors, and other approved third parties, as applicable, for the purposes of verifying Customer’s eligibility for participation in the Program; processing the Customer’s application; to verify equipment installation system operation and results; or as required to comply with state and/or federal law, fraud prevention, regulation, and other legal action; in those cases, ComEd, Program Administrator, Contractors and approved third parties shall comply with all legal requirements of the jurisdiction of the individual whose Customer data would be disclosed before making such disclosure. Project Eligibility Project requirements under the Program and this Offering include the following: • • • • • Projects that are NOT eligible for an incentive include, but are not limited to, the following: • • • • • • • • • • Projects must involve new equipment installed at an existing facility that results in a permanent reduction in electrical energy usage (kWh). Equipment must be installed and operational. Equipment must be new (not used or rebuilt, and not for resale) and used at the address for which savings are claimed. Resale of replaced equipment is expressly forbidden. Any measures installed at a facility must be sustainable and provide 100 percent of the energy benefits as stated in the application for a period of five years or for the life of the product, whichever is less. If the customer ceases to be a delivery service customer of ComEd, or removes the equipment or systems at any time during the five-year period or the life of the product, the customer may be required to return a prorated amount of incentive funds to ComEd. All accounts that an eligible large private energy customer has chosen to and been approved to opt out of the ComEd Energy Efficiency Program for the period beginning January 1, 2024 may not contribute to or participate in the ComEd Energy Efficiency Program as of January 1, 2024. On-site electricity generation (except as part of a qualifying Combined Heat and Power project) Projects involving gas-driven equipment in place of electric equipment (such as a chiller) Projects focused primarily on power factor improvement Projects that involve peak-shifting (and not kWh savings) Renewables Projects receiving funding for the same equipment through any other Energy Efficiency Portfolio (EEP) program offered by ComEd, Ameren, Nicor, Peoples or North Shore Used and/or refurbished equipment Projects for the sole purpose of implementing demand response measures Projects that repair or replace existing equipment with like equipment Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 4 501 Terms and Conditions (Continued) Application Review Process Program Administrator will review application submission packages for eligibility in the order received. Applicants who submit incomplete applications will be notified of their deficiencies upon review of the application, but could experience delays in the approval process until all requested information is submitted. Program incentives exceeding $50,000 for an account number will require additional review. Applicants are encouraged to call 855-433-2700 if they have any questions. Inspections ComEd reserves the right to inspect all projects to verify compliance with Program rules and verify the accuracy of project documentation. Upon reasonable notice by ComEd, Customer must agree to provide access to project documents and the facility where the efficiency measures were installed for a period of one year after project completion. Customer authorizes ComEd to verify the actual savings from the improvements installed by reviewing three years of billing and usage data pre-installation of the measures and two years post installation of the measures. Evaluation, Measurement and Verification The Program is evaluated annually by an independent third-party evaluator, as required by law. Customer’s completed project may be selected for evaluation. Depending on the nature of the project, evaluation may include measurement and verification (M&V), the process of monitoring, measuring and/or verifying data related to equipment operation and electrical consumption. Upon reasonable notice, Customer agrees to participate fully in the evaluation process by allowing access to the facility where the project took place and providing information and access to data required for M&V to the Program’s evaluator and/or to complete a customer survey. Project Costs For equipment replacement items, the costs listed are estimated costs for materials. Taxes and costs above this base for items such as vapor tight fluorescent fixtures or installation equipment, e.g. lifts, are to be discussed with the customer by the Contractor. Project scope may include additional items not incentivized or listed in this report, please refer to your Contractor for additional documentation for items outside of this report. Incentive payments are issued directly to the Contractor. Customer is responsible for payment of remaining balance to the Contractor. Toxic Materials Neither ComEd nor its Program Administrator shall have any responsibility for the discovery, presence, handling, removal, disposal of, or exposure to hazardous materials of any kind in connection with customer’s facility, including without limitation, asbestos, asbestos products, PCBs or any other toxic substances. All materials removed, including lamps and PCB ballasts, are required to be permanently taken out of service and disposed of in accordance with local codes and ordinances, and resale of replaced equipment is not allowed. Customer understands that its Contractor is responsible for recycling and disposal of old equipment in compliance with applicable codes or ordinances. (Information about hazardous waste disposal can be found at: www.epa.gov/epawaste/hazard/index.htm). Limitations of Liability IN NO EVENT WILL COMED AND PROGRAM ADMINISTRATOR, BE LIABLE FOR CUSTOMER’S FAILURE TO ACHIEVE A SPECIFIED AMOUNT OF ENERGY SAVINGS, THE OPERATION OF CUSTOMER’S FACILITIES, OR THE IMPLEMENTATION OF ENERGY CONSERVATION MEASURES AT CUSTOMER’S FACILITIES. IN NO EVENT WILL COMED OR PROGRAM ADMINISTRATOR BE LIABLE TO CUSTOMER FOR ANY LOST PROFITS, LOST SAVINGS OR INCIDENTAL, INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES, ARISING OUT OF CUSTOMER’S PARTICIPATION IN THIS OFFERING. Each party hereby agrees to defend, indemnify and hold harmless the other party, its consultants, contractors and subcontractors, and their respective officers, employees, agents, assigns, and successors- interest (“Indemnified Parties”) from and against any third party claims, damages, losses, liability, costs (including attorney’s fees and expenses) for bodily injury to any person (including death resulting therefrom) and property damage arising out of or in connection with the Program, except to the extent such claims, damages, losses, liability and costs are caused by the negligence or willful misconduct of the other party. Disclaimer Customer shall be entitled to the energy cost savings realized by the customer that result from the installation of ECMs at the customer’s site. In consideration of the services provided by ComEd as part of this Offering, the customer agrees that ComEd is entitled to 100% of the rights and benefits associated with the measures, including without limitation PJM products and all other attributes, credits or products associated therewith under any regional initiative or federal, state or local law, program or regulation, and customer waives, and agrees not to seek, any right to the same. Assessment Report Customer understands that the Assessment Report (“Report”) is provided by ComEd to assist Customer in making energy decisions and is for informational purposes only. The information in the Report is based on an on-site assessment of conditions observed at the facility address identified in Customer’s application, information provided by Customer and from ComEd, and industry standard practices and costs for similar projects. The amounts provided are estimates and may vary from actual results of installed measures. This Report is not to be construed as a design document and in no way implies approval of incentive amounts or pre-approval of Customer’s application. ComEd reserves the right to make final determination of customer eligibility, qualifying measures, system savings, project cost-effectiveness and final rebate amounts and the final incentive amount is based on approval of installed measures meeting all Program and Offering requirements. No Warranties Customer shall independently evaluate any advice or information offered by ComEd, Program Administrator or Contractors related to estimates of energy savings or project costs and is solely responsible for the selection and implementation of Energy Conservation Measures (ECMs). COMED AND PROGRAM ADMINISTRATOR MAKE NO WARRANTIES OR REPRESENTATIONS OF ANY KIND WITH RESPECT TO THE PERFORMANCE OR EFFECTIVENESS OF ANY POTENTIAL ENERGY OR COSTS SAVINGS, MEASURES IDENTIFIED, EQUIPMENT INSTALLED, Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 5 502 Terms and Conditions (Continued) Project Summary Tool ID: 060905 Total project cost: $91,358.00 Total incentives: $27,887.04 Final cost to customer: $63,470.96 Service Provider company name: Green Sky Consulting Customer Signature MEASURES IMPLEMENTED, AND/OR SERVICES RENDERED BY ANY PERSON OR ENTITY IN CONNECTION WITH THE PROGRAM. COMED AND PROGRAM ADMINISTRATOR DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, TO THE MAXIMUM EXTENT PERMITTED UNDER LAW, WHETHER STATUTORY OR OTHERWISE, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Governing Law This Agreement shall be exclusively governed by and interpreted in accordance with the laws of the state of Illinois, excluding choice of law rules. Any litigation between the parties shall be prosecuted only in the state or federal courts located in Cook County, Illinois. Program Changes ComEd reserves the right to modify, update, and amend the terms and conditions of the Program, including, but not limited to, making adjustments to incentive amounts, qualifying measures, and changing or cancelling the Program upon thirty (30) days written notice to Customer and/or Contractor. Pre-approved applications, for which the applicant has completed all Program requirements, will be processed to completion under the terms and conditions in effect at the time of the pre-approval by ComEd. Entire Agreement The terms and conditions set forth herein, including all attachments and incorporated references, constitute a complete statement of the terms and conditions applicable to Customer’s participation and supersede all prior representations or understandings, whether written or oral. By signing below, I certify that: 1. As the Customer Representative, I have the authority to bind the Customer to these terms. 2. Customer agrees to the installation of the improvements with the above installation quantities as specified in the Report and that Customer will install the specified product(s) at the facility. I have been informed of the installation costs of the specified products and acknowledge and agree that the products were selected at my discretion. 3. I have read, understand and agree to comply with the terms and conditions set forth in this Agreement. 4. I agree that if I remove the energy-saving improvements installed before a period of five years or the end of the product life, whichever is less, then I shall pay back a prorated amount of incentive funds (equal to the cost of the energy-saving improvement(s)) to ComEd based on the actual period of time in which the related equipment was installed and operating (or the full amount if the equipment was never installed). I understand that this is necessary to assure that the project’s related energy benefits will be achieved. 5. I consent to use of a third party service for purposes of electronically signing this Agreement and agree to be bound by electronic signature. Signature: Title: Printed name: Date: Company: Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 6 Terms and conditions apply. Offers subject to change. Actual savings will vary by customer's energy usage and rate. The ComEd Energy Efficiency Program is funded in compliance with state law. © Commonwealth Edison Company, 2024. SBMAT-CR 041923-01503 Assessment Report Dave Doty • Plainfield Law Enforcement Center 14300 Coil Plus Drive, Plainfield, IL 60544-7704 Wednesday, January 17, 2024 Annual Energy Usage Benefit The figures below represent your current energy use and where you'll end up after installing the recommended improvements. Current Energy Usage 2,200,000 kWh/yr After Installing Your Selected Improvements 1,879,356 kWh/yr Financial Benefit ComEd provides instant incentives to reduce your upfront project costs. The table below shows your project costs before and after your instant incentives. Cost of Selected Improvements $110,070.80 Total Instant Incentives from ComEd*- $100,070.80 Bonuses from ComEd - $10,000.00 Project Cost Due to Your Service Provider $0.00 *All incentives are subject to change and must be reserved to be guaranteed Benefits Overview Total Incentives $110,070.80 Estimated Payback Period After Incentives 0.0 years Estimated Annual Cost Savings $25,651.50 Estimated savings based on average retail price of $0.08 per kWh and $0.70 per therm for commercial customers. † † Environmental Impact‡ Your project can result in an annual reduction of 156 metric tons of CO That's the equivalent of taking 34 cars off the road annually! Estimated CO reduction assumes 4.872 * 10 metric tons CO e not emitted per kWh reduced. Estimated car removal assumes 1 vehicle removed from service reduces the same amount of CO e as reducing electricity production by 9444 kWh / year 2 ‡2 -4 2 2 Let's Explore Small Business Assistance Program DX Tune-Up Small Business and Multi- Family Loan Program Networked Lighting Controls Distributed Generation Rebates (Solar) Prepared By Green Sky Consulting Scott Baloun 815-355-5651 sbaloun@greenskyconsulting.net Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 1 504 Applicant Information You acknowledged that pursuant to Section 16-128B of the Illinois Public Utilities Act, ComEd cannot issue certain incentives or rebates unless it is provided with: Customer Information Company name: Plainfield Law Enforcement Center Contact name: Dave Doty Title: Facilities Manager Address: 14300 Coil Plus Drive, Plainfield IL, 60544 - 7704 Mailing address: Same as facility address Telephone: 815-671-2353 Email: ddoty@goplainfield.com ComEd account number: XXXXX10035 Name as it appears on electric bill: VLG OF PLFD LAW ENFRCMNT CTR Service Provider Information Contracting company name: Green Sky Consulting Contact name: Scott Baloun Title: Owner Telephone: 815-355-5651 Email: sbaloun@greenskyconsulting.net Address: 1142 Dovercliff Way, Crystal Lake IL, 60014 Illinois Commerce Commission Certification 1. Certification that the measure was self-installed by the ComEd customer, or 2. Evidence that the measure was installed by an installer certified by the Illinois Commerce Commission Reminder: All removed equipment must be recycled to ensure inefficient equipment is removed from the market. You may qualify for more incentives from the ComEd Energy Efficiency Program. If so, we may contact you. For more information, visit ComEd.com/BizIncentives. You can also reach us by phone at 855-433-2700 or email us at BusinessEE@ComEd.com. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 2 505 Program Offering Agreement Work with your Service Provider to review this customized project plan. These improvements were identified during your free energy assessment. Receive an instant incentive on these improvements by completing the application, signing the program agreement and scheduling installation with your Service Provider. Your project will be installed by your Service Provider and you will only pay the balance after the incentives are applied. Program Agreement for: Plainfield Law Enforcement Center Service Provider company: Green Sky Consulting Valid: November 10, 2023 - September 30, 2024 Representative: Scott Baloun ** Must Include L&B Retrofit Energy-Saving Improvements Selected for Installation Improvement Type Yearly Energy Cost Savings Quantity Total Cost TLED (Type C)$9,088.19 687 $60,456.00 TLED (Type C)$1,648.51 162 $12,150.00 TLED (Type C)$11,770.58 269 $24,210.00 TLED (Type C)$1,643.42 51 $4,590.00 Outdoor: LED New Fixtures $1,500.80 28 $8,400.00 Additional Costs Selected for Installation Cost Type Yearly Energy Cost Savings Quantity Total Cost Lift Rental N/A 1 $264.80 Energy-Saving Improvements Cost $109,806.00 Additional Costs $264.80 Instant Incentives*- $100,070.80 Bonuses from ComEd - $10,000.00 Final Cost Payable To Service Provider $0.00 *Projects must be approved and incentives reserved before any work begins. If the program does not approve the project, the customer is not required to proceed with the project. Incentives stated in this report are valid for 30 days from date of assessment. If you choose to pursue identified energy-saving improvements after 30 days, please contact the program for a revised list of eligible improvements and pricing. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 3 506 Terms and Conditions Commonwealth Edison Company (“ComEd”) is offering the ComEd Energy Efficiency Program (“Program”) to eligible customers to facilitate the identification and implementation of cost-effective energy-efficiency improvements available for eligible non-residential customers (commercial, industrial, local governments, municipal corporations, public school districts, public universities, state and federal facilities). This Agreement sets forth the terms and conditions applicable to customer’s participation in the Program. By signing below, Customer agrees to comply with and be bound by these terms. Program Year Program incentives are offered from November 10, 2023 until September 30, 2024 or when approved funding is exhausted, whichever comes first. Funds are limited and applications are accepted on a first-come, first- served basis. If funding is exhausted in a given calendar year or the Program or an offering is cancelled, only projects which have received a written pre-approval will be considered for payment of incentives. Program Administrator ComEd has contracted and authorized Resource Innovations (“Program Administrator”) to administer the Program including such activities, but not limited to; review, processing, and approval of customer applications; pre and post inspections of customer facilities and facilitate project information requests from customers, and Contractors; completion of energy assessments at customer facilities; and measurement and verification activities. Contractors As a convenience to customers, ComEd may provide a list of Service Providers, distributors, manufacturers, and other organizations (“Contractors”) that may assist customers with the Program. Customer acknowledges that Contractors are independent contractors with respect to the Program, and that Contractors are not authorized to make representations or incur obligations on behalf of ComEd. Participation as a Contractor does not constitute an endorsement by ComEd, nor does it certify or guarantee the quality of work performed. Customer Eligibility Commercial, Industrial and Public customers on non-residential rate/ accounts must meet these requirements: • • • • Customer Information By signing this application, Customer authorizes and acknowledges that ComEd may duplicate, disseminate, release and disclose Customer’s information relating to Customer’s application (including the entirety of its contents), and any other information related to the Customer’s participation in the Program, including but not limited to account 0 - 400 kW Peak Demand for private Commercial and Industrial Businesses 0 - 400 kW Peak Demand for public sector customers such as local, township, county, state and federal government facilities, public schools, community colleges, public universities, etc. Within the ComEd service territory and receive electricity over ComEd wires regardless of retail electric supplier Pay into the Energy Efficiency and Demand Response Adjustment (Rider EDA) information, billing data, and energy usage to Program Administrator, Contractors, and other approved third parties, as applicable, for the purposes of verifying Customer’s eligibility for participation in the Program; processing the Customer’s application; to verify equipment installation system operation and results; or as required to comply with state and/or federal law, fraud prevention, regulation, and other legal action; in those cases, ComEd, Program Administrator, Contractors and approved third parties shall comply with all legal requirements of the jurisdiction of the individual whose Customer data would be disclosed before making such disclosure. Project Eligibility Project requirements under the Program and this Offering include the following: • • • • • Projects that are NOT eligible for an incentive include, but are not limited to, the following: • • • • • • • • • • Projects must involve new equipment installed at an existing facility that results in a permanent reduction in electrical energy usage (kWh). Equipment must be installed and operational. Equipment must be new (not used or rebuilt, and not for resale) and used at the address for which savings are claimed. Resale of replaced equipment is expressly forbidden. Any measures installed at a facility must be sustainable and provide 100 percent of the energy benefits as stated in the application for a period of five years or for the life of the product, whichever is less. If the customer ceases to be a delivery service customer of ComEd, or removes the equipment or systems at any time during the five-year period or the life of the product, the customer may be required to return a prorated amount of incentive funds to ComEd. All accounts that an eligible large private energy customer has chosen to and been approved to opt out of the ComEd Energy Efficiency Program for the period beginning January 1, 2024 may not contribute to or participate in the ComEd Energy Efficiency Program as of January 1, 2024. On-site electricity generation (except as part of a qualifying Combined Heat and Power project) Projects involving gas-driven equipment in place of electric equipment (such as a chiller) Projects focused primarily on power factor improvement Projects that involve peak-shifting (and not kWh savings) Renewables Projects receiving funding for the same equipment through any other Energy Efficiency Portfolio (EEP) program offered by ComEd, Ameren, Nicor, Peoples or North Shore Used and/or refurbished equipment Projects for the sole purpose of implementing demand response measures Projects that repair or replace existing equipment with like equipment Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 4 507 Terms and Conditions (Continued) Application Review Process Program Administrator will review application submission packages for eligibility in the order received. Applicants who submit incomplete applications will be notified of their deficiencies upon review of the application, but could experience delays in the approval process until all requested information is submitted. Program incentives exceeding $50,000 for an account number will require additional review. Applicants are encouraged to call 855-433-2700 if they have any questions. Inspections ComEd reserves the right to inspect all projects to verify compliance with Program rules and verify the accuracy of project documentation. Upon reasonable notice by ComEd, Customer must agree to provide access to project documents and the facility where the efficiency measures were installed for a period of one year after project completion. Customer authorizes ComEd to verify the actual savings from the improvements installed by reviewing three years of billing and usage data pre-installation of the measures and two years post installation of the measures. Evaluation, Measurement and Verification The Program is evaluated annually by an independent third-party evaluator, as required by law. Customer’s completed project may be selected for evaluation. Depending on the nature of the project, evaluation may include measurement and verification (M&V), the process of monitoring, measuring and/or verifying data related to equipment operation and electrical consumption. Upon reasonable notice, Customer agrees to participate fully in the evaluation process by allowing access to the facility where the project took place and providing information and access to data required for M&V to the Program’s evaluator and/or to complete a customer survey. Project Costs For equipment replacement items, the costs listed are estimated costs for materials. Taxes and costs above this base for items such as vapor tight fluorescent fixtures or installation equipment, e.g. lifts, are to be discussed with the customer by the Contractor. Project scope may include additional items not incentivized or listed in this report, please refer to your Contractor for additional documentation for items outside of this report. Incentive payments are issued directly to the Contractor. Customer is responsible for payment of remaining balance to the Contractor. Toxic Materials Neither ComEd nor its Program Administrator shall have any responsibility for the discovery, presence, handling, removal, disposal of, or exposure to hazardous materials of any kind in connection with customer’s facility, including without limitation, asbestos, asbestos products, PCBs or any other toxic substances. All materials removed, including lamps and PCB ballasts, are required to be permanently taken out of service and disposed of in accordance with local codes and ordinances, and resale of replaced equipment is not allowed. Customer understands that its Contractor is responsible for recycling and disposal of old equipment in compliance with applicable codes or ordinances. (Information about hazardous waste disposal can be found at: www.epa.gov/epawaste/hazard/index.htm). Limitations of Liability IN NO EVENT WILL COMED AND PROGRAM ADMINISTRATOR, BE LIABLE FOR CUSTOMER’S FAILURE TO ACHIEVE A SPECIFIED AMOUNT OF ENERGY SAVINGS, THE OPERATION OF CUSTOMER’S FACILITIES, OR THE IMPLEMENTATION OF ENERGY CONSERVATION MEASURES AT CUSTOMER’S FACILITIES. IN NO EVENT WILL COMED OR PROGRAM ADMINISTRATOR BE LIABLE TO CUSTOMER FOR ANY LOST PROFITS, LOST SAVINGS OR INCIDENTAL, INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES, ARISING OUT OF CUSTOMER’S PARTICIPATION IN THIS OFFERING. Each party hereby agrees to defend, indemnify and hold harmless the other party, its consultants, contractors and subcontractors, and their respective officers, employees, agents, assigns, and successors- interest (“Indemnified Parties”) from and against any third party claims, damages, losses, liability, costs (including attorney’s fees and expenses) for bodily injury to any person (including death resulting therefrom) and property damage arising out of or in connection with the Program, except to the extent such claims, damages, losses, liability and costs are caused by the negligence or willful misconduct of the other party. Disclaimer Customer shall be entitled to the energy cost savings realized by the customer that result from the installation of ECMs at the customer’s site. In consideration of the services provided by ComEd as part of this Offering, the customer agrees that ComEd is entitled to 100% of the rights and benefits associated with the measures, including without limitation PJM products and all other attributes, credits or products associated therewith under any regional initiative or federal, state or local law, program or regulation, and customer waives, and agrees not to seek, any right to the same. Assessment Report Customer understands that the Assessment Report (“Report”) is provided by ComEd to assist Customer in making energy decisions and is for informational purposes only. The information in the Report is based on an on-site assessment of conditions observed at the facility address identified in Customer’s application, information provided by Customer and from ComEd, and industry standard practices and costs for similar projects. The amounts provided are estimates and may vary from actual results of installed measures. This Report is not to be construed as a design document and in no way implies approval of incentive amounts or pre-approval of Customer’s application. ComEd reserves the right to make final determination of customer eligibility, qualifying measures, system savings, project cost-effectiveness and final rebate amounts and the final incentive amount is based on approval of installed measures meeting all Program and Offering requirements. No Warranties Customer shall independently evaluate any advice or information offered by ComEd, Program Administrator or Contractors related to estimates of energy savings or project costs and is solely responsible for the selection and implementation of Energy Conservation Measures (ECMs). COMED AND PROGRAM ADMINISTRATOR MAKE NO WARRANTIES OR REPRESENTATIONS OF ANY KIND WITH RESPECT TO THE PERFORMANCE OR EFFECTIVENESS OF ANY POTENTIAL ENERGY OR COSTS SAVINGS, MEASURES IDENTIFIED, EQUIPMENT INSTALLED, Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 5 508 Terms and Conditions (Continued) Project Summary Tool ID: 060909 Total project cost: $110,070.80 Total incentives: $110,070.80 Final cost to customer: $0.00 Service Provider company name: Green Sky Consulting Customer Signature MEASURES IMPLEMENTED, AND/OR SERVICES RENDERED BY ANY PERSON OR ENTITY IN CONNECTION WITH THE PROGRAM. COMED AND PROGRAM ADMINISTRATOR DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, TO THE MAXIMUM EXTENT PERMITTED UNDER LAW, WHETHER STATUTORY OR OTHERWISE, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Governing Law This Agreement shall be exclusively governed by and interpreted in accordance with the laws of the state of Illinois, excluding choice of law rules. Any litigation between the parties shall be prosecuted only in the state or federal courts located in Cook County, Illinois. Program Changes ComEd reserves the right to modify, update, and amend the terms and conditions of the Program, including, but not limited to, making adjustments to incentive amounts, qualifying measures, and changing or cancelling the Program upon thirty (30) days written notice to Customer and/or Contractor. Pre-approved applications, for which the applicant has completed all Program requirements, will be processed to completion under the terms and conditions in effect at the time of the pre-approval by ComEd. Entire Agreement The terms and conditions set forth herein, including all attachments and incorporated references, constitute a complete statement of the terms and conditions applicable to Customer’s participation and supersede all prior representations or understandings, whether written or oral. By signing below, I certify that: 1. As the Customer Representative, I have the authority to bind the Customer to these terms. 2. Customer agrees to the installation of the improvements with the above installation quantities as specified in the Report and that Customer will install the specified product(s) at the facility. I have been informed of the installation costs of the specified products and acknowledge and agree that the products were selected at my discretion. 3. I have read, understand and agree to comply with the terms and conditions set forth in this Agreement. 4. I agree that if I remove the energy-saving improvements installed before a period of five years or the end of the product life, whichever is less, then I shall pay back a prorated amount of incentive funds (equal to the cost of the energy-saving improvement(s)) to ComEd based on the actual period of time in which the related equipment was installed and operating (or the full amount if the equipment was never installed). I understand that this is necessary to assure that the project’s related energy benefits will be achieved. 5. I consent to use of a third party service for purposes of electronically signing this Agreement and agree to be bound by electronic signature. Signature: Title: Printed name: Date: Company: Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 6 Terms and conditions apply. Offers subject to change. Actual savings will vary by customer's energy usage and rate. The ComEd Energy Efficiency Program is funded in compliance with state law. © Commonwealth Edison Company, 2024. SBMAT-CR 041923-01509 Assessment Report Dave Doty • Plainfield Public Works 14400 Coil Plus Drive, Plainfield, IL 60544-7702 Wednesday, January 17, 2024 Annual Energy Usage Benefit The figures below represent your current energy use and where you'll end up after installing the recommended improvements. Current Energy Usage 500,000 kWh/yr After Installing Your Selected Improvements 396,078 kWh/yr Financial Benefit ComEd provides instant incentives to reduce your upfront project costs. The table below shows your project costs before and after your instant incentives. Cost of Selected Improvements $46,865.00 Total Instant Incentives from ComEd*- $41,148.30 Bonuses from ComEd - $6,172.25 Project Cost Due to Your Service Provider $0.00 *All incentives are subject to change and must be reserved to be guaranteed Benefits Overview Total Incentives $47,320.55 Estimated Payback Period After Incentives 0.0 years Estimated Annual Cost Savings $8,313.75 Estimated savings based on average retail price of $0.08 per kWh and $0.70 per therm for commercial customers. † † Environmental Impact‡ Your project can result in an annual reduction of 51 metric tons of CO That's the equivalent of taking 11 cars off the road annually! Estimated CO reduction assumes 4.872 * 10 metric tons CO e not emitted per kWh reduced. Estimated car removal assumes 1 vehicle removed from service reduces the same amount of CO e as reducing electricity production by 9444 kWh / year 2 ‡2 -4 2 2 Let's Explore Small Business Assistance Program DX Tune-Up Small Business and Multi- Family Loan Program Networked Lighting Controls Distributed Generation Rebates (Solar) Prepared By Green Sky Consulting Scott Baloun 815-355-5651 sbaloun@greenskyconsulting.net Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 1 510 Applicant Information You acknowledged that pursuant to Section 16-128B of the Illinois Public Utilities Act, ComEd cannot issue certain incentives or rebates unless it is provided with: Customer Information Company name: Plainfield Public Works Contact name: Dave Doty Title: Facilities Manager Address: 14400 Coil Plus Drive, Plainfield IL, 60544 - 7702 Mailing address: Same as facility address Telephone: 815-671-2353 Email: ddoty@goplainfield.com ComEd account number: XXXXX28023 Name as it appears on electric bill: Plainfield Public Works Service Provider Information Contracting company name: Green Sky Consulting Contact name: Scott Baloun Title: Owner Telephone: 815-355-5651 Email: sbaloun@greenskyconsulting.net Address: 1142 Dovercliff Way, Crystal Lake IL, 60014 Illinois Commerce Commission Certification 1. Certification that the measure was self-installed by the ComEd customer, or 2. Evidence that the measure was installed by an installer certified by the Illinois Commerce Commission Reminder: All removed equipment must be recycled to ensure inefficient equipment is removed from the market. You may qualify for more incentives from the ComEd Energy Efficiency Program. If so, we may contact you. For more information, visit ComEd.com/BizIncentives. You can also reach us by phone at 855-433-2700 or email us at BusinessEE@ComEd.com. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 2 511 Program Offering Agreement Work with your Service Provider to review this customized project plan. These improvements were identified during your free energy assessment. Receive an instant incentive on these improvements by completing the application, signing the program agreement and scheduling installation with your Service Provider. Your project will be installed by your Service Provider and you will only pay the balance after the incentives are applied. Program Agreement for: Plainfield Public Works Service Provider company: Green Sky Consulting Valid: November 10, 2023 - September 30, 2024 Representative: Scott Baloun ** Must Include L&B Retrofit Energy-Saving Improvements Selected for Installation Improvement Type Yearly Energy Cost Savings Quantity Total Cost TLED (Type C)$1,814.40 175 $17,500.00 TLED (Type C)$1,981.32 147 $14,700.00 TLED (Type C)$780.19 35 $2,625.00 TLED (Type C)$6.91 4 $140.00 TLED (Type C)$11.40 1 $50.00 LED New Fixtures $3,719.52 50 $11,250.00 Additional Costs Selected for Installation Cost Type Yearly Energy Cost Savings Quantity Total Cost Lift Rental N/A 1 $600.00 Energy-Saving Improvements Cost $46,265.00 Additional Costs $600.00 Instant Incentives*- $41,148.30 Bonuses from ComEd - $6,172.25 Final Cost Payable To Service Provider $0.00 *Projects must be approved and incentives reserved before any work begins. If the program does not approve the project, the customer is not required to proceed with the project. Incentives stated in this report are valid for 30 days from date of assessment. If you choose to pursue identified energy-saving improvements after 30 days, please contact the program for a revised list of eligible improvements and pricing. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 3 512 Terms and Conditions Commonwealth Edison Company (“ComEd”) is offering the ComEd Energy Efficiency Program (“Program”) to eligible customers to facilitate the identification and implementation of cost-effective energy-efficiency improvements available for eligible non-residential customers (commercial, industrial, local governments, municipal corporations, public school districts, public universities, state and federal facilities). This Agreement sets forth the terms and conditions applicable to customer’s participation in the Program. By signing below, Customer agrees to comply with and be bound by these terms. Program Year Program incentives are offered from November 10, 2023 until September 30, 2024 or when approved funding is exhausted, whichever comes first. Funds are limited and applications are accepted on a first-come, first- served basis. If funding is exhausted in a given calendar year or the Program or an offering is cancelled, only projects which have received a written pre-approval will be considered for payment of incentives. Program Administrator ComEd has contracted and authorized Resource Innovations (“Program Administrator”) to administer the Program including such activities, but not limited to; review, processing, and approval of customer applications; pre and post inspections of customer facilities and facilitate project information requests from customers, and Contractors; completion of energy assessments at customer facilities; and measurement and verification activities. Contractors As a convenience to customers, ComEd may provide a list of Service Providers, distributors, manufacturers, and other organizations (“Contractors”) that may assist customers with the Program. Customer acknowledges that Contractors are independent contractors with respect to the Program, and that Contractors are not authorized to make representations or incur obligations on behalf of ComEd. Participation as a Contractor does not constitute an endorsement by ComEd, nor does it certify or guarantee the quality of work performed. Customer Eligibility Commercial, Industrial and Public customers on non-residential rate/ accounts must meet these requirements: • • • • Customer Information By signing this application, Customer authorizes and acknowledges that ComEd may duplicate, disseminate, release and disclose Customer’s information relating to Customer’s application (including the entirety of its contents), and any other information related to the Customer’s participation in the Program, including but not limited to account 0 - 400 kW Peak Demand for private Commercial and Industrial Businesses 0 - 400 kW Peak Demand for public sector customers such as local, township, county, state and federal government facilities, public schools, community colleges, public universities, etc. Within the ComEd service territory and receive electricity over ComEd wires regardless of retail electric supplier Pay into the Energy Efficiency and Demand Response Adjustment (Rider EDA) information, billing data, and energy usage to Program Administrator, Contractors, and other approved third parties, as applicable, for the purposes of verifying Customer’s eligibility for participation in the Program; processing the Customer’s application; to verify equipment installation system operation and results; or as required to comply with state and/or federal law, fraud prevention, regulation, and other legal action; in those cases, ComEd, Program Administrator, Contractors and approved third parties shall comply with all legal requirements of the jurisdiction of the individual whose Customer data would be disclosed before making such disclosure. Project Eligibility Project requirements under the Program and this Offering include the following: • • • • • Projects that are NOT eligible for an incentive include, but are not limited to, the following: • • • • • • • • • • Projects must involve new equipment installed at an existing facility that results in a permanent reduction in electrical energy usage (kWh). Equipment must be installed and operational. Equipment must be new (not used or rebuilt, and not for resale) and used at the address for which savings are claimed. Resale of replaced equipment is expressly forbidden. Any measures installed at a facility must be sustainable and provide 100 percent of the energy benefits as stated in the application for a period of five years or for the life of the product, whichever is less. If the customer ceases to be a delivery service customer of ComEd, or removes the equipment or systems at any time during the five-year period or the life of the product, the customer may be required to return a prorated amount of incentive funds to ComEd. All accounts that an eligible large private energy customer has chosen to and been approved to opt out of the ComEd Energy Efficiency Program for the period beginning January 1, 2024 may not contribute to or participate in the ComEd Energy Efficiency Program as of January 1, 2024. On-site electricity generation (except as part of a qualifying Combined Heat and Power project) Projects involving gas-driven equipment in place of electric equipment (such as a chiller) Projects focused primarily on power factor improvement Projects that involve peak-shifting (and not kWh savings) Renewables Projects receiving funding for the same equipment through any other Energy Efficiency Portfolio (EEP) program offered by ComEd, Ameren, Nicor, Peoples or North Shore Used and/or refurbished equipment Projects for the sole purpose of implementing demand response measures Projects that repair or replace existing equipment with like equipment Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 4 513 Terms and Conditions (Continued) Application Review Process Program Administrator will review application submission packages for eligibility in the order received. Applicants who submit incomplete applications will be notified of their deficiencies upon review of the application, but could experience delays in the approval process until all requested information is submitted. Program incentives exceeding $50,000 for an account number will require additional review. Applicants are encouraged to call 855-433-2700 if they have any questions. Inspections ComEd reserves the right to inspect all projects to verify compliance with Program rules and verify the accuracy of project documentation. Upon reasonable notice by ComEd, Customer must agree to provide access to project documents and the facility where the efficiency measures were installed for a period of one year after project completion. Customer authorizes ComEd to verify the actual savings from the improvements installed by reviewing three years of billing and usage data pre-installation of the measures and two years post installation of the measures. Evaluation, Measurement and Verification The Program is evaluated annually by an independent third-party evaluator, as required by law. Customer’s completed project may be selected for evaluation. Depending on the nature of the project, evaluation may include measurement and verification (M&V), the process of monitoring, measuring and/or verifying data related to equipment operation and electrical consumption. Upon reasonable notice, Customer agrees to participate fully in the evaluation process by allowing access to the facility where the project took place and providing information and access to data required for M&V to the Program’s evaluator and/or to complete a customer survey. Project Costs For equipment replacement items, the costs listed are estimated costs for materials. Taxes and costs above this base for items such as vapor tight fluorescent fixtures or installation equipment, e.g. lifts, are to be discussed with the customer by the Contractor. Project scope may include additional items not incentivized or listed in this report, please refer to your Contractor for additional documentation for items outside of this report. Incentive payments are issued directly to the Contractor. Customer is responsible for payment of remaining balance to the Contractor. Toxic Materials Neither ComEd nor its Program Administrator shall have any responsibility for the discovery, presence, handling, removal, disposal of, or exposure to hazardous materials of any kind in connection with customer’s facility, including without limitation, asbestos, asbestos products, PCBs or any other toxic substances. All materials removed, including lamps and PCB ballasts, are required to be permanently taken out of service and disposed of in accordance with local codes and ordinances, and resale of replaced equipment is not allowed. Customer understands that its Contractor is responsible for recycling and disposal of old equipment in compliance with applicable codes or ordinances. (Information about hazardous waste disposal can be found at: www.epa.gov/epawaste/hazard/index.htm). Limitations of Liability IN NO EVENT WILL COMED AND PROGRAM ADMINISTRATOR, BE LIABLE FOR CUSTOMER’S FAILURE TO ACHIEVE A SPECIFIED AMOUNT OF ENERGY SAVINGS, THE OPERATION OF CUSTOMER’S FACILITIES, OR THE IMPLEMENTATION OF ENERGY CONSERVATION MEASURES AT CUSTOMER’S FACILITIES. IN NO EVENT WILL COMED OR PROGRAM ADMINISTRATOR BE LIABLE TO CUSTOMER FOR ANY LOST PROFITS, LOST SAVINGS OR INCIDENTAL, INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES, ARISING OUT OF CUSTOMER’S PARTICIPATION IN THIS OFFERING. Each party hereby agrees to defend, indemnify and hold harmless the other party, its consultants, contractors and subcontractors, and their respective officers, employees, agents, assigns, and successors- interest (“Indemnified Parties”) from and against any third party claims, damages, losses, liability, costs (including attorney’s fees and expenses) for bodily injury to any person (including death resulting therefrom) and property damage arising out of or in connection with the Program, except to the extent such claims, damages, losses, liability and costs are caused by the negligence or willful misconduct of the other party. Disclaimer Customer shall be entitled to the energy cost savings realized by the customer that result from the installation of ECMs at the customer’s site. In consideration of the services provided by ComEd as part of this Offering, the customer agrees that ComEd is entitled to 100% of the rights and benefits associated with the measures, including without limitation PJM products and all other attributes, credits or products associated therewith under any regional initiative or federal, state or local law, program or regulation, and customer waives, and agrees not to seek, any right to the same. Assessment Report Customer understands that the Assessment Report (“Report”) is provided by ComEd to assist Customer in making energy decisions and is for informational purposes only. The information in the Report is based on an on-site assessment of conditions observed at the facility address identified in Customer’s application, information provided by Customer and from ComEd, and industry standard practices and costs for similar projects. The amounts provided are estimates and may vary from actual results of installed measures. This Report is not to be construed as a design document and in no way implies approval of incentive amounts or pre-approval of Customer’s application. ComEd reserves the right to make final determination of customer eligibility, qualifying measures, system savings, project cost-effectiveness and final rebate amounts and the final incentive amount is based on approval of installed measures meeting all Program and Offering requirements. No Warranties Customer shall independently evaluate any advice or information offered by ComEd, Program Administrator or Contractors related to estimates of energy savings or project costs and is solely responsible for the selection and implementation of Energy Conservation Measures (ECMs). COMED AND PROGRAM ADMINISTRATOR MAKE NO WARRANTIES OR REPRESENTATIONS OF ANY KIND WITH RESPECT TO THE PERFORMANCE OR EFFECTIVENESS OF ANY POTENTIAL ENERGY OR COSTS SAVINGS, MEASURES IDENTIFIED, EQUIPMENT INSTALLED, Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 5 514 Terms and Conditions (Continued) Project Summary Tool ID: 060913 Total project cost: $46,865.00 Total incentives: $47,320.55 Final cost to customer: $0.00 Service Provider company name: Green Sky Consulting Customer Signature MEASURES IMPLEMENTED, AND/OR SERVICES RENDERED BY ANY PERSON OR ENTITY IN CONNECTION WITH THE PROGRAM. COMED AND PROGRAM ADMINISTRATOR DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, TO THE MAXIMUM EXTENT PERMITTED UNDER LAW, WHETHER STATUTORY OR OTHERWISE, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Governing Law This Agreement shall be exclusively governed by and interpreted in accordance with the laws of the state of Illinois, excluding choice of law rules. Any litigation between the parties shall be prosecuted only in the state or federal courts located in Cook County, Illinois. Program Changes ComEd reserves the right to modify, update, and amend the terms and conditions of the Program, including, but not limited to, making adjustments to incentive amounts, qualifying measures, and changing or cancelling the Program upon thirty (30) days written notice to Customer and/or Contractor. Pre-approved applications, for which the applicant has completed all Program requirements, will be processed to completion under the terms and conditions in effect at the time of the pre-approval by ComEd. Entire Agreement The terms and conditions set forth herein, including all attachments and incorporated references, constitute a complete statement of the terms and conditions applicable to Customer’s participation and supersede all prior representations or understandings, whether written or oral. By signing below, I certify that: 1. As the Customer Representative, I have the authority to bind the Customer to these terms. 2. Customer agrees to the installation of the improvements with the above installation quantities as specified in the Report and that Customer will install the specified product(s) at the facility. I have been informed of the installation costs of the specified products and acknowledge and agree that the products were selected at my discretion. 3. I have read, understand and agree to comply with the terms and conditions set forth in this Agreement. 4. I agree that if I remove the energy-saving improvements installed before a period of five years or the end of the product life, whichever is less, then I shall pay back a prorated amount of incentive funds (equal to the cost of the energy-saving improvement(s)) to ComEd based on the actual period of time in which the related equipment was installed and operating (or the full amount if the equipment was never installed). I understand that this is necessary to assure that the project’s related energy benefits will be achieved. 5. I consent to use of a third party service for purposes of electronically signing this Agreement and agree to be bound by electronic signature. Signature: Title: Printed name: Date: Company: Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 6 Terms and conditions apply. Offers subject to change. Actual savings will vary by customer's energy usage and rate. The ComEd Energy Efficiency Program is funded in compliance with state law. © Commonwealth Edison Company, 2024. SBMAT-CR 041923-01515 Assessment Report Dave Doty • Plainfield North Waste Water 14701 Wood Farm Road, Plainfield, IL 60544-0000 Wednesday, January 17, 2024 Annual Energy Usage Benefit The figures below represent your current energy use and where you'll end up after installing the recommended improvements. Current Energy Usage 400,000 kWh/yr After Installing Your Selected Improvements 321,815 kWh/yr Financial Benefit ComEd provides instant incentives to reduce your upfront project costs. The table below shows your project costs before and after your instant incentives. Cost of Selected Improvements $58,600.00 Total Instant Incentives from ComEd*- $40,061.70 Bonuses from ComEd - $6,009.26 Project Cost Due to Your Service Provider $12,529.04 *All incentives are subject to change and must be reserved to be guaranteed Benefits Overview Total Incentives $46,070.96 Estimated Payback Period After Incentives 2.0 years Estimated Annual Cost Savings $6,254.82 Estimated savings based on average retail price of $0.08 per kWh and $0.70 per therm for commercial customers. † † Environmental Impact‡ Your project can result in an annual reduction of 38 metric tons of CO That's the equivalent of taking 8 cars off the road annually! Estimated CO reduction assumes 4.872 * 10 metric tons CO e not emitted per kWh reduced. Estimated car removal assumes 1 vehicle removed from service reduces the same amount of CO e as reducing electricity production by 9444 kWh / year 2 ‡2 -4 2 2 Let's Explore Small Business Assistance Program DX Tune-Up Small Business and Multi- Family Loan Program Networked Lighting Controls Distributed Generation Rebates (Solar) Prepared By Green Sky Consulting Scott Baloun 815-355-5651 sbaloun@greenskyconsulting.net Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 1 516 Applicant Information You acknowledged that pursuant to Section 16-128B of the Illinois Public Utilities Act, ComEd cannot issue certain incentives or rebates unless it is provided with: Customer Information Company name: Plainfield North Waste Water Contact name: Dave Doty Title: Facilities Manager Address: 14701 Wood Farm Road, Plainfield IL, 60544 - 0000 Mailing address: Same as facility address Telephone: 815-671-2353 Email: ddoty@goplainfield.com ComEd account number: XXXXX56789 Name as it appears on electric bill: Plainfield North Waste Water Service Provider Information Contracting company name: Green Sky Consulting Contact name: Scott Baloun Title: Owner Telephone: 815-355-5651 Email: sbaloun@greenskyconsulting.net Address: 1142 Dovercliff Way, Crystal Lake IL, 60014 Illinois Commerce Commission Certification 1. Certification that the measure was self-installed by the ComEd customer, or 2. Evidence that the measure was installed by an installer certified by the Illinois Commerce Commission Reminder: All removed equipment must be recycled to ensure inefficient equipment is removed from the market. You may qualify for more incentives from the ComEd Energy Efficiency Program. If so, we may contact you. For more information, visit ComEd.com/BizIncentives. You can also reach us by phone at 855-433-2700 or email us at BusinessEE@ComEd.com. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 2 517 Program Offering Agreement Work with your Service Provider to review this customized project plan. These improvements were identified during your free energy assessment. Receive an instant incentive on these improvements by completing the application, signing the program agreement and scheduling installation with your Service Provider. Your project will be installed by your Service Provider and you will only pay the balance after the incentives are applied. Program Agreement for: Plainfield North Waste Water Service Provider company: Green Sky Consulting Valid: November 10, 2023 - September 30, 2024 Representative: Scott Baloun ** Must Include L&B Retrofit Energy-Saving Improvements Selected for Installation Improvement Type Yearly Energy Cost Savings Quantity Total Cost TLED (Type C)$1,815.26 191 $19,100.00 TLED (Type C)$381.54 24 $2,400.00 LED New Fixtures $1,463.62 22 $5,500.00 Outdoor: LED New Fixtures $820.00 25 $7,500.00 Outdoor: LED New Fixtures $1,363.20 48 $14,400.00 Outdoor: LED New Fixtures $244.80 18 $4,500.00 Outdoor: LED New Fixtures $166.40 26 $5,200.00 Energy-Saving Improvements Cost $58,600.00 Additional Costs $0.00 Instant Incentives*- $40,061.70 Bonuses from ComEd - $6,009.26 Final Cost Payable To Service Provider $12,529.04 *Projects must be approved and incentives reserved before any work begins. If the program does not approve the project, the customer is not required to proceed with the project. Incentives stated in this report are valid for 30 days from date of assessment. If you choose to pursue identified energy-saving improvements after 30 days, please contact the program for a revised list of eligible improvements and pricing. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 3 518 Terms and Conditions Commonwealth Edison Company (“ComEd”) is offering the ComEd Energy Efficiency Program (“Program”) to eligible customers to facilitate the identification and implementation of cost-effective energy-efficiency improvements available for eligible non-residential customers (commercial, industrial, local governments, municipal corporations, public school districts, public universities, state and federal facilities). This Agreement sets forth the terms and conditions applicable to customer’s participation in the Program. By signing below, Customer agrees to comply with and be bound by these terms. Program Year Program incentives are offered from November 10, 2023 until September 30, 2024 or when approved funding is exhausted, whichever comes first. Funds are limited and applications are accepted on a first-come, first- served basis. If funding is exhausted in a given calendar year or the Program or an offering is cancelled, only projects which have received a written pre-approval will be considered for payment of incentives. Program Administrator ComEd has contracted and authorized Resource Innovations (“Program Administrator”) to administer the Program including such activities, but not limited to; review, processing, and approval of customer applications; pre and post inspections of customer facilities and facilitate project information requests from customers, and Contractors; completion of energy assessments at customer facilities; and measurement and verification activities. Contractors As a convenience to customers, ComEd may provide a list of Service Providers, distributors, manufacturers, and other organizations (“Contractors”) that may assist customers with the Program. Customer acknowledges that Contractors are independent contractors with respect to the Program, and that Contractors are not authorized to make representations or incur obligations on behalf of ComEd. Participation as a Contractor does not constitute an endorsement by ComEd, nor does it certify or guarantee the quality of work performed. Customer Eligibility Commercial, Industrial and Public customers on non-residential rate/ accounts must meet these requirements: • • • • Customer Information By signing this application, Customer authorizes and acknowledges that ComEd may duplicate, disseminate, release and disclose Customer’s information relating to Customer’s application (including the entirety of its contents), and any other information related to the Customer’s participation in the Program, including but not limited to account 0 - 400 kW Peak Demand for private Commercial and Industrial Businesses 0 - 400 kW Peak Demand for public sector customers such as local, township, county, state and federal government facilities, public schools, community colleges, public universities, etc. Within the ComEd service territory and receive electricity over ComEd wires regardless of retail electric supplier Pay into the Energy Efficiency and Demand Response Adjustment (Rider EDA) information, billing data, and energy usage to Program Administrator, Contractors, and other approved third parties, as applicable, for the purposes of verifying Customer’s eligibility for participation in the Program; processing the Customer’s application; to verify equipment installation system operation and results; or as required to comply with state and/or federal law, fraud prevention, regulation, and other legal action; in those cases, ComEd, Program Administrator, Contractors and approved third parties shall comply with all legal requirements of the jurisdiction of the individual whose Customer data would be disclosed before making such disclosure. Project Eligibility Project requirements under the Program and this Offering include the following: • • • • • Projects that are NOT eligible for an incentive include, but are not limited to, the following: • • • • • • • • • • Projects must involve new equipment installed at an existing facility that results in a permanent reduction in electrical energy usage (kWh). Equipment must be installed and operational. Equipment must be new (not used or rebuilt, and not for resale) and used at the address for which savings are claimed. Resale of replaced equipment is expressly forbidden. Any measures installed at a facility must be sustainable and provide 100 percent of the energy benefits as stated in the application for a period of five years or for the life of the product, whichever is less. If the customer ceases to be a delivery service customer of ComEd, or removes the equipment or systems at any time during the five-year period or the life of the product, the customer may be required to return a prorated amount of incentive funds to ComEd. All accounts that an eligible large private energy customer has chosen to and been approved to opt out of the ComEd Energy Efficiency Program for the period beginning January 1, 2024 may not contribute to or participate in the ComEd Energy Efficiency Program as of January 1, 2024. On-site electricity generation (except as part of a qualifying Combined Heat and Power project) Projects involving gas-driven equipment in place of electric equipment (such as a chiller) Projects focused primarily on power factor improvement Projects that involve peak-shifting (and not kWh savings) Renewables Projects receiving funding for the same equipment through any other Energy Efficiency Portfolio (EEP) program offered by ComEd, Ameren, Nicor, Peoples or North Shore Used and/or refurbished equipment Projects for the sole purpose of implementing demand response measures Projects that repair or replace existing equipment with like equipment Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 4 519 Terms and Conditions (Continued) Application Review Process Program Administrator will review application submission packages for eligibility in the order received. Applicants who submit incomplete applications will be notified of their deficiencies upon review of the application, but could experience delays in the approval process until all requested information is submitted. Program incentives exceeding $50,000 for an account number will require additional review. Applicants are encouraged to call 855-433-2700 if they have any questions. Inspections ComEd reserves the right to inspect all projects to verify compliance with Program rules and verify the accuracy of project documentation. Upon reasonable notice by ComEd, Customer must agree to provide access to project documents and the facility where the efficiency measures were installed for a period of one year after project completion. Customer authorizes ComEd to verify the actual savings from the improvements installed by reviewing three years of billing and usage data pre-installation of the measures and two years post installation of the measures. Evaluation, Measurement and Verification The Program is evaluated annually by an independent third-party evaluator, as required by law. Customer’s completed project may be selected for evaluation. Depending on the nature of the project, evaluation may include measurement and verification (M&V), the process of monitoring, measuring and/or verifying data related to equipment operation and electrical consumption. Upon reasonable notice, Customer agrees to participate fully in the evaluation process by allowing access to the facility where the project took place and providing information and access to data required for M&V to the Program’s evaluator and/or to complete a customer survey. Project Costs For equipment replacement items, the costs listed are estimated costs for materials. Taxes and costs above this base for items such as vapor tight fluorescent fixtures or installation equipment, e.g. lifts, are to be discussed with the customer by the Contractor. Project scope may include additional items not incentivized or listed in this report, please refer to your Contractor for additional documentation for items outside of this report. Incentive payments are issued directly to the Contractor. Customer is responsible for payment of remaining balance to the Contractor. Toxic Materials Neither ComEd nor its Program Administrator shall have any responsibility for the discovery, presence, handling, removal, disposal of, or exposure to hazardous materials of any kind in connection with customer’s facility, including without limitation, asbestos, asbestos products, PCBs or any other toxic substances. All materials removed, including lamps and PCB ballasts, are required to be permanently taken out of service and disposed of in accordance with local codes and ordinances, and resale of replaced equipment is not allowed. Customer understands that its Contractor is responsible for recycling and disposal of old equipment in compliance with applicable codes or ordinances. (Information about hazardous waste disposal can be found at: www.epa.gov/epawaste/hazard/index.htm). Limitations of Liability IN NO EVENT WILL COMED AND PROGRAM ADMINISTRATOR, BE LIABLE FOR CUSTOMER’S FAILURE TO ACHIEVE A SPECIFIED AMOUNT OF ENERGY SAVINGS, THE OPERATION OF CUSTOMER’S FACILITIES, OR THE IMPLEMENTATION OF ENERGY CONSERVATION MEASURES AT CUSTOMER’S FACILITIES. IN NO EVENT WILL COMED OR PROGRAM ADMINISTRATOR BE LIABLE TO CUSTOMER FOR ANY LOST PROFITS, LOST SAVINGS OR INCIDENTAL, INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES, ARISING OUT OF CUSTOMER’S PARTICIPATION IN THIS OFFERING. Each party hereby agrees to defend, indemnify and hold harmless the other party, its consultants, contractors and subcontractors, and their respective officers, employees, agents, assigns, and successors- interest (“Indemnified Parties”) from and against any third party claims, damages, losses, liability, costs (including attorney’s fees and expenses) for bodily injury to any person (including death resulting therefrom) and property damage arising out of or in connection with the Program, except to the extent such claims, damages, losses, liability and costs are caused by the negligence or willful misconduct of the other party. Disclaimer Customer shall be entitled to the energy cost savings realized by the customer that result from the installation of ECMs at the customer’s site. In consideration of the services provided by ComEd as part of this Offering, the customer agrees that ComEd is entitled to 100% of the rights and benefits associated with the measures, including without limitation PJM products and all other attributes, credits or products associated therewith under any regional initiative or federal, state or local law, program or regulation, and customer waives, and agrees not to seek, any right to the same. Assessment Report Customer understands that the Assessment Report (“Report”) is provided by ComEd to assist Customer in making energy decisions and is for informational purposes only. The information in the Report is based on an on-site assessment of conditions observed at the facility address identified in Customer’s application, information provided by Customer and from ComEd, and industry standard practices and costs for similar projects. The amounts provided are estimates and may vary from actual results of installed measures. This Report is not to be construed as a design document and in no way implies approval of incentive amounts or pre-approval of Customer’s application. ComEd reserves the right to make final determination of customer eligibility, qualifying measures, system savings, project cost-effectiveness and final rebate amounts and the final incentive amount is based on approval of installed measures meeting all Program and Offering requirements. No Warranties Customer shall independently evaluate any advice or information offered by ComEd, Program Administrator or Contractors related to estimates of energy savings or project costs and is solely responsible for the selection and implementation of Energy Conservation Measures (ECMs). COMED AND PROGRAM ADMINISTRATOR MAKE NO WARRANTIES OR REPRESENTATIONS OF ANY KIND WITH RESPECT TO THE PERFORMANCE OR EFFECTIVENESS OF ANY POTENTIAL ENERGY OR COSTS SAVINGS, MEASURES IDENTIFIED, EQUIPMENT INSTALLED, Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 5 520 Terms and Conditions (Continued) Project Summary Tool ID: 064878 Total project cost: $58,600.00 Total incentives: $46,070.96 Final cost to customer: $12,529.04 Service Provider company name: Green Sky Consulting Customer Signature MEASURES IMPLEMENTED, AND/OR SERVICES RENDERED BY ANY PERSON OR ENTITY IN CONNECTION WITH THE PROGRAM. COMED AND PROGRAM ADMINISTRATOR DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, TO THE MAXIMUM EXTENT PERMITTED UNDER LAW, WHETHER STATUTORY OR OTHERWISE, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Governing Law This Agreement shall be exclusively governed by and interpreted in accordance with the laws of the state of Illinois, excluding choice of law rules. Any litigation between the parties shall be prosecuted only in the state or federal courts located in Cook County, Illinois. Program Changes ComEd reserves the right to modify, update, and amend the terms and conditions of the Program, including, but not limited to, making adjustments to incentive amounts, qualifying measures, and changing or cancelling the Program upon thirty (30) days written notice to Customer and/or Contractor. Pre-approved applications, for which the applicant has completed all Program requirements, will be processed to completion under the terms and conditions in effect at the time of the pre-approval by ComEd. Entire Agreement The terms and conditions set forth herein, including all attachments and incorporated references, constitute a complete statement of the terms and conditions applicable to Customer’s participation and supersede all prior representations or understandings, whether written or oral. By signing below, I certify that: 1. As the Customer Representative, I have the authority to bind the Customer to these terms. 2. Customer agrees to the installation of the improvements with the above installation quantities as specified in the Report and that Customer will install the specified product(s) at the facility. I have been informed of the installation costs of the specified products and acknowledge and agree that the products were selected at my discretion. 3. I have read, understand and agree to comply with the terms and conditions set forth in this Agreement. 4. I agree that if I remove the energy-saving improvements installed before a period of five years or the end of the product life, whichever is less, then I shall pay back a prorated amount of incentive funds (equal to the cost of the energy-saving improvement(s)) to ComEd based on the actual period of time in which the related equipment was installed and operating (or the full amount if the equipment was never installed). I understand that this is necessary to assure that the project’s related energy benefits will be achieved. 5. I consent to use of a third party service for purposes of electronically signing this Agreement and agree to be bound by electronic signature. Signature: Title: Printed name: Date: Company: Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 6 Terms and conditions apply. Offers subject to change. Actual savings will vary by customer's energy usage and rate. The ComEd Energy Efficiency Program is funded in compliance with state law. © Commonwealth Edison Company, 2024. SBMAT-CR 041923-01521 Assessment Report Dave Doty • Plainfield Wells 11901 Van Dyke Road, Plainfield, IL 00000-0000 Wednesday, January 17, 2024 Annual Energy Usage Benefit The figures below represent your current energy use and where you'll end up after installing the recommended improvements. Current Energy Usage 120,000 kWh/yr After Installing Your Selected Improvements 101,744 kWh/yr Financial Benefit ComEd provides instant incentives to reduce your upfront project costs. The table below shows your project costs before and after your instant incentives. Cost of Selected Improvements $17,430.55 Total Instant Incentives from ComEd*- $15,157.00 Bonuses from ComEd - $2,273.55 Project Cost Due to Your Service Provider $0.00 *All incentives are subject to change and must be reserved to be guaranteed Benefits Overview Total Incentives $17,430.55 Estimated Payback Period After Incentives 0.0 years Estimated Annual Cost Savings $1,460.51 Estimated savings based on average retail price of $0.08 per kWh and $0.70 per therm for commercial customers. † † Environmental Impact‡ Your project can result in an annual reduction of 9 metric tons of CO That's the equivalent of taking 2 cars off the road annually! Estimated CO reduction assumes 4.872 * 10 metric tons CO e not emitted per kWh reduced. Estimated car removal assumes 1 vehicle removed from service reduces the same amount of CO e as reducing electricity production by 9444 kWh / year 2 ‡2 -4 2 2 Let's Explore Small Business Assistance Program DX Tune-Up Small Business and Multi- Family Loan Program Networked Lighting Controls Distributed Generation Rebates (Solar) Prepared By Green Sky Consulting Scott Baloun 815-355-5651 sbaloun@greenskyconsulting.net Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 1 522 Applicant Information You acknowledged that pursuant to Section 16-128B of the Illinois Public Utilities Act, ComEd cannot issue certain incentives or rebates unless it is provided with: Customer Information Company name: Plainfield Wells Contact name: Dave Doty Title: Facilities Manager Address: 11901 Van Dyke Road, Plainfield IL, 00000 - 0000 Mailing address: Same as facility address Telephone: 815-671-2353 Email: ddoty@goplainfield.com ComEd account number: XXXXX43016 Name as it appears on electric bill: Village of Plainfield Service Provider Information Contracting company name: Green Sky Consulting Contact name: Scott Baloun Title: Owner Telephone: 815-355-5651 Email: sbaloun@greenskyconsulting.net Address: 1142 Dovercliff Way, Crystal Lake IL, 60014 Illinois Commerce Commission Certification 1. Certification that the measure was self-installed by the ComEd customer, or 2. Evidence that the measure was installed by an installer certified by the Illinois Commerce Commission Reminder: All removed equipment must be recycled to ensure inefficient equipment is removed from the market. You may qualify for more incentives from the ComEd Energy Efficiency Program. If so, we may contact you. For more information, visit ComEd.com/BizIncentives. You can also reach us by phone at 855-433-2700 or email us at BusinessEE@ComEd.com. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 2 523 Program Offering Agreement Work with your Service Provider to review this customized project plan. These improvements were identified during your free energy assessment. Receive an instant incentive on these improvements by completing the application, signing the program agreement and scheduling installation with your Service Provider. Your project will be installed by your Service Provider and you will only pay the balance after the incentives are applied. Program Agreement for: Plainfield Wells Service Provider company: Green Sky Consulting Valid: November 10, 2023 - September 30, 2024 Representative: Scott Baloun ** Must Include L&B Retrofit Energy-Saving Improvements Selected for Installation Improvement Type Yearly Energy Cost Savings Quantity Total Cost TLED (Type C)$1,324.51 210 $15,750.00 Outdoor: LED New Fixtures $136.00 10 $1,600.00 Additional Costs Selected for Installation Cost Type Yearly Energy Cost Savings Quantity Total Cost Other N/A 1 $80.55 Energy-Saving Improvements Cost $17,350.00 Additional Costs $80.55 Instant Incentives*- $15,157.00 Bonuses from ComEd - $2,273.55 Final Cost Payable To Service Provider $0.00 *Projects must be approved and incentives reserved before any work begins. If the program does not approve the project, the customer is not required to proceed with the project. Incentives stated in this report are valid for 30 days from date of assessment. If you choose to pursue identified energy-saving improvements after 30 days, please contact the program for a revised list of eligible improvements and pricing. Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 3 524 Terms and Conditions Commonwealth Edison Company (“ComEd”) is offering the ComEd Energy Efficiency Program (“Program”) to eligible customers to facilitate the identification and implementation of cost-effective energy-efficiency improvements available for eligible non-residential customers (commercial, industrial, local governments, municipal corporations, public school districts, public universities, state and federal facilities). This Agreement sets forth the terms and conditions applicable to customer’s participation in the Program. By signing below, Customer agrees to comply with and be bound by these terms. Program Year Program incentives are offered from November 10, 2023 until September 30, 2024 or when approved funding is exhausted, whichever comes first. Funds are limited and applications are accepted on a first-come, first- served basis. If funding is exhausted in a given calendar year or the Program or an offering is cancelled, only projects which have received a written pre-approval will be considered for payment of incentives. Program Administrator ComEd has contracted and authorized Resource Innovations (“Program Administrator”) to administer the Program including such activities, but not limited to; review, processing, and approval of customer applications; pre and post inspections of customer facilities and facilitate project information requests from customers, and Contractors; completion of energy assessments at customer facilities; and measurement and verification activities. Contractors As a convenience to customers, ComEd may provide a list of Service Providers, distributors, manufacturers, and other organizations (“Contractors”) that may assist customers with the Program. Customer acknowledges that Contractors are independent contractors with respect to the Program, and that Contractors are not authorized to make representations or incur obligations on behalf of ComEd. Participation as a Contractor does not constitute an endorsement by ComEd, nor does it certify or guarantee the quality of work performed. Customer Eligibility Commercial, Industrial and Public customers on non-residential rate/ accounts must meet these requirements: • • • • Customer Information By signing this application, Customer authorizes and acknowledges that ComEd may duplicate, disseminate, release and disclose Customer’s information relating to Customer’s application (including the entirety of its contents), and any other information related to the Customer’s participation in the Program, including but not limited to account 0 - 400 kW Peak Demand for private Commercial and Industrial Businesses 0 - 400 kW Peak Demand for public sector customers such as local, township, county, state and federal government facilities, public schools, community colleges, public universities, etc. Within the ComEd service territory and receive electricity over ComEd wires regardless of retail electric supplier Pay into the Energy Efficiency and Demand Response Adjustment (Rider EDA) information, billing data, and energy usage to Program Administrator, Contractors, and other approved third parties, as applicable, for the purposes of verifying Customer’s eligibility for participation in the Program; processing the Customer’s application; to verify equipment installation system operation and results; or as required to comply with state and/or federal law, fraud prevention, regulation, and other legal action; in those cases, ComEd, Program Administrator, Contractors and approved third parties shall comply with all legal requirements of the jurisdiction of the individual whose Customer data would be disclosed before making such disclosure. Project Eligibility Project requirements under the Program and this Offering include the following: • • • • • Projects that are NOT eligible for an incentive include, but are not limited to, the following: • • • • • • • • • • Projects must involve new equipment installed at an existing facility that results in a permanent reduction in electrical energy usage (kWh). Equipment must be installed and operational. Equipment must be new (not used or rebuilt, and not for resale) and used at the address for which savings are claimed. Resale of replaced equipment is expressly forbidden. Any measures installed at a facility must be sustainable and provide 100 percent of the energy benefits as stated in the application for a period of five years or for the life of the product, whichever is less. If the customer ceases to be a delivery service customer of ComEd, or removes the equipment or systems at any time during the five-year period or the life of the product, the customer may be required to return a prorated amount of incentive funds to ComEd. All accounts that an eligible large private energy customer has chosen to and been approved to opt out of the ComEd Energy Efficiency Program for the period beginning January 1, 2024 may not contribute to or participate in the ComEd Energy Efficiency Program as of January 1, 2024. On-site electricity generation (except as part of a qualifying Combined Heat and Power project) Projects involving gas-driven equipment in place of electric equipment (such as a chiller) Projects focused primarily on power factor improvement Projects that involve peak-shifting (and not kWh savings) Renewables Projects receiving funding for the same equipment through any other Energy Efficiency Portfolio (EEP) program offered by ComEd, Ameren, Nicor, Peoples or North Shore Used and/or refurbished equipment Projects for the sole purpose of implementing demand response measures Projects that repair or replace existing equipment with like equipment Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 4 525 Terms and Conditions (Continued) Application Review Process Program Administrator will review application submission packages for eligibility in the order received. Applicants who submit incomplete applications will be notified of their deficiencies upon review of the application, but could experience delays in the approval process until all requested information is submitted. Program incentives exceeding $50,000 for an account number will require additional review. Applicants are encouraged to call 855-433-2700 if they have any questions. Inspections ComEd reserves the right to inspect all projects to verify compliance with Program rules and verify the accuracy of project documentation. Upon reasonable notice by ComEd, Customer must agree to provide access to project documents and the facility where the efficiency measures were installed for a period of one year after project completion. Customer authorizes ComEd to verify the actual savings from the improvements installed by reviewing three years of billing and usage data pre-installation of the measures and two years post installation of the measures. Evaluation, Measurement and Verification The Program is evaluated annually by an independent third-party evaluator, as required by law. Customer’s completed project may be selected for evaluation. Depending on the nature of the project, evaluation may include measurement and verification (M&V), the process of monitoring, measuring and/or verifying data related to equipment operation and electrical consumption. Upon reasonable notice, Customer agrees to participate fully in the evaluation process by allowing access to the facility where the project took place and providing information and access to data required for M&V to the Program’s evaluator and/or to complete a customer survey. Project Costs For equipment replacement items, the costs listed are estimated costs for materials. Taxes and costs above this base for items such as vapor tight fluorescent fixtures or installation equipment, e.g. lifts, are to be discussed with the customer by the Contractor. Project scope may include additional items not incentivized or listed in this report, please refer to your Contractor for additional documentation for items outside of this report. Incentive payments are issued directly to the Contractor. Customer is responsible for payment of remaining balance to the Contractor. Toxic Materials Neither ComEd nor its Program Administrator shall have any responsibility for the discovery, presence, handling, removal, disposal of, or exposure to hazardous materials of any kind in connection with customer’s facility, including without limitation, asbestos, asbestos products, PCBs or any other toxic substances. All materials removed, including lamps and PCB ballasts, are required to be permanently taken out of service and disposed of in accordance with local codes and ordinances, and resale of replaced equipment is not allowed. Customer understands that its Contractor is responsible for recycling and disposal of old equipment in compliance with applicable codes or ordinances. (Information about hazardous waste disposal can be found at: www.epa.gov/epawaste/hazard/index.htm). Limitations of Liability IN NO EVENT WILL COMED AND PROGRAM ADMINISTRATOR, BE LIABLE FOR CUSTOMER’S FAILURE TO ACHIEVE A SPECIFIED AMOUNT OF ENERGY SAVINGS, THE OPERATION OF CUSTOMER’S FACILITIES, OR THE IMPLEMENTATION OF ENERGY CONSERVATION MEASURES AT CUSTOMER’S FACILITIES. IN NO EVENT WILL COMED OR PROGRAM ADMINISTRATOR BE LIABLE TO CUSTOMER FOR ANY LOST PROFITS, LOST SAVINGS OR INCIDENTAL, INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES, ARISING OUT OF CUSTOMER’S PARTICIPATION IN THIS OFFERING. Each party hereby agrees to defend, indemnify and hold harmless the other party, its consultants, contractors and subcontractors, and their respective officers, employees, agents, assigns, and successors- interest (“Indemnified Parties”) from and against any third party claims, damages, losses, liability, costs (including attorney’s fees and expenses) for bodily injury to any person (including death resulting therefrom) and property damage arising out of or in connection with the Program, except to the extent such claims, damages, losses, liability and costs are caused by the negligence or willful misconduct of the other party. Disclaimer Customer shall be entitled to the energy cost savings realized by the customer that result from the installation of ECMs at the customer’s site. In consideration of the services provided by ComEd as part of this Offering, the customer agrees that ComEd is entitled to 100% of the rights and benefits associated with the measures, including without limitation PJM products and all other attributes, credits or products associated therewith under any regional initiative or federal, state or local law, program or regulation, and customer waives, and agrees not to seek, any right to the same. Assessment Report Customer understands that the Assessment Report (“Report”) is provided by ComEd to assist Customer in making energy decisions and is for informational purposes only. The information in the Report is based on an on-site assessment of conditions observed at the facility address identified in Customer’s application, information provided by Customer and from ComEd, and industry standard practices and costs for similar projects. The amounts provided are estimates and may vary from actual results of installed measures. This Report is not to be construed as a design document and in no way implies approval of incentive amounts or pre-approval of Customer’s application. ComEd reserves the right to make final determination of customer eligibility, qualifying measures, system savings, project cost-effectiveness and final rebate amounts and the final incentive amount is based on approval of installed measures meeting all Program and Offering requirements. No Warranties Customer shall independently evaluate any advice or information offered by ComEd, Program Administrator or Contractors related to estimates of energy savings or project costs and is solely responsible for the selection and implementation of Energy Conservation Measures (ECMs). COMED AND PROGRAM ADMINISTRATOR MAKE NO WARRANTIES OR REPRESENTATIONS OF ANY KIND WITH RESPECT TO THE PERFORMANCE OR EFFECTIVENESS OF ANY POTENTIAL ENERGY OR COSTS SAVINGS, MEASURES IDENTIFIED, EQUIPMENT INSTALLED, Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 5 526 Terms and Conditions (Continued) Project Summary Tool ID: 064881 Total project cost: $17,430.55 Total incentives: $17,430.55 Final cost to customer: $0.00 Service Provider company name: Green Sky Consulting Customer Signature MEASURES IMPLEMENTED, AND/OR SERVICES RENDERED BY ANY PERSON OR ENTITY IN CONNECTION WITH THE PROGRAM. COMED AND PROGRAM ADMINISTRATOR DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, TO THE MAXIMUM EXTENT PERMITTED UNDER LAW, WHETHER STATUTORY OR OTHERWISE, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Governing Law This Agreement shall be exclusively governed by and interpreted in accordance with the laws of the state of Illinois, excluding choice of law rules. Any litigation between the parties shall be prosecuted only in the state or federal courts located in Cook County, Illinois. Program Changes ComEd reserves the right to modify, update, and amend the terms and conditions of the Program, including, but not limited to, making adjustments to incentive amounts, qualifying measures, and changing or cancelling the Program upon thirty (30) days written notice to Customer and/or Contractor. Pre-approved applications, for which the applicant has completed all Program requirements, will be processed to completion under the terms and conditions in effect at the time of the pre-approval by ComEd. Entire Agreement The terms and conditions set forth herein, including all attachments and incorporated references, constitute a complete statement of the terms and conditions applicable to Customer’s participation and supersede all prior representations or understandings, whether written or oral. By signing below, I certify that: 1. As the Customer Representative, I have the authority to bind the Customer to these terms. 2. Customer agrees to the installation of the improvements with the above installation quantities as specified in the Report and that Customer will install the specified product(s) at the facility. I have been informed of the installation costs of the specified products and acknowledge and agree that the products were selected at my discretion. 3. I have read, understand and agree to comply with the terms and conditions set forth in this Agreement. 4. I agree that if I remove the energy-saving improvements installed before a period of five years or the end of the product life, whichever is less, then I shall pay back a prorated amount of incentive funds (equal to the cost of the energy-saving improvement(s)) to ComEd based on the actual period of time in which the related equipment was installed and operating (or the full amount if the equipment was never installed). I understand that this is necessary to assure that the project’s related energy benefits will be achieved. 5. I consent to use of a third party service for purposes of electronically signing this Agreement and agree to be bound by electronic signature. Signature: Title: Printed name: Date: Company: Reproduction of this document without the express written consent of ComEd is prohibited and in violation of copyright laws. 6 Terms and conditions apply. Offers subject to change. Actual savings will vary by customer's energy usage and rate. The ComEd Energy Efficiency Program is funded in compliance with state law. © Commonwealth Edison Company, 2024. SBMAT-CR 041923-01527 Healing the Earth….One Step At A Time Healing the Earth….One Step At A Time PLAINFIELD REFERENCES Business Name: Village of Hinckley Contact Name: Russ Kula Contact Number: (815)-501-6101 Information: Just like the village of Plainfield, Hinckley called into the ComEd Energy Efficiency Program and were referred to GSC to do the work. Green Sky Consulting upgraded lights in their village hall, public works, sewers and wells, parking lots and streetlights. Business Name: Village of Huntley Contact Name: Jason Irvin Contact Number: (847)-515-5284 Information: Green Sky Consulting replaced all the lights in all of the village owned buildings. We started by replacing all the T-12 lights with T-8 lighting. Once LED became mainstream, we upgraded them from the T8 fixtures to LED fixtures. Buildings that we upgraded included the village hall, public works, the wells and sewers. Business Name: Resource Innovations Contact Name: Anthony Romano Contact Number: (773)-316-2259 Information: Resource Innovations is the company that is Implementing the ComEd Energy Efficiency program on behalf of ComEd. Anthony is the program manager. He has insight to every project Green Sky Consulting has performed under the program. He is a great resource to ask any questions not only about projects completed by GSC but also information regarding the program as well. You can ask Anthony about our performance and customer feedback. 528 MEMORANDUM To: Joshua Blakemore, Village Administrator From: Scott Threewitt, Director of Public Works Date: February 28, 2024 Re: PEMA Facility-Electrical, Plumbing, and Ventilation Work Background Findings As part of the design and construction of the new PEMA facility, certain items were not included in the original scope due to the allowable cost identified in the Public Private Partnership agreement for the development of the property. Recently, the Village Board approved the purchase of both a back-up generator and communication tower to allow the facility to function as designed. These improvements have been substantially completed and staff is requesting the approval to complete the remaining items which includes overhead natural gas heaters (and related plumbing work), overhead fans (and related electrical work), an evaporative cooler, and additional electrical capacity. Staff has researched various approaches to provide the necessary heat and airflow within the garage area and recommends the installation of large, industrial overhead fans for improved circulation along with overhead heaters which will provide additional heat in the winter when the oversized garage doors are open during emergency operations. To power the fans, additional electrical work is required as the fan supplier does not provide this work within their contract. The electrical work will also include installation of additional outlets and cord reels to support vehicle operations (battery tenders, etc.) which will allow further functionality of the facility. Numerous vendors were contacted to quote this work, but it was challenging to find a contractor that could complete all the individual components. Staff then divided the work into a scope for the heaters (generally plumbing contractor) and the electrical to obtain additional bids. The following are the proposals that were received: Overhead Heaters and Electric: Meade-$106,368.00 Overhead Heaters Only: Westside Mechanical-$46,550.00 Electrical Only: Elliott Electric-$49,210.00 Total for Westside Mechanical and Elliott Electric-$95,760.00 Overhead Fans and Evaporative Cooler (Proprietary): Big Ass Fans-$19,210.00 Policy Considerations According to Section 2-76(d)(5) of the Village Code of Ordinances, the Village Administrator shall make a recommendation to the President and Board of Trustees on purchases over the $10,000 statutory limit. The Board has the right to accept or reject any or all proposals. Financial Considerations Building improvements for the PEMA facility are funded through the Capital Improvement Fund under the line item for Building Improvements-PEMA (11-00-91-9105.007). Additionally, the Village will be applying for a $10,000 grant through ComEd’s Powering Safe Communities program to assist with the cost of the overhead fans. 529 Recommendation Staff recommends that the Village Board approve the proposal from Westside Mechanical for PEMA overhead heaters and related work in an amount not to exceed $46,550.00. Staff recommends that the Village Board approve the proposal from Elliott Electric for PEMA electrical upgrades and related work in an amount not to exceed $49,210.00. Staff recommends that the Village Board approve the proposal from Big Ass Fans for fans, evaporative cooler, and related work in an amount not to exceed $19,210.00. 530 WESTS|/DE MECHAN'CAI, GROUP , Februa ry 28,2024 Dave Doty Village of Plainfield RE: PEMA Plainfield / HVAC quote/ ADD supplemental infra-red tube heaters Gentlemen: Per your request we are pleased to quote the following installation Per request we are providing a quote to install 4 supplemental heaters (infra-red) for the PEMA call center in Plainfield t. Provide and install four infra-red tube heaters in between the doors, 2. Provide flue penetrations for each of the units. 3. Provide roof repair. By roofer) 4. Provide 110 V electrical connection at 4 locations. 5. Provide four thermostats with wiring down to column 5. Provide gas from existing gas pipe system with regulators (2#) to each of 4 units. 7. Startup and check for proper operation. 8. The total cost for this this installation would be S q5,550.00 Not included: Permits, fees, paintihB, Please feel free to call with any questions. Rega rd s, John S. Shaw Sales Engineer Westside Mechanical DB, LLC Naperville Office 2007 Corporate Lane I Naperville, lllinois 50553 | www.wsmech.com | 530.369.6590 531 e Date:2/26/2024 TO: Village of Plainfield L4400 S. Coil Plus Drive P la i nf ie ld, I L 60544 ATTN: Dave Doty ELECTRICylNc, 1600 S. Broadway Street Coal City, It 60416 Office 815-634-1 600 7 Fax 815-634-1603 JOBNAM E/LOCATTON Work at PEMA Building Scope work includes the following: o lnstall one 480 volt, 3 phase lo 72O|2OB volt, 3 phase, 45 kVa transformer with wall mount bracket near the existing transformer . lnstall a720/2OB volt, 3 phase, 125 amp main breaker, 30 circuit electrical panel o Power to originate at the MDP for the transformer and install a 480 volt, 3 phase, 50 amp breaker o lnstall one 7/r." conduit, fittings, wire, & supports to feed the panel o lnstall conduit, fittings, wire, and local disconnects near the final connection to the Big ASS Fans o lnstall and make final connections for the two VFD's that will control the fans o Terminate Fire Alarm cable installed by BAF at the Fire Alarm Panel o Conduit, fittings, and supports for various circuits in the vehicle bays for cord reels, general receptacles, and radiant heaters which includes local switch near heater final connection o Provide and install 10- Pass and Seymour 1000 series, with 50' corded receptacle, 20 amp cord reels with built in GFI reset/ protection, Model CRCD123G50R20, spec sheet attached o Cut in duplex receptacles in conference room and equipment room o Terminate and test all work o Aerial Platform Lift o Estimated lead time is 19 working days on the Electrical Panel Bid Price: S 49,210.00 (Forty Nine Thousand Two Hundred Ten Dollars and no cents) 532 eELECTRICvtNc 1600 S. Broadway Street Coal City, IL 60416 Office 815-634-1600 7 Fax 815-634-1603 Since re ly, Terms and conditions: No permits and fees. Bid is based on normal work hours Monday thru Friday Bid price is good for 30 days unless otherwise noted, > 533 MEADE Corporate Headq ua rters 625 Willowbrook Ctr Pk Willowbrook lL 50527 708-588-2500 (office) 708-588 -250L (Fax) www. meade 100.com S+9,959.89 522,27 4.47 .57,L72.64 February L9,2024 Dave Doty Building Maintenance Village of Plainfield L44OO S. Coil PIus Drive Plainfield, lllinois 60544 PEMA Building Electrical Upgrades Meade Est # 24-4322 Dear Dave We are pleased to provide this LUMP SUM proposal for the above-referenced project. Our quote is based upon the Scope of Work provided verbally in the walkdown and documents supplied on U3O/24. Our pricing for the following proposal is: One Hundred Four Thousand Three Hundred Sixty'Eight ond 00/700 Dollars..,,....., $7061368.00 Pricing Breakdown Electricol La bor ........ Material Eq u ip me nt. Mechanical H eaters & Gas Line .. Total Base Bid... .526,961.00 s106,358.00 Chicago Office 6850 W. 62nd Street Chicago, tL (r0(r38 773-287 -7600 (Off ice) 773-287-4407 (Fax) Hammond Office 174l Sumnrer Street Hantmond, [N 4(t320 219-939-4301 (Office) 219-939-4305 (Fax) Ntilwaukee Office 100 West Oklahoma Avenue Milwaukee, W[ 53207 Indianapolis Office 6057 Churchrnan ByPass Indianapolis, [N 4(t203 3L7 -780-0322 (Off ice) 3L7-780-0366 (Fax) SAFETY ,QUAT]TY.PERFORMAAICE . SINCE IgOt Re: 534 Scope of Work Proposal includes labor, supervision, materials, tools, and equipment necessary to furnish and install the electrical and mechanical scope of work per the provided drawings previously mentioned: 1. Supply and install new 45kVA transformer on West interior garage bay wall above existing panels. 2. Supply and install new 1504 Main Breaker Lighting Panel on interior West vehicle bay wall near office door with breakers. 3. lnstall conduit and wire as needed to power transformer and new panel from existing 480V panel. 4. Su pply a nd lnsta ll 4 new Natura I Gas Radia nt Heaters, gas regu lators, sh ut off va lves, thermostats, gas piping, conduit, and wiring as needed to render heaters fully operational. 5. lnstall electrical conduit and wiring to supply power and controls for 2 Overhead fans. 6. lnstall electrical conduit, wiring, receptacles, and cord reels to be mounted as outlined in supplied drawings. 7. lnstall conduit, wire, boxes, and receptacles in vehicle garage as outlined in supplied drawings. 8. lnstall additional receptacles in training room on West and South Walls as outlined in supplied drawings. 9. Relocate or add receptacles in radio room and lT room. 10. Perform all testing to verify installation. Clarifications 1. Proposal assumes village representative will be present to grant building access daily throughout construction. 2. Proposal assumes village representative will be present to move vehicles as needed for ceiling access, when applicable. 3. Proposal assumes Meade will be notified of any training, classes, meetings, or events at facility which may interfere with construction 1 week prior as to allow for execution planning and not cause delays or break in continuity, 4. Proposal assumes village will supply ceiling fans which will be mounted by others. No allowances are included in this proposal for the mounting of bay overhead fans, or assembly of blades. 5. Proposal assumes isolation of electrical 480V panel will be allowed for the purpose of electrical connection of new transformer. 6. Due to lack of detail, spare breakers in new panel will be determined based upon a 20% sparing standard consisting of 20 and 30 amp breakers. 7. Proposal does not include any repairs, modifications, or alterations of any existing system not detailed in this proposal, nor does it include any allowances for findings or discovery that may affect installation. Chicago Office 6850 W. 62n'r Street Chicago, IL (r0(r3tt 773-287 -7600 (Off ice) 773-287-4407 (Fax) Hammond Office 174l Summer Street Hanrmond. IN 46320 2t9-939-4301 (office) 219-939-4306 (Fax) Ntilrn'aukee Office 100 West Oklahoma Avenue Milwaukee. WI *2A7 Indianapolis Office 6057 Churchman Bypass Indianapolis, IN 46203 3L7 -78a-0322 (office) 3L7-780-0366 (Fax) 535 General Qualifications L. Quote is based on a 4O-hour workweek, Monday thru Friday 7:00am to 3:30pm. No overtime has been included in this proposal. 2. Quote does not include cost for schedule compression. lf the schedule is compressed, due to no fault of Meade, we will treat the compression as an out of scope item and bill accordingly. 3. Quote assumes that all out of scope work or additional work will be priced and approved prior to execution. Work that is deemed not in our scope will halt until change orders are approved in writing and received by Meade. 4. Quote does not include cost for delays, which are not in our direct control. Any delays, of this type, that we encounter will be treated as out of scope items and billed accordingly. 5. Due to extreme volatility in the price and delivery schedule of material in general, but especially PVC, steel, and copper, we can only guarantee pricing for 14 days from the date of submission. All other pricing is valid for 30 days. 6. Due to the current supply chain challenges, we cannot guarantee availability or timely delivery of any material or equipment. 7. Liquidated damages or penalties are not included. 8. Permits and bonds are not included. Thank you for the opportunity to prepare this proposal. lf you have any questions or concerns, please feel free to contact me. Sincerely, Brian Eaton Project Manager Meade lndustries, lnc. (81s) 7s L-3286 beaton @ meade100.com Chicago Office 6850 W. 62nd Street Chicago, IL 60638 773-287-7600 (Office) 773-287'4407 (Fax) Hammond Office 171l Summer Street Hammond. tN'16320 21,9 -939 -43 0 1 ( Off i ce ) 2t9-939-4306 (Fax) Milwaukee Office 100 West Oklahoma Avenlle Milwaukee, WI 53207 Indianapolis Office 6057 Churchman Bypass Indianapolis. IN 46203 3L7 -780-0322 (Off ice) 3L7-780-0366 (Fax) 536 QUOTE NUMBER: PROPOSAL THE ULTIMATE AIRFLOW SOLUTION For more than 20 years, Big Ass Fans has set the standard for safer, more comfortable work conditions with airflow products purpose-built to excel in demanding environments. Our fans provide year-round relief from extreme temperatures, making people feel up to 10 °F (6 °C) cooler in summer and effectively circulating heated air in winter. Engineered for efficient, maintenance-free operation and backed by unbeatable warranties, Big Ass fans deliver powerful airflow that keeps workers refreshed and productive. With a custom solution from Big Ass Fans, your business will reap the rewards of comfort and cost-savings for years. Contact: Email: Phone: (877) 244-3267 | BIGASSFANS.COM An ISO 9001:2015 compliant company | ©2020 Delta T, LLC dba Big Ass Fans. All rights reserved. Prince Stewart Plainfield Police Department (859) 977-7934 prince.stewart@bigassfans.com 00941629 537 00941629 Quote Information Quote Number 00941629 Created Date 1/30/2024 Expiration Date 2/29/2024 Bill To Name Plainfield Police Department Ship To Name Plainfield Police Department Bill To: 14805 Woodfarm Rd Plainfield, IL 60544 US Ship To: 14805 Woodfarm Rd Plainfield, IL 60544 US SFDC ID 10985915 General Information Sales Rep Prince Stewart Contact Name Anthony Novak E-mail prince.stewart@bigassfans.com Contact Phone (815) 436-6544 Phone (859) 977-7934 Fax 859-233-0139 Comments Comments Sales Tax Sales Tax is strictly an estimate and may change based on the shipping address of the order; sales tax is also subject to the tax provisions of the “STANDARD TERMS.” Product Description Qty Total Price Ceiling Fan Kit, Basic 6, 16', 400-480V/3PH, 2.0HP, >725W - Basic 6/PF8/PP8 Short Standard Industrial Mount Kit, 5-9 7/8" Beam Mount - Wired Standard Control 2 $8,587.50 Evaporative Cooler, Cool-Space 400, 36", 120V/1Ph, 60Hz 1 $3,499.00 - Industrial Overhead Fan, Mechanical installation, First Fan, with lift, Zone 3 (AK, CA, CT, DC, HI, IL, MA, ME, MN, ND, NH, NJ, NV, NY, OR, RI, SD, VT, WA, WI) - Industrial Overhead Fan, Mechanical installation, Additional Fan, Zone 3 (AK, CA, CT, DC, HI, IL, MA, ME, MN, ND, NH, NJ, NV, NY, OR, RI, SD, VT, WA, WI) - Installation Adder, Fire Relay Install and Wire (BAF will not tie into fire panel), First Fan - Installation Adder, Fire Relay Install and Wire (BAF will not tie into fire panel), Additional Fan 2 $6,223.50 Subtotal: $18,310.00 Tax: Estimated Shipping: $ 0.00 $900.00 Grand Total: $19,210.00 538 STANDARD TERMS - NET 30 DAYS UPON APPROVAL Shipping and handling is an estimate. Our proposals include an estimate of applicable itemized sales taxes which Big Ass Fans is legally obligated to collect and remit. The final, actual amount of such taxes would only be known at the time the customer is actually invoiced for the order. All products are subject to Big Ass Fans return policy. For full details visit bigassfans.com/returns The Buyer must insure that product specifications are consistent with actual field installation requirements. Big Ass Fans product recommendations are based on product specifications as transmitted to the company. As such, Big Ass Fans is not responsible for inaccuracies between the communicated product specifications and actual field installation requirements. The Buyer of the specified products assumes responsibility for the cost of returning or exchanging specified product where specified product does not meet field requirements. Any variations to product types or quantities (or omissions of existing light fixtures during the survey process – and now not represented in project) will be considered “add-on” and an additional material requirement. These add-on materials will be priced separately. Big Ass Fans customers who have been approved for term credit and are invoiced for their orders may pay their invoice through one of our customary term credit payment methods of: Check, money order, wire transfer or ACH payment. Any such term credit approved customers who subsequently elect to pay their term invoice by credit card will also be charged a convenience fee for doing so. The exact amount of the convenience fee will be communicated to the customer before the transaction is processed and the card is charged. The Fee is calculated by multiplying the amount sought to be charged to the credit card by .03. (Fee = .03 x Total Amount Paid). If the customer elects not to pay the convenience fee, the customer may use one of the other payment channels alluded to above, free of charge. Customer is responsible for paying all applicable state and local transactional taxes resulting from the sale. As a manufacturer of tangible personal property registered to do business in all 50 US States, Big Ass Fans is obligated to collect and remit applicable sales taxes and the transaction will be treated and reported as the sale of tangible personal property sold by a manufacturer. To the extent that the Buyer takes any contrary position with any taxing authority subsequent to this transaction which results in additional and/ or different transaction-based taxes for which Big Ass Fans is responsible, Big Ass Fans reserves the right to apply any sales tax collected to any such additional taxes due and/or invoice the Buyer for any other additional amounts due. Additionally, to the extent that applicable transactional taxes were not collected at the time of sale in reliance upon an Exemption Certificate or other exemption later found to be inapplicable by Big Ass Fans, in the exercise of its sole and absolute discretion, Big Ass Fans will invoice Buyer for any applicable sales or other transactional taxes. Buyer covenants and agrees to promptly pay any such amounts to Big Ass Fans on the same terms and conditions as any other amounts owed to Big Ass Fans on the applicable Order. The transaction and contract that is the subject of this Proposal shall be governed by the internal laws of the Commonwealth of Kentucky. Any controversy or claim arising out of or relating to this contract, or the breach thereof, shall be settled by arbitration administered by the American Arbitration Association in accordance with its Commercial Arbitration Rules, and judgment on the award rendered by the arbitrator(s) may be entered in any court having jurisdiction thereof. Upon sales agreement being signed and submitted, order shipment date changes may not be submitted or changed by the purchasing party within 10 business days of scheduled shipment. Scheduled shipment dates may not be changed within the final 10 business days of a given month.Should a customer require that a shipment date be changed within 10 business days or scheduled shipment or within the final 10 business days of a given month, Big Ass Fans reserves the right to decline the customer's request. Secondarily, Big Ass Fans reserves the right to charge a monetary fee for any shipment date change request that falls within the representative windows described above. Reconsignment fees are as follows: $50 for small diameter fan orders and $500 for large overhead orders. Evaporative Cooler (Cool-Space) orders are not able to be canceled outside of the same business day in which purchase has been confirmed. Customer assumes responsibility for all necessary reconsignment fees related to shipping &/or freight charges as a result of canceled orders completed outside of the hours of 8:00AM to 5:00PM EST on the same business day purchase occurs. This Proposal and its Associated Terms may not be modified or added to, except by a subsequent writing executed by Big Ass Fans. PURCHASING OR USING ANY OF OUR PRODUCTS & SERVICES INDICATES YOU AGREE WITH OUR TERMS OF SERVICE AND PRIVACY POLICY. (FOR FULL WARRANTY, TERMS, AND CONDITIONS FOR ALL BIG ASS PRODUCTS, VISIT BIGASSFANS.COM) INTELLECTUAL PROPERTY Big Ass Fans retains exclusive ownership of all intellectual property rights embodied by and/or associated with the products sold. Notwithstanding any provision to the contrary, neither party shall be liable to the other party (or any third party) for indirect, consequential, special, incidental, or punitive damages arising from the sale of the products or this agreement. In addition, seller’s total aggregate liability under this agreement shall never exceed the value of the purchase order or the previous twelve (12) months of sales hereunder, whichever is less. This provision shall survive the expiration of termination of this agreement. $19,210.0000941629 539 CLIENT Signature Signature DatePrinted Name DatePrinted Name ACCOUNTS PAYABLE (BILLING) ADDRESS: IS THE BILLING ADDRESS ABOVE CORRECT? Y / N If this address is incorrect, please provide correct information below: Company Name: Contact Name: Billing Address: City, State, Zip: Email: Phone:DUNS #: CUSTOMER CONTACT INFORMATION PLEASE CONFIRM AND COMPLETE ALL BILLING AND SHIPPING INFORMATION FOR YOUR ORDER. If your organization requires a purchase order, please provide the PO number here: Please provide any available PO documentation to your BAF sales representative. SHIPPING ADDRESS: IS THE SHIPPING ADDRESS ABOVE CORRECT? Y / N If this address is incorrect, please provide correct information below: Company Name: Contact Name: Shipping Address: City, State, Zip: Email: Phone: If this purchase is tax exempt (e.g., 501(c)(3), 509(a), Section 527, registered resellers), you must provide a valid tax exemption certificate to your BAF sales representative. BIG ASS FANS dl.shipcontact.1 dl.shipaddressnew.1 dl.billingaddress.1 dl.datesign.2 dl.shipemail.1 dl.ponum.1 dl.billaddress.1 dl.dbnumber.1 dl.shipcitystatezipnew.1 dl.billphone.1 dl.shipcompany.1 14805 Woodfarm Rd, Plainfield, IL, 60544, US dl.apcontact.1 dl.signhere.2 dl.fullname.2dl.fullname.1 $19,210.00 dl.apcompany.1 dl.datesign.1 dl.shipphone.1 00941629 dl.shippingaddress.1 dl.billemail.1 dl.signhere.1 dl.billcitystatezip.1 14805 Woodfarm Rd, Plainfield, IL, 60544, US 540 BASIC 6® Conquer extreme temperatures and stagnant air with the economical Basic 6. Its durable design and smooth, powerful performance keep challenging work conditions from holding your business down. Backed by Big Ass Fans’ world- class customer support and in-field services, Basic 6 is your best entry-level option for airflow that sets your people up for success. KEY FEATURES DISCOVER MORE ABOUT BASIC 6 Learn more at bigassfans.com/basic-6 or call 877.BIG.FANS for a free custom quote. Six aluminum airfoils with winglets and safety restraints Sealed helical gearbox and industrial motor for smooth, durable operation Machine-cut hub system evenly distributes load and promotes long life Redundant safety features keep workers cool without worry Variable speed operation with convenient digital touchscreen controller Wide airflow coverage improves existing HVAC efficiency 8–24 FEET (2.4–7.3 METERS) DIAMETER INDUSTRIAL GRADE WITH DOUBLE LIP-SEALED GEARBOX MOTOR UP TO 7 YEARS MECHANICAL UP TO 3 YEARS ELECTRICAL WARRANTY I-BEAMS, BAR JOISTS, SOLID BEAMS, AND PURLINS MOUNTING 541 Technical SpecificaTionS USA BIGASSFANS.COM 877-244-3267 CANADA BIGASSFANS.COM 844-924-4277 AUSTRALIA BIGASSFANS.COM/AU 1300 244 277 SINGAPORE BIGASSFANS.COM/SG 65 6709 8500 MALAYSIA BIGASSFANS.COM/SG 603 5565 0888 Basic 6 Specifications subject to change without notice.© 2018 Delta T LLC dba Big Ass Fans. All rights reserved. | BC6-MKTG-150-ENG-01 REV. H | 03/26/21 USA BIGASSFANS.COM 877-244-3267 CANADA BIGASSFANS.COM 844-924-4277 AUSTRALIA BIGASSFANS.COM/AU 1300 244 277 SINGAPORE BIGASSFANS.COM/SG 65 6709 8500 MALAYSIA BIGASSFANS.COM/SG 603 5565 0888 MADE TO MOVE AIR, PLAIN AND SIMPLE Technical Specifications Diameter (A)Weight1 Max Speed Input Power and Required Breaker Motor Horsepower Airfoil Clearances Max Operating Temperature 8 ft (2.4 m)124 lb (56.2 kg)191 RPM 100–125 VAC, 50/60 Hz, 1 Φ, 15 A 200–240 VAC, 50/60 Hz, 1 Φ, 15 A 200–240 VAC, 50/60 Hz, 3 Φ, 10 A 400–480 VAC, 50/60 Hz, 3 Φ, 10 A 575–600 VAC, 50/60 Hz, 3 Φ, 10 A 1.0 hp (0.75 kW) 2 ft (0.6 m) on sides 4 ft (1.2 m) below ceiling 104°F (40°C) 10 ft (3 m)135 lb (61.2 kg)148 RPM 12 ft (3.6 m)185 lb (83.9 kg)135 RPM 200–240 VAC, 50/60 Hz, 1 Φ, 25 A 200–240 VAC, 50/60 Hz, 3 Φ, 15 A 400–480 VAC, 50/60 Hz, 3 Φ, 10 A 575–600 VAC, 50/60 Hz, 3 Φ, 10 A 1.5 hp (1.1 kW) 2 ft (0.6 m) on sides 5 ft (1.5 m) below ceiling14 ft (4.3 m)192 lb (87.1 kg)110 RPM 16 ft (4.9 m)204 lb (92.5 kg)98 RPM 2.0 hp (1.5 kW) 2 ft (0.6 m) on sides 6 ft (1.8 m) below ceiling18 ft (5.5 m)210 lb (95.2 kg)86 RPM 20 ft (6.1 m)217 lb (98.4 kg)76 RPM 2 ft (0.6 m) on sides 7 ft (2.1 m) below ceiling24 ft (7.3 m)231 lb (104.8 kg)61 RPM Construction Features Airfoils Motor and Drive3 Certifications Mounting Multi-Point Safety4 Colors Six patented Powerfoil airfoils (mill finish) Powerfoil winglets eliminate wind noise (BAF yellow) Industrial-grade motor and gearbox feature inline helical-cut gears for efficient, durable, and reliable operation; lubricated for life with synthetic oil Onboard NEMA 4X VFD eliminates RFI and EMI noise UL Standard 507 and CSA Standard 22.2 No. 113 Standard upper mount installs to I-beams and bar joists Optional kits allow for mounting to solid beams and purlins Double safety cable system, airfoil retainers, hub safety clips, Grade 8 hardware, fire relay, guy wires, and airfoil restraint system Standard colors are silver and yellow. Individualize your fan with one of our classic color upgrades, or work with our design consultants to create a shade that’s all your own. Standard Controller Construction Controls Made from durable UV-resistant materials Rated IP55 Intuitive touchscreen interface On/Off and variable speed control Password protection Powered by fan drive Lead times may vary. See full warranty for coverage information. Standard Controller Height: 4.86 in. (123 mm) Width: 4.54 in. (115 mm)Depth: 1.3 in. (29 mm) ¹ Weight does not include mount or extension tube.2 Measure the distance from the tip of the winglet to the ceiling or major obstruction.3 The VFD is not preinstalled on the fan. Mounting the VFD onboard the fan requires field installation.4 Airfoil restraint system comes standard on 20 –24 ft (6–7.3 m) fans and is an option for smaller diameter fans. The fire relay must be wired during install if required by local code. Guy wires are included with fans that have extension tubes 4 ft (1.2 m) or longer. Standard Controller Specifications subject to change without notice. A 24 in. (610 mm) 46.5 in. (1181 mm) 29 in. (737 mm) Pictured with 1 ft (305 mm) extension tube 542 COOL-SPACE® 400 Complex facilities with changing layouts can be nearly impossible to cool. With an improved motor and updated blade design, Cool-Space® 400 delivers portable, powerful heat relief to facilities, warehouses, and outdoor spaces. Featuring a coverage area of 3,600 square feet and GREENGUARD Gold-certified cooling media, Cool-Space 400 brings rapid, reliable cooling comfort without compromise. KEY FEATURES Quickly cool indoor and outdoor spaces by up to 33° F (18° C) A re-designed motor and new aerodynamic fan blades deliver more efficient Ideal for large factories, warehouses, and fitness centers Available push/pull bar kit for additional ergonomic portability 46-gallon (174-liter) reservoir lasts up to 10 hours without hose connection 36-inch (91-centimeter) fan diameter Optional All-Terrain version includes off-road tires and push/pull bar DISCOVER MORE ABOUT COOL-SPACE Learn more at bigassfans.com/evaporative-coolers/cool- space-400/ or call 877.BIG.FANS for a free custom quote. UP TO 10,000 CFM AIRFLOW 110 VAC OR 230 VAC VOLTAGE UP TO 3,600 SQUARE FEET (334 SQUARE METERS) COVERAGE AREA VARIABLE SPEED CONTROL 543 Technical SpecificaTionS USA BIGASSFANS.COM 877-244-3267 CANADA BIGASSFANS.COM 844-924-4277 AUSTRALIA BIGASSFANS.COM/AU 1300 244 277 SINGAPORE BIGASSFANS.COM/SG 65 6709 8500 Cool-Space® 400 Technical Specifications Model Ordering Information Input power and required breaker Amperage1 Drive Motor Weight Water Capacity Inlet Water Supply Pressure Environment2 Airflow and Coverage Sound Level3 Operating Temperature Cool-Space 400 E-400-3601 E-400-3602 120 VAC, 60 Hz, 1Φ, 15 A 220/230 VAC, 50/60 Hz, 1Φ, 10 A 8.75 A 5.52 A Variable Speed 0.67 hp (0.5 kW) 220 lb (99.8 kg) 46 gal (174 L)120 PSI Max Well-ventilated Indoor or outdoor space Up to 10,000 cfm 3,600 sq ft 61 dBA 0 to 104 °F (-18 to 40 °C) Construction Housing Motor Power Supply Water Supply Cooling Media Maintenance UV-resistant roto-molded polyethylene housing Four swivel casters (two locking) High-efficiency, totally enclosed 10 ft (3 m) power cord plugs into standard electrical outlet Cord wrap for easy storage Accepts standard garden hose or portable supply tank Water level regulated by float valve Low-water shutoff for pump longevity Made from thick cross-corrugated, angle-fluted formulated cellulose Treated with thermosetting resin for strength and prevention of algae Accessible reservoir cap for convenient water treatment access Drain plug and flush valve for water removal Lead times may vary. See full warranty for coverage information. Specifications subject to change without notice.© 2023 Delta T LLC dba Big Ass Fans. All rights reserved. | EVA-MKTG-229-ENG-01 REV B | 05/03/23 70 in. (1778 mm) 62 in. (1575 mm) 31 in. (787 mm) 36 in. (914 mm) DELIVER COOLER CONDITIONS AT A MOMENT’S NOTICE Onboard Variable Speed Control 1 Maximum amperage includes both the fan and pump ratings. 2 Not suitable for salt air environments.3 Fans are sound tested in a laboratory environment. Actual results in field conditions may vary due to sound reflecting surfaces and environmental conditions. 544 © 2019 Delta T LLC dba Big Ass Fans. All rights reserved. | BAF-SOW-32-ENG-01 Rev. B | 07/29/22 MECHANICAL SCOPE OF WORK Industrial Overhead Fans This document is a reference tool only. Please consult the installation guide for complete installation instructions and safety guidelines. GENERAL • Includes regular working hours from 7 a.m. to 5 p.m., Monday through Friday. After hours charges will apply. • If applicable, bridge cranes in or near fan installation area must be locked out during fan installation. • To activate warranty coverage, Check-In and Close-Out forms must be completed and returned to Big Ass Fans. • Whether provided by Big Ass Fans or the customer, the lift must be an OSHA-approved, two-man scissor lift, unless otherwise specified. • If the lift is provided by the customer, but is unavailable or in an unsafe condition, Big Ass Fans will order a replacement lift and the customer will be charged for its usage, as well as any resulting downtime. • Angle iron or other steel added by the installer in commercial or finished (non-industrial) spaces will be painted to match by the installer. • Wasted trips or delays caused by the customer, including timely access to work area(s), timely delivery of fans to the installers, fan/controller placement indecision, and incomplete customer responsibilities, will result in extra charges. NOT INCLUDED IN THIS SCOPE OF WORK • Use of scaffolding, all-terrain lifts, articulated boom lifts, or specialty lifts • Clean-up or rework of existing electrical infractions • Additional local disconnecting means adjacent to the fan • Welding or additional structural reinforcement • Structural engineering charges • Fire alarm tie-in at the fire control panel • Electrical work in EMT or conduit • Repair/replace any type of fireproofing material • Removal/reinstallation of ceiling tiles • Cutting into or repairing finished ceilings • Relocation of obstacles, such as light fixtures, electrical conduits, gas lines, water lines, sprinkler lines, etc. • Any permits or inspections • Any other requirements beyond details in this Scope of Work The installation of HVLS fans in buildings equipped with sprinklers, including ESFR sprinklers, shall comply with the following: • The HVLS fan shall be centered approximately between four adjacent sprinklers. • The vertical distance from the HVLS fan to sprinkler deflector shall be a minimum of 3 ft (0.9 m). • All HVLS fans shall be interlocked to shut down immediately upon receiving a water flow signal from the alarm system in accordance with the requirements of NFPA 72. WARNING: To reduce the risk of electric shock, wiring should be performed by a qualified electrician! Incorrect assembly can cause electric shock or damage the motor and the controller! WARNING: Fan installation must be in accordance with the National Electrical Code, ANSI/NFPA 70, and all local codes. Failure to comply with these codes could result in personal injury or property damage. CAUTION: The Big Ass Fans product warranty will not cover equipment damage or failure that is caused by improper installation by customer. WARNING: The fan should not be installed unless the structure on which the fan is to be mounted is of sound construction, undamaged, and capable of supporting the loads of the fan and its method of mounting. Verifying the stability of the mounting structure is the sole responsibility of the customer and/or end user, and Big Ass Fans expressly disclaims any liability arising therefrom, or arising from the use of any materials or hardware other than those supplied by Big Ass Fans or otherwise specified in the installation instructions which can be found in the installation manual. CUSTOMER RESPONSIBILITY — MUST BE COMPLETED PRIOR TO BIG ASS FANS’ ARRIVAL • Obtain all required electrical permits and inspections. • Receive and store the fan shipment in a safe, dry place until installation. • Install wiring per NEC between the power source and junction box within 5 ft (1.5 m) of the fan mounting location. Power must be live before the installation is started. Return trip to commission the fan(s) will result in extra charges. • IF FIRE RELAY INSTALL NOT PURCHASED: Install fire wire per NEC from the fire control panel to the contact relay at the VFD location. • Final tie-in to the fire panel. The provided relay requires 20―32 VDC to energize. • If BAFCON controller is purchased for Basic 6/Powerfoil 8, provide NEMA-specified receptacle at the fan controller location. • If LED kit is purchased for Powerfoil D/Powerfoil X4.0, provide AC powered lighting circuit within 3 linear feet of fan mounting location. BIG ASS FANS RESPONSIBILITY • Make the electrical connection between the customer-installed junction box and the onboard VFD or fan electronics board. • Assemble and mount the complete fan kit to the building structure, including safety cables. • PIVOT 2.0: Attach and secure all cage brackets, and adjust the pivot joint to the desired fan direction. • Install the wall-mounted digital controller to an accessible surface (column, concrete wall, or wood) within 150 ft (45.7 m) of the fan, and run the wire connection to the VFD in EMT conduit to eave height. • IF FIRE RELAY INSTALL NOT PURCHASED: Install a contact relay at the VFD location. (If fire relay is purchased, refer to the Fire Relay Scope of Work.) • Fan startup and operational training. 545 © 2019 Delta T LLC dba Big Ass Fans. All rights reserved. | BAF-SOW-38-ENG-01 Rev. C | 04/10/23 SCOPE OF WORK Fire Relay This document is a reference tool only. Please consult the installation guide for complete installation instructions and safety guidelines. GENERAL • Includes regular working hours from 7 a.m. to 5 p.m., Monday through Friday. After hours charges will apply. • If applicable, bridge cranes in or near fan installation area must be locked out during fan installation. • To activate warranty coverage, Check-In and Close-Out forms must be completed and returned to Big Ass Fans. • Whether provided by Big Ass Fans or the customer, the lift must be an OSHA-approved, two-man scissor lift, unless otherwise specified. • If the lift is provided by the customer, but is unavailable or in an unsafe condition, Big Ass Fans will order a replacement lift and the customer will be charged for its usage, as well as any resulting downtime. • Angle iron or other steel added by the installer in commercial or finished (non-industrial) spaces will be painted to match by the installer. • Wasted trips or delays caused by the customer, including timely access to work area(s), timely delivery of fans to the installers, fan/controller placement indecision, and incomplete customer responsibilities, will result in extra charges. NOT INCLUDED IN THIS SCOPE OF WORK • Additional labor or materials needed if fire alarm panel is located in another tenant’s suite/area of the building that is not owned or leased by the customer • Use of scaffolding, all-terrain lifts, articulated boom lifts, or specialty lifts • Clean-up or rework of existing electrical infractions • Additional local disconnecting means adjacent to the fan • Welding or additional structural reinforcement • Structural engineering charges • Housing fire wire in EMT or rigid conduit • Additional wiring or work required for addressable fire systems • Repair/replace any type of fireproofing material • Removal/reinstallation of ceiling tiles • Cutting into or repairing finished ceilings • Relocation of obstacles, such as light fixtures, electrical conduits, gas lines, water lines, sprinkler lines, etc. • Preliminary work for electrical permit, e.g., layouts or additional visits • Any permits or inspections • Any other requirements beyond details in this Scope of Work The installation of HVLS fans in buildings equipped with sprinklers, including ESFR sprinklers, shall comply with the following: • The HVLS fan shall be centered approximately between four adjacent sprinklers. • The vertical distance from the HVLS fan to sprinkler deflector shall be a minimum of 3 ft (0.9 m). • All HVLS fans shall be interlocked to shut down immediately upon receiving a water flow signal from the alarm system in accordance with the requirements of NFPA 72. WARNING: To reduce the risk of electric shock, wiring should be performed by a qualified electrician! Incorrect assembly can cause electric shock or damage the motor and the controller! WARNING: Fan installation must be in accordance with the National Electrical Code, ANSI/NFPA 70, and all local codes. Failure to comply with these codes could result in personal injury or property damage. CAUTION: The Big Ass Fans product warranty will not cover equipment damage or failure that is caused by improper installation by customer. WARNING: The fan should not be installed unless the structure on which the fan is to be mounted is of sound construction, undamaged, and capable of supporting the loads of the fan and its method of mounting. Verifying the stability of the mounting structure is the sole responsibility of the customer and/or end user, and Big Ass Fans expressly disclaims any liability arising therefrom, or arising from the use of any materials or hardware other than those supplied by Big Ass Fans or otherwise specified in the installation instructions which can be found in the installation manual. CUSTOMER RESPONSIBILITY — MUST BE COMPLETED PRIOR TO BIG ASS FANS’ ARRIVAL • Receive and store the fan shipment and any required fire relay parts in a safe, dry place until installation. • Provide switched 20–32 VDC power from the fire control panel. • Final tie-in of the fire alarm cable at the fire control panel and any programming required (to be completed after fans installed). BIG ASS FANS RESPONSIBILITY • Install fire alarm cable (per NEC Article 760) from the fan VFD to the next fan in the chain or to within 5 ft (1.5 m) of fire alarm panel (for the last fan in the chain), not to exceed 250 linear feet (76.2 linear meters). • Install protective conduit from the fire relay location to ceiling height (where applicable with an offboard VFD) and free-air installation of fire alarm cable at ceiling height, per NEC. • Verify fire relay operation using temporary power. 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 PLAINFIELD POLICE DEPARTMENT Memo To: From: Date: Subject: John Argoudelis, Village President Joshua Blakemore, Village Administrator Village Trustees Robert Miller, Chief of Police Wednesday, February 7 2024 Operations Report- December 2023 The following pages contain the Monthly Operations Report for the month of December 2023: Shop with a Cop Plainfield Target Thursday, December 21, 2023 Revenue Summary Page 2 Vehicle Report Page 2 Training Report Page 3 Dispatch Activity Page 4 Arrest Reports Page 5-7 Case Status Reports Page 8-16 Monthly Offenses Reported Page 17-26 Page 1 of 26December 2023 Operations Report 572 PLAINFIELD POLICE DEPARTMENT Operations Report 2021 2022 2023 Monthly Vehicle Report: December Average Miles Per Gallon 9.25 9.05 8.67 Gallons of Gasoline Used 4,077.60 4,283.30 3,871.70 Miles Driven 37,722 38,769 33,573 Monthly Maintenance*$11,600.38 $12,010.88 $7,639.20 *Vehicle maintenance is reported as an expense based upon the calendar date paid; therefore is not necessarily representative of the date the maintenance was performed, billed, nor the budget month applied. Payment Category FINES - Fines/Forfeitures Payment Category PERMITS - Permits 2021 2022 2023 *Red Light Camera Fines and Will and Kendal County fines were received by the counties in November, but were received by Plainfield in December. These numbers are delayed due to the timing of payment processing relative to this reports publication. *Red light Camera Violations includes all transactions receipted by Plainfield and not solely the Police Department. Reporting month timing changed in the 12/2021 report for Red Light months. Monthly Revenue Summary: December Payment Category FEES - Fees and Services Administrative Ticket $10,985.00 $13,355.00 $8,350.00 Administrative Ticket-Late Fee $540.00 $730.00 $740.00 Alcohol Enforcement Fine $2,769.00 $1,465.50 $734.50 Daily Storage Fee $0.00 $1,230.00 $420.00 Impound Fees $5,000.00 $4,000.00 $4,000.00 Kendall County Court Fine*$140.94 $0.00 $0.00 Red Light Camera Violations*$38,000.00 $31,800.00 $37,900.00 Will County Court Fine*$23,881.63 $29,447.45 $31,998.82 $81,316.57 $82,027.95 $84,143.32 Accident/Insurance Reports $315.00 $1,370.00 $195.00 Fingerprint Fee $80.00 $100.00 $100.00 Freedom of Information Fee $1.25 $8.00 $18.55 Offender Registration Fee $200.00 $120.00 $20.00 Copies, Maps, Etc.$0.00 $0.00 $0.00 $596.25 $1,598.00 $333.55 Solicitors Permit $50.00 $0.00 $50.00 $50.00 $0.00 $50.00 $81,962.82 $83,625.95 $84,526.87Total Page 2 of 26December 2023 Operations Report 573 PLAINFIELD POLICE DEPARTMENT Training Activity LocationCourse TitleClass DateEmployee Hours Each December 2023 Training Report Total Hours Janis 12/1/2023 12 Professional Administrative Certification of Excellence Online Course / ASAP12 Friddle, Martin, Robles 12/1/2023 8 ILEAS MFF24 Scapardine 10/2-12/22/23 60 Essential Skills II Online Course60 Choi 10/2-12/22/23 60 Crime Analysis for Small Jurisdictions 5960 Ostreko 12/4/2023 Supervising & Managing the Field Training Process New Lenox PD/TR Bayless, Mikos 12/14/2023 8 Juvenile Interrogation & Delinquency Update New Lenox PD/TR16 C. Sester 12/16/2023 10 Negotiator Training Joliet SOS10 Mulacek, Bayless 12/13/2023 10 Joliet SOS20 Klier, Columbus 12/21/2023 8 Kendall Counry SRT16 218Total Training Hours for December 2023: Page 3 of 26December 2023 Operations Report 574 PLAINFIELD POLICE DEPARTMENT Dispatch Activity Zone*2021 2022 2023 December Zone Incident Comparison Report PCW 1761 52 42 Z1 610 549 570 Z2 418 370 360 Z3 688 810 719 Z4 466 463 454 Z5 89 88 84 Z6 4 7 3 0 500 1000 1500 2000 PCW Z1 Z2 Z3 Z4 Z5 Z6 2021 2022 2023 4036 2339 2232TOTAL** *PDF/PCW/WC is used when an incident is out of the village, or when the dispatcher does not validate the address. **Total incidents includes all CAD created incidents, including all Service Calls, Traffic Stops, Information only Calls, Etc. 0 50 100 150 200 250 300 0100200300400500600700800900100011001200130014001500160017001800190020002100220023002021 2022 2023 *Total incidents includes all CAD created incidents, including all Service Calls, Traffic Stops, Information only Calls, Etc. Yearly Dispatch Comparison By Hour for December Page 4 of 26December 2023 Operations Report 575 PLAINFIELD POLICE DEPARTMENT Arrest Reports 202320222021 December Adult Arrests* Battery Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 20410 Battery 4 20460 Domestic Battery 4 2 20486 Cannabis Control Act Possession Of Cannabis - More Than 100g But Less Than 500g 21813 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 21814 Manufacture, Deliver, Possess With Intent To Deliver Cannabis - More Than 30g But Less Than 500g 21824 Controlled Substance Act Possession Controlled Substance 2 42020 Possession Of Controlled Substance 22020 Criminal Damage & Trespass to Property Criminal Damage To Property 41310 Criminal Trespass Residence 21365 Disorderly Conduct Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 2 42890 Drug Paraphernalia Act Possession Of Drug Paraphernalia (civil Law Violation)22171 *Both Juvenile and Adult Felonies and Misdemeanors (Excludes Petty Offenses) 0 20 40 60 80 100 120 1 2 3 4 5 6 7 8 9 10 11 12 2021 2022 2023 Arrest Comparison for the Past 3 Years Page 5 of 26December 2023 Operations Report 576 202320222021 December Adult Arrests* Interference with Public Officers Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 23711 Obstructing Justice 4 23730 Motor Vehicle Offenses Dui - Under The Influence Of Alcohol 142410 Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 4 42410 Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 82411 Dui - Under The Influence Of Alcohol 8 142411 Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Dui - Drug, Substance, Compound In Blood/urine, Results Of Use/consumption Controlled Substance, Compound, Or Meth 22422 Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 2 2 42430 Possession Adult Use Cannabis In Passenger Area Of Motor Vehicle - Driver 2 22435 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 22436 Reckless Driving - Drives Vehicle With Willful Or Wanton Disregard For Safety Of Persons Or Property 22440 Cancelled/suspended/revoked Registration 2 42460 Operation Vehicle W/suspended Registration (no Insurance) 2 22462 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 2 2 22470 Suspended/revoked Drivers License 6 22480 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 22480 Flee/attempt To Elude Peace Officer 22495 Aggravated Dui - Violation For The Third Or Subsequent Time 22510 Aggravated Dui - No Driver's License, Permit, Restricted Driving Permit, Judicial Driving Permit, Monitoring Device Permit 22517 Offenses Involving Children Prohibition On Sale/possession Of Tobacco By Minors, Distribution To Any Person, Vending Machines, Etc. 41715 Other Offenses In-state Warrant 10 8 85081 Theft Retail Theft - Alters, Transfers, Removes Label Or Price Tag And Attempts To Purchase At Less Than Full Retail Value 20810 Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 4 80860 Possession Of Stolen Vehicle 22476 60 76 66TOTAL *Felonies & Misdemeanors (Excludes Petty Offenses). Any 2410 Arrests are for all individual citations. This number does not reflect the number of individual occurrances since a single offender may recieve multiple citations, e.g. DUI Alcohol & DUI >.08. Page 6 of 26December 2023 Operations Report 577 202320222021 December Juvenile Arrests* Assault Assault 0 20560 Battery Aggravated Battery - Teacher Or School Employee - Minor Or No Injury - No Dangerous Weapon 0 20433 Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 0 20434 Aggravated Battery - Deadly Weapon Other Than Firearm Or Use Of Air Rifle 00447 Battery 0 40460 Domestic Battery 2 0 20486 Cannabis Control Act Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 01814 Possession Of Cannabis - Less Than 10g (civil/ordinance Violation) 0 21814 Criminal Damage & Trespass to Property Criminal Damage To Property 01310 Criminal Damage To Government Supported Property 01340 Criminal Trespass To State Supported Land 0 21350 Criminal Trespass State Supported Property 01350 Disorderly Conduct Threaten Destruction Of School Or Violence, Death, Or Bodily Harm Against Persons At School, School Function, Or Event 0 22851 Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 12 02890 Drug Paraphernalia Act Possession Of Drug Paraphernalia (civil Law Violation)10 02171 Interference with Public Officers Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 2 0 23711 26 0 20TOTAL *Felonies & Misdemeanors (Excludes Petty Offenses). Any 2410 Arrests are for all individual citations. This number does not reflect the number of individual occurrances since a single offender may recieve multiple citations, e.g. DUI Alcohol & DUI >.08. Page 7 of 26December 2023 Operations Report 578 PLAINFIELD POLICE DEPARTMENT Case Status Reports Detective 2022 2023 2024 Active (02) Pending Case Assignments as of: February 7, 2024* ALLEN, CHRISTOPHER 196 31 28 20 BAYLESS, ZACHARY 197 28 COLUMBUS, CODY 198 27 DABEZIC, DINO 194 18 20 FELGENHAUER, AMANDA 116 21 25 7 KAMINSKI, JEFFREY 192 24 19 7 MARSHALL, CHRISTOPHER 195 17 MCQUAID, KEVIN 107 10 5 2 MIKOS, RONALD 113 9 104 97 117TOTAL 0 5 10 15 20 25 30 35 ALLEN,CHRISTOPHER 196BAYLESS,ZACHARY 197COLUMBUS,CODY 198FELGENHAUER,AMANDA 116KAMINSKI,JEFFREY 192MARSHALL,CHRISTOPHER 195MCQUAID,KEVIN 107MIKOS,RONALD 113DABEZIC,DINO 1942021 2022 2023 *Active case assignements and pending investigations will not typically be equal because multiple officers may be assigned to follow up on one case that may have multiple offenses. Page 8 of 26December 2023 Operations Report 579 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED Home Repair Fraud 17309 1Total: HOMICIDE Homicide First Degree 50110 5Total: Homicide ROBBERY Armed Robbery 10310 1Total: Robbery BATTERY Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 10410 Aggravated Battery - Peace Officer - Great Bodily Harm/permanent Disability/disfigurement 10412 Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 1 20434 Aggravated Battery - Merchant Detaining Person For Retail Theft - Minor Or No Injury - No Dangerous Weapon 10445 Battery 4 30460 Domestic Battery 4 140486 Aggravated Domestic Battery 30488 10 24Total: Battery ASSAULT Aggravated Assault - Offense Based Only On Location (public Way/property/amusement Place/sports Venue) 10510 1Total: Assault BURGLARY Burglary - Building 7 10610 Residential Burglary 60625 Burglary - Motor Vehicle 10 20760 23 3Total: Burglary THEFT Theft From Motor Vehicle 5 10710 Theft 20711 Theft Of Lost Or Mislaid Property 10805 Retail Theft - Alters, Transfers, Removes Label Or Price Tag And Attempts To Purchase At Less Than Full Retail Value 20810 Retail Theft - Removal Of Shopping Cart With Intent To Deprive Merchant Of Possession 1 10814 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Over $500 5 170815 Page 9 of 26December 2023 Operations Report 580 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED THEFT Theft Over $500 30815 Retail Theft - Falsely Represents To Merchant As Owner Of Property Seeking Money, Merchandise Credit, Other Property 10816 Retail Theft - Theft By Emergency Exit 40819 Retail Theft - Permissive Inference - Concealment And Removal Of Merchandise Beyond Last Payment Station 20820 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Less Than $500 4 60825 Theft $500 And Under 10825 Retail Theft 90860 Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 19 230860 Identity Theft 4 31137 Theft - Obtained By Deception Control Over Property Of The Owner 4 71139 Identity Theft - Building Permit Application - Falsely Providing License Number Of Contractor 11141 Internet Offenses - Online Theft By Deception 11146 Theft/labor/services/property 11210 45 83Total: Theft MOTOR VEHICLE THEFT Motor Vehicle Theft 7 10910 7 1Total: Motor Vehicle Theft DECEPTIVE PRACTICES Deceptive Practices - General Deception 5 101110 Deceptive Practice 31110 Deceptive Practices - Bad Checks 31111 Deceptive Practices - Bank-related Fraud - False Statement, Possession Stolen Fraudulently Obtained Checks 21112 Deceptive Practices - Bank Related Fraud - Possession Of Implements Of Check Fraud 11113 Forgery 1 21120 Financial Institution Fraud 11121 Fraud 31130 Possession Lost Or Mislaid Credit/debit Card With Intent To Use/sell/transfer To Another Person 11163 Use Of Credit//debit Card With Intent To Defraud 21167 Use Of Credit/debit Card With Intent To Defraud 1 11167 Fraud 11191 Financial Exploitation Of Elderly Or Person With A Disability 11195 Computer Fraud 21242 12 28Total: Deceptive Practices Page 10 of 26December 2023 Operations Report 581 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED CRIMINAL DAMAGE & TRESPASS TO PROPERTY Criminal Damage To Property 17 41310 Criminal Damage Property 1 21310 Criminal Trespass To Real Property 11330 Criminal Damage To Government Supported Property 11340 Criminal Trespass To Vehicles 11360 Criminal Trespass Vehicle 11360 Criminal Trespass To Residence 11365 Trespass Warning 19375 24 6Total: Criminal Damage & Trespass to Property DEADLY WEAPONS Unlawful Use Weapon 1 11410 Unlawful Use Of Weapon 11410 Unlawful Possession Firearm/ammunition 11425 Possession Of A Stolen Firearm 11438 Firearm Owner's Identification Card Required - Acquire Or Possess Firearm Ammunition 11461 4 2Total: Deadly Weapons SEX OFFENSES Criminal Sexual Assault 1 10260 Criminal Sexual Assault-victim Unable To Understand/unable To Give Consent 10262 Predatory Criminal Sexual Assault Child 20280 Criminal Sexual Abuse - Sexual Conduct - Use Or Threat Of Force 11563 Public Indecency 11570 Criminal Sexual Abuse - Sexual Conduct - Offender Under 17 Yoa And Victim 9 To 17 Yoa 11571 Non-consensual Dissemination Of Private Sexual Images 31581 Child Pornography 71582 Aggravated Criminal Sexual Abuse - Offender 17 Yoa Or Older And Victim Is Less Than 13 Yoa 11594 15 4Total: Sex Offenses OFFENSES INVOLVING CHILDREN Endangering The Life Or Health Of A Child - Causes, Permits Or Places Child In Circumstances (family Related) 21711 Contributing To Dependency/neglect Child 11720 Runaway (m.r.a.i.)11740 Juvenile Bullying 19279 2 3Total: Offenses Involving Children CANNABIS CONTROL ACT Possession Of Cannabis Over 10gm To 100gm (misdemeanor)11810 Page 11 of 26December 2023 Operations Report 582 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED CANNABIS CONTROL ACT Possession Of Cannabis - More Than 30g But Less Than 100g 11811 Possession Of Cannabis - More Than 100g But Less Than 500g 1 11813 Possession Of Cannabis Over 100gm (felony)1 11813 Civil Law Cannabis (not More Than 10grams)11814 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 21814 Possession Of Cannabis - More Than 5,000g 11819 Delivery/manufacture Of Cannabis 10gm And Under (misdemeanor) 11821 Delivery/manufacture Of Cannabis Over 30gm (felony)11822 Delivery/manufacture Of Cannabis 10gm And Over (felony)11822 Manufacture, Deliver, Possess With Intent To Deliver Cannabis - More Than 30g But Less Than 500g 11824 Unlawful Production Of Cannabis Sativa Plant - More Than 50 But Less Than 200 Plants 11853 10 5Total: Cannabis Control Act CONTROLLED SUBSTANCE ACT Manufacture Of Controlled Substance 12011 Delivery Of Controlled Substance 32012 Possession With Intent To Deliver 12013 Possession Of Controlled Substance 42020 Possession Controlled Substance 6 42020 Drug Overdose (misc/unknown)39185 17 5Total: Controlled Substance Act DRUG PARAPHERNALIA ACT Possession Of Drug Paraphernalia 12170 Possession Drug Equipment 12170 Civil Law Paraphernalia 12171 3Total: Drug Paraphernalia Act DISORDERLY CONDUCT Harassment By Telephone 12825 Harassment Through Electronic Communications 12826 Threaten Destruction Of School Or Violence, Death, Or Bodily Harm Against Persons At School, School Function, Or Event 12851 False Police Report 12860 Disorderly Conduct 12890 Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 3 22890 Mob Action 13100 5 6Total: Disorderly Conduct Page 12 of 26December 2023 Operations Report 583 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED INTERFERENCE WITH PUBLIC OFFICERS Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 2 13711 Obstructing Justice 13730 2 2Total: Interference with Public Officers TRAFFIC CRASHES Accident: Hit And Run (property Damage)46548 Accident: Property Damage 16558 Accident: Leaving Scene Of Accident 16572 Accident: Hit And Run (personal Injury)18527 Accident: Hit And Run (property Damage)18528 Accident: Leaving Scene Of Accident 18549 9Total: Traffic Crashes PARKING Parking: Overnight Prohibited/specific Hours 16310 1Total: Parking MOTOR VEHICLE OFFENSES Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Dui - Under The Combined Influence Alcohol, Other Drugs, Intoxicating Compounds 22421 Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 12430 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 22436 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Passenger 12437 Leaving Scene Property Damage Accident 12447 Improper Lane Usage 12455 Cancelled/suspended/revoked Registration 12460 Operation Uninsured Motor Vehicle 12461 Operation Of Uninsured Motor Vehicle 32461 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 12470 Suspended/revoked Drivers License 42480 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 12480 Flee/attempt To Elude Peace Officer 32495 Fleeing Or Attempting To Elude A Peace Officer 12495 Aggravated Fleeing/attempting To Elude Peace Officer - Involves Disobedience Of 2 Or More Traffic Devices 1 22499 Failure To Signal 16584 Speeding: Over 26 - 34 Mph Over Posted Limit 26594 Speeding: Radar 2 16601 Page 13 of 26December 2023 Operations Report 584 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED MOTOR VEHICLE OFFENSES Traffic Sign Violation 16605 Improper Lane Usage 26608 Failure To Report Accident 16624 Improper Lighting (one Headlight)16633 Warning Ticket - Equipment Violations 16643 Other Equipment Violations (citations Issued)16648 Improper Display Of Registration 1 16653 Failure To Yield: Private Road Or Drive 16683 Fictitious Or Altered Driver's License/id Card 16688 Expired Registration 16712 Speeding: Over 26 - 34 Mph Over Posted Limit 18563 Improper Passing 18575 Failure To Yield: Stop Sign 18586 Improper Lighting (driving Without Lights)18593 Improper Lighting (no Taillights)18594 Disobey Traffic Control Device 28619 38 15Total: Motor Vehicle Offenses OTHER OFFENSES Violation Of Order Of Protection 1 54387 Violation Order Of Protection 1 24387 Violation Of Stalking No Contact Order 14389 In-state Warrant 35081 Out-of-state Warrant 15082 Expunged Offense 27001 Violation Of Bail Bond 19175 7 10Total: Other Offenses SUSPICIOUS ACTIVITY Investigation Quasi-criminal 3 19100 Damage To Property: Non Criminal 19104 Neighborhood Trouble/neighbor Dispute 19105 Disturbance/disputes 19110 Suspicious Circumstances 19356 6 2Total: Suspicious Activity LOST/FOUND PROPERTY Found Property 3 19246 3 1Total: Lost/Found Property SUICIDE & DEATH INVESTIGATIONS Suicide: By Firearm 19401 Death: Suspicious Circumstances 3 19432 Death: Other Sudden Death/bodies Found (death Investigation) 19438 Page 14 of 26December 2023 Operations Report 585 Active Cases and Warrants Listed by Primary Offense as of: February 7, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED SUICIDE & DEATH INVESTIGATIONS 5 1Total: Suicide & Death Investigations AGENCY ASSIST Assist: Ambulance 1 39083 1 3Total: Agency Assist CRISIS INTERVENTION Parent-juvenile: Crisis Intervention 19603 Mental Illness: Crisis Intervention 1 29604 Other: Crisis Intervention 19608 Child Abuse: Crisis Intervention 19612 2 4Total: Crisis Intervention OTHER INCIDENTS Other Investigations 19119 Wire Fraud 19125 Interfering With The Reporting Of Domestic Violence 29132 Released Vehicle/property 29325 Search Warrant 19331 Threats 19366 Station Information 29507 Follow Up 19700 Welfare Check 1 29798 Fights, Riots, Brawls 19918 8 7Total: Other Incidents 261 221TOTAL Page 15 of 26December 2023 Operations Report 586 Closed Cases by Offense Administratively Closed Adult Arrest Juvenile Arrest December 2023 Closed Cases (by Disposition and Primary Offense) Victim Refusal to Cooperate Prosecution Declined Referred to Other Jurisdiction 3 Agency Assist 10 Animal Complaints 3 6 Arson 2 Battery 7 6 19 4 Burglary 9 2 Cannabis Control Act 7 Citizen Assist 30 Controlled Substance Act 7 4 Criminal Damage & Trespass to Property 15 2 2 Crisis Intervention 44 3 Deceptive Practices 12 3 Disorderly Conduct 3 9 Interference with Public Officers 6 Lost/Found Property 9 Missing Persons 4 Motor Vehicle Offenses 59 Offenses Involving Children 2 1 8 Other Incidents 15 Other Offenses 31 13 Sex Offenses 5 2 Suicide & Death Investigations 5 Suspicious Activity 11 Theft 19 14 1 Traffic Crashes 1 1 240 107 51TOTAL 9 8 4 Page 16 of 26December 2023 Operations Report 587 PLAINFIELD POLICE DEPARTMENT Offense Reports 2021 2022 2023 Monthly Offenses Reported: December Landlord/tenant Dispute 19280 1Total: BATTERY Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 10410 Aggravated Battery - Teacher Or School Employee - Minor Or No Injury - No Dangerous Weapon 1 2 10433 Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 10434 Aggravated Battery - Deadly Weapon Other Than Firearm Or Use Of Air Rifle 10447 Battery 4 6 60460 Domestic Battery 6 10 50486 Aggravated Domestic Battery 10488 12 20 13Total: Battery BURGLARY Burglary - Building 3 3 30610 Burglary - House Trailer 10611 Residential Burglary 40625 Burglary - Motor Vehicle 1 2 70760 4 5 15Total: Burglary THEFT Theft From Motor Vehicle 3 20710 Theft 50711 Theft Of Lost Or Mislaid Property 10805 Retail Theft - Alters, Transfers, Removes Label Or Price Tag And Attempts To Purchase At Less Than Full Retail Value 10810 Retail Theft - Removal Of Shopping Cart With Intent To Deprive Merchant Of Possession 20814 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Over $500 10 1 30815 Retail Theft - Falsely Represents To Merchant As Owner Of Property Seeking Money, Merchandise Credit, Other Property 10816 Retail Theft - Theft By Emergency Exit 10819 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Less Than $500 20825 Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 8 7 50860 Identity Theft 5 3 31137 Page 17 of 26December 2023 Operations Report 588 2021 2022 2023 Monthly Offenses Reported: December THEFT Theft - Obtained By Deception Control Over Property Of The Owner 1 11139 Theft Of Labor Or Services Or Use Of Property 11210 Theft Of Motor Vehicle Parts Or Accessories-misdemeanor 12475 Theft Of Motor Vehicle Parts Or Accessories-felony 12476 Possession Of Stolen Vehicle 22476 28 17 25Total: Theft ARSON Fires 19054 1Total: Arson MOTOR VEHICLE THEFT Motor Vehicle Theft 3 7 20910 Recovered Stolen Vehicle 15084 3 8 2Total: Motor Vehicle Theft DECEPTIVE PRACTICES Deceptive Practices - General Deception 2 2 21110 Deceptive Practices - Bad Checks 1 21111 Deceptive Practices - Bank-related Fraud - False Statement, Possession Stolen Fraudulently Obtained Checks 21112 Forgery 1 1 11120 Sale Or Purchase Of A Credit Or Debit Card Without Consent Of Issuer 11164 Use Of Credit//debit Card With Intent To Defraud 11167 Fraud 1 21191 Financial Exploitation Of Elderly Or Person With A Disability 11195 6 10 4Total: Deceptive Practices CRIMINAL DAMAGE & TRESPASS TO PROPERTY Criminal Defacement Property 11305 Criminal Damage To Property 7 9 121310 Criminal Trespass To Real Property 1 1 11330 Criminal Damage To Government Supported Property 11340 Criminal Trespass State Supported Property 11350 Criminal Trespass To State Supported Land 11350 Criminal Trespass Vehicle 31360 Criminal Trespass Residence 11365 Trespass Warning 1 3 19375 Trespassing 19376 10 20 15Total: Criminal Damage & Trespass to Property SEX OFFENSES Criminal Sexual Assault 20260 Criminal Sexual Abuse - Sexual Conduct - Use Or Threat Of Force 11563 Page 18 of 26December 2023 Operations Report 589 2021 2022 2023 Monthly Offenses Reported:December SEX OFFENSES Criminal Sexual Abuse - Sexual Conduct - Offender Under 17 Yoa And Victim 9 To 17 Yoa 31571 3 3Total: Sex Offenses OFFENSES INVOLVING CHILDREN Possession, Sale To/from Minors - Tobacco Products 11715 Prohibition On Sale/possession Of Tobacco By Minors, Distribution To Any Person, Vending Machines, Etc. 11715 Minor Remains In Public Place Or On Premises Of Any Establishment During Curfew Hours 11730 Juvenile Bullying 1 19279 Possession Of Tobacco/minor 4 18 99910 Child Custody Dispute/visitation Interference 1 1 19934 8 19 12Total: Offenses Involving Children CANNABIS CONTROL ACT Possession Of Cannabis - More Than 10g But Less Than 30g 11810 Possession Of Cannabis - More Than 100g But Less Than 500g 11813 Possession Of Cannabis - Less Than 10g (civil/ordinance Violation) 81814 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 3 11814 Manufacture, Deliver, Possess With Intent To Deliver Cannabis - More Than 30g But Less Than 500g 11824 3 3 9Total: Cannabis Control Act CONTROLLED SUBSTANCE ACT Possession Controlled Substance 1 22020 Possession Of Controlled Substance 22020 Drug Activity 19183 2 2 2Total: Controlled Substance Act DRUG PARAPHERNALIA ACT Possession Of Drug Paraphernalia (civil Law Violation)1 1 12171 1 1 1Total: Drug Paraphernalia Act DISORDERLY CONDUCT Harassment By Telephone 1 12825 Threaten Destruction Of School Or Violence, Death, Or Bodily Harm Against Persons At School, School Function, Or Event 2 1 32851 Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 10 4 12890 13 5 5Total: Disorderly Conduct INTERFERENCE WITH PUBLIC OFFICERS Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 2 13711 Obstructing Justice 2 13730 4 1 1Total: Interference with Public Officers Page 19 of 26December 2023 Operations Report 590 2021 2022 2023 Monthly Offenses Reported: December INTIMIDATION Extortion 13970 1Total: Intimidation TRAFFIC CRASHES Accident: Hit And Run (personal Injury)16547 Accident: Hit And Run (property Damage)1 16548 Accident: Fatal 26555 Accident: Personal Injury 8 106556 Accident: Non-injury 87 996557 Accident: Property Damage 10 126558 Accident: Private Property 2 16563 Accident: Arrest 26564 Accident: Leaving Scene Of Accident 16572 Fail To Give Information And Render Aid 16951 Accident: Hit And Run (property Damage)18528 Accident: Personal Injury 108536 Accident: Non-injury 1018537 Accident: Property Damage 98538 Accident: Village /city/county Property 18542 Accident: Leaving Scene Of Accident 28549 108 129 125Total: Traffic Crashes VEHICLE TOW Tow: Abandoned Vehicle 16723 1Total: Vehicle Tow PARKING Parking: All Other Violations 1 26300 Parking: Handicapped Violation 1 16304 Parking: In Fire Lane 16305 Parking: Over Sidewalk (blocking Sidewalk)16308 Parking: Overnight Prohibited/specific Hours 222 266310 Parking: Where Prohibited (sign Posted)3 106312 Parking: Over Sidewalk (blocking Sidewalk)28509 Parking: Overnight Prohibited/specific Hours 558511 Parking: Where Prohibited (sign Posted)48513 228 40 61Total: Parking MOTOR VEHICLE OFFENSES Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 7 42410 Dui - Under The Influence Of Alcohol 142410 Dui - Under The Influence Of Alcohol 12 132411 Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 82411 Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Dui - Drug, Substance, Compound In Blood/urine, Results Of Use/consumption Controlled Substance, Compound, Or Meth 22422 Page 20 of 26December 2023 Operations Report 591 2021 2022 2023 Monthly Offenses Reported: December MOTOR VEHICLE OFFENSES Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 5 2 42430 Possession Adult Use Cannabis In Passenger Area Of Motor Vehicle - Driver 2 12435 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 2 2 12436 Reckless Driving - Drives Vehicle With Willful Or Wanton Disregard For Safety Of Persons Or Property 1 12440 Leaving Scene Property Damage Accident 22447 Failure To Remain At The Scene Of A Vehicle Damage Accident 52447 Speeding - Over Statutory Limit 52454 Improper Lane Usage 15 5 162455 Operation Of Vehicle Without Registration 1 222456 Operation Of A Vehicle With Cancelled, Suspended Or Revoked Registration 82460 Cancelled/suspended/revoked Registration 2 42460 Operation Of Uninsured Motor Vehicle 29 48 332461 Operation Vehicle W/suspended Registration (no Insurance) 3 192462 Operation Of Motor Vehicle When Registration Suspended For Noninsurance 392462 Improper Use Of Registration 12465 Improper Use Of Evidence Of Registration Or Certificate Of Title 12465 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 10 10 142470 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 172480 Suspended/revoked Drivers License 20 122480 Fail To Pay Fine/penalty Standing, Parking, Compliance, Auto Speed Enforcement System Or Auto Traffic Law Violations 12484 Driver And Passenger Required To Use Safety Belts 342485 Driver And Passenger Safety Belts 23 872485 Failure To Secure Child Under 8 Years In Appropriate Child Restraint System 1 12486 Failure To Secure Child 8 Yoa But Under 16 Yoa In A Safety Belt Or Child Restraint System 1 12487 Unlawful Use Of Driver's License 12490 Flee/attempt To Elude Peace Officer 22495 Aggravated Fleeing/attempting To Elude Peace Officer - Involves Disobedience Of 2 Or More Traffic Devices 12499 Aggravated Dui - Violation For The Third Or Subsequent Time 12510 Aggravated Dui - No Driver's License, Permit, Restricted Driving Permit, Judicial Driving Permit, Monitoring Device Permit 22517 Aggravated Dui - Knowingly Operated Vehicle Not Covered By Liability Insurance Policy 12518 Page 21 of 26December 2023 Operations Report 592 2021 2022 2023 Monthly Offenses Reported: December MOTOR VEHICLE OFFENSES Failure To Reduce Speed To Avoid Accident 23 86581 Failure To Signal 9 16584 Tire Violations 16592 Voided Tickets 0 06593 Speeding: Over 26 - 34 Mph Over Posted Limit 6 66594 Speeding: Over 35+ Mph Over Posted Limit 1 36595 Speeding: Radar 168 2096601 Too Fast For Conditions 1 346604 Traffic Sign Violation 27 226605 Traffic Signal Violation 10 66606 Improper Passing 1 56607 Improper Lane Usage 20 316608 Following Too Closely 16609 Improper Turn At Intersection 16611 Improper U-turn 16613 Failure To Yield: Merging Traffic 16615 Failure To Yield: Intersection 16616 Failure To Yield: Turning Left 7 46617 Failure To Yield: Private Road 2 16618 Failure To Yield: Stop Sign 9 16620 Failure To Yield: Emergency Vehicle 26621 Failure To Report Accident 26624 Improper Lighting (driving Without Lights)7 96630 Improper Lighting (no Taillights)7 106631 Improper Lighting (one Headlight)16 66633 No Valid Safety Test (sticker)16635 Size, Weight, Load, Length Violations 16636 Warning Ticket - Moving Violations 16642 Warning Ticket - Equipment Violations 12 16643 Other Equipment Violations (citations Issued)1 16648 Other Moving Violations (citations Issued)16649 Improper Display Of Registration 12 126653 Disobey Traffic Control Device (red Light)4 56669 Disobey Lane Control Sign 16674 Driving In Wrong Lane 16677 Driving Off Roadway 16678 Obstructed/tinted Window(s)26685 Fictitious Or Altered Driver's License/id Card 16688 Improper Turn 1 16700 All Other Traffic 26701 Illegal Use Of Cell Phone While Driving 5 136707 Expired Registration 25 756712 Page 22 of 26December 2023 Operations Report 593 2021 2022 2023 Monthly Offenses Reported: December MOTOR VEHICLE OFFENSES Expired/invalid Registration 26715 Unsafe Equipment 16717 Commercial Drivers License Or Permit Violations 27000 Failure To Give Aid/information 27002 Failure To Reduce Speed To Avoid Accident 298558 Failure To Signal 18559 Voided Tickets 08562 Speeding: Over 26 - 34 Mph Over Posted Limit 148563 Speeding: Over 35+ Mph Over Posted Limit 58564 Speeding: Radar 1328569 Too Fast For Conditions 28572 Traffic Sign Violation 68573 Traffic Signal Violation 38574 Improper U-turn 28580 Failure To Yield: Intersection 78582 Failure To Yield: Turning Left 68583 Failure To Yield: Private Road 78584 Failure To Yield: Stop Sign 18586 Failure To Report Accident 18589 Graduated License Violation(s)28591 Improper Lighting (driving Without Lights)58593 Improper Lighting (no Taillights)58594 Improper Lighting (one Headlight)78596 Muffler Violations 18597 No Valid Safety Test (sticker)98598 Size, Weight, Load, Length Violations 18599 Warning Ticket - Equipment Violations 38605 Other Equipment Violations (citations Issued)18609 Overweight Violation 18612 Improper Display Of Registration 138614 Disobey Traffic Control Device 48619 Failure To Yield: Private Road Or Drive 28631 Obstructed/tinted Window(s)88633 Improper Turn 78647 Illegal Use Of Cell Phone While Driving 98654 Expired Registration 788656 Expired/invalid Registration 58659 Unsafe Equipment 28661 Defective Windshield, Side Or Rear Window 19162 520 699 609Total: Motor Vehicle Offenses CITIZEN ASSIST Motorist Assist 1 26513 Page 23 of 26December 2023 Operations Report 594 2021 2022 2023 Monthly Offenses Reported: December CITIZEN ASSIST Lock Out 25 28 279031 Burglar Alarm 19046 Hold-up/panic Alarm 19047 Abandoned Vehicle 29908 28 31 28Total: Citizen Assist MISSING PERSONS Missing Person: Adult Female 19065 Missing Person: Juvenile Male 1 19066 Missing Person: Juvenile Female 19067 Found Missing Person 1 19069 4 2Total: Missing Persons OTHER OFFENSES Violation Of Order Of Protection 64387 Violation Order Of Protection 24387 Domestic Dispute 12 12 124870 In-state Warrant 7 5 45081 Expunged Offense 17001 20 19 22Total: Other Offenses SUSPICIOUS ACTIVITY Loud Noise Complaint 39058 Investigation Quasi-criminal 3 1 39100 Suspicious Person 19103 Damage To Property: Non Criminal 1 1 19104 Neighborhood Trouble/neighbor Dispute 19105 Disturbance/disputes 1 19110 Suspicious Circumstances 1 1 19356 9 4 7Total: Suspicious Activity LOST/FOUND PROPERTY Lost Articles 1 19061 Found Articles 2 1 39062 Lost Driver's License/plates 49063 Found Property 19246 Lost/stolen Credit Cards 29284 Lost/stolen Wallet/purse 29285 3 2 12Total: Lost/Found Property SUICIDE & DEATH INVESTIGATIONS Suicide: By Firearm 29401 Suicide: Other 29409 Suicide Attempt: By Cutting 19413 Suicide Attempt: By Drugs 19414 Death: Natural Causes 39431 Death: Bodies Found 19437 Page 24 of 26December 2023 Operations Report 595 2021 2022 2023 Monthly Offenses Reported: December SUICIDE & DEATH INVESTIGATIONS Death: Other Sudden Death/bodies Found (death Investigation) 3 39438 Suicide Threat: Crisis Intervention 19607 4 9 4Total: Suicide & Death Investigations AGENCY ASSIST Assist: Fire Department 2 1 19001 Assist: State Police 2 29003 Assist: Other Police Department 2 2 39004 Assist: Other Government Agency 19005 Assist: Ambulance 4 19083 6 10 5Total: Agency Assist ANIMAL COMPLAINTS Dog Bite: Home 19201 Dog Bite: Occupational 19202 Dog Bite: Public 1 29203 Stray Dogs/leash Law 1 2 59209 Stray Other Animals 19210 2 3 9Total: Animal Complaints CRISIS INTERVENTION Transportation Of Mental Cases 19301 Domestic Trouble: Crisis Intervention 2 19600 Family: Crisis Intervention 1 19602 Parent-juvenile: Crisis Intervention 19603 Mental Illness: Crisis Intervention 5 19 189604 Alcohol: Crisis Intervention 19606 Child Abuse: Crisis Intervention 29612 Mental Illness: Crisis Intervention [intake]29623 Runaway: Crisis Intervention [juvenile Problems]1 19637 School: Crisis Intervention [juvenile Problems]19638 Sex: Crisis Intervention [juvenile Problems]19639 11 23 24Total: Crisis Intervention OTHER INCIDENTS Evidence/property Duties 29099 Other Investigations 19119 Remove Subject/unwanted Subject (no Arrest)1 19138 Code Enforcement 19152 Park District Violation 69313 Threats 1 19366 Harassment 1 19367 Station Information 4 4 59507 Follow Up 19700 Welfare Check 5 4 29798 Fights, Riots, Brawls 4 59918 Page 25 of 26December 2023 Operations Report 596 2021 2022 2023 Monthly Offenses Reported: December OTHER INCIDENTS Service Of Order Of Protection 4 3 29933 25 23 11Total: Other Incidents 1063 1107 1028TOTAL *On 02/17/2023 and 10/12/2023 the Department made changes to many of the reportable offense codes (UCR) as required by the FBI and State of Illinois. This will explain some offenses seeming to be redundant as cases before 02/18 used a different set of codes. 14300 S. Coil Plus Drive, Plainfield, Illinois 60544-7704 Main Office # (815) 436-6544 Executive Office Fax # (815) 436-9681 Page 26 of 26December 2023 Operations Report 597 PLAINFIELD POLICE DEPARTMENT Memo To: From: Date: Subject: John Argoudelis, Village President Robert Miller, Chief of Police Tuesday, February 20 2024 Operations Report- January 2024 Joshua Blakemore, Village Administrator Village Trustees The following pages contain the Monthly Operations Report for the month of January 2024: New Officer Swearing In Plainfield Police Department Wednesday, January 3, 2024 Revenue Summary Page 2 Vehicle Report Page 2 Training Report Page 3 Dispatch Activity Page 4 Arrest Reports Page 5-8 Case Status Reports Page 9-16 Monthly Offenses Reported Page 17-26 Page 1 of 26January 2024 Operations Report 598 PLAINFIELD POLICE DEPARTMENT Operations Report 2022 2023 2024 Monthly Vehicle Report: January Average Miles Per Gallon 9.64 9.86 8.18 Gallons of Gasoline Used 4,642.40 4,922.20 3,283.40 Miles Driven 44,737 48,538 26,865 Monthly Maintenance*$6,331.32 $6,680.12 $6,581.27 *Vehicle maintenance is reported as an expense based upon the calendar date paid; therefore is not necessarily representative of the date the maintenance was performed, billed, nor the budget month applied. Payment Category FEES - Fees and Services Payment Category FINES - Fines/Forfeitures Payment Category PERMITS - Permits 2022 2023 2024 *Red light Camera Violations includes all transactions receipted by Plainfield and not solely the Police Department. Reporting month timing changed in the 12/2021 report for Red Light months. *Red Light Camera Fines and Will and Kendal County fines were received by the counties in December, but were received by Plainfield in January. These numbers are delayed due to the timing of payment processing relative to this reports publication. Monthly Revenue Summary: January Administrative Ticket $9,975.00 $7,700.00 $6,210.00 Administrative Ticket-Late Fee $1,140.00 $680.00 $755.00 Alcohol Enforcement Fine $584.50 $2,100.00 $1,615.50 Daily Storage Fee $0.00 $0.00 $0.00 Impound Fees $3,500.00 $3,500.00 $1,500.00 Kendall County Court Fine*$1,354.00 $1,086.00 $1,025.00 Red Light Camera Violations*$39,312.65 $29,000.00 $27,600.00 Will County Court Fine*$24,097.53 $24,927.91 $17,756.25 $79,963.68 $68,993.91 $56,461.75 Accident/Insurance Reports $730.00 $830.00 $1,025.00 Fingerprint Fee $160.00 $160.00 $80.00 Freedom of Information Fee $5.00 $28.90 $8.50 Offender Registration Fee $20.00 $0.00 $0.00 Copies, Maps, Etc.$0.00 $0.00 $0.00 $915.00 $1,018.90 $1,113.50 Solicitors Permit $50.00 $430.00 $120.00 $50.00 $430.00 $120.00 $80,928.68 $70,442.81 $57,695.25Total Page 2 of 26January 2024 Operations Report 599 PLAINFIELD POLICE DEPARTMENT Training Activity LocationCourse TitleClass DateEmployee Hours Each January 2024 Training Report Total Hours Janis 1/1/2024 12 Professional Administrative Certification of Excellence Online Course / ASAP12 McQuaid 1/12/2024 8 Adaptive Leader - Strategic Leadership for Police Executive Staff Romeoville PD / NEMRT 8 Mikos 1/12/2024 8 Open Source Intelligence Techniques Will County Sheriff's Office / TR 8 Sinclair, Weyenberg 1/16/2024 8 IVC Update and Review for Patrol Lockport PD / TR16 Miller 1/16 - 19/24 32 Staff & Command Plainfield PD32 Klier 1/18/2024 8 Search Warrant Kendall County SRT8 Miller 1/22-26/2024 40 Staff & Command Plainfield PD40 Jeka, Rogers 1/22-26/2024 40 Field Training Officer Certification Will County Sheriff's Office / TR 80 Felgenhauer / R. Sester 1/22 - 2/2/2024 80 Northwestern University Center of Public Safety NUC / Naperville160 Bayless, Mulacek 1/31/2024 10 Gas Mask Fit Test Joliet SOS20 384Total Training Hours for January 2024: Page 3 of 26January 2024 Operations Report 600 PLAINFIELD POLICE DEPARTMENT Dispatch Activity Zone*2022 2023 2024 January Zone Incident Comparison Report PCW 2181 104 47 Z1 736 490 510 Z2 490 382 325 Z3 1326 990 718 Z4 554 459 400 Z5 97 97 78 Z6 2 5 7 0 500 1000 1500 2000 2500 PCW Z1 Z2 Z3 Z4 Z5 Z6 2022 2023 2024 5386 2527 2085TOTAL** *PDF/PCW/WC is used when an incident is out of the village, or when the dispatcher does not validate the address. **Total incidents includes all CAD created incidents, including all Service Calls, Traffic Stops, Information only Calls, Etc. 0 50 100 150 200 250 300 350 400 0100200300400500600700800900100011001200130014001500160017001800190020002100220023002022 2023 2024 *Total incidents includes all CAD created incidents, including all Service Calls, Traffic Stops, Information only Calls, Etc. Yearly Dispatch Comparison By Hour for January Page 4 of 26January 2024 Operations Report 601 PLAINFIELD POLICE DEPARTMENT Arrest Reports 202420232022 January Adult Arrests* Battery Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 20434 Domestic Battery 6 20486 Cannabis Control Act Possession Of Cannabis - More Than 10g But Less Than 30g 21810 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 21814 Controlled Substance Act Possession Controlled Substance 2 42020 Criminal Damage & Trespass to Property Criminal Damage To Property 6 21310 Criminal Damage To Government Supported Property 21340 Criminal Trespass Residence 21365 Deadly Weapons Unlawful Use Weapon 21410 Aggravated Unlawful Use Of Weapon 21411 Disorderly Conduct Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 2 62890 *Both Juvenile and Adult Felonies and Misdemeanors (Excludes Petty Offenses) 0 20 40 60 80 100 120 1 2 3 4 5 6 7 8 9 10 11 12 2022 2023 2024 Arrest Comparison for the Past 3 Years Page 5 of 26January 2024 Operations Report 602 202420232022 January Adult Arrests* Interference with Public Officers Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 23711 Obstructing Identification 43731 Motor Vehicle Offenses Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 6 82410 Dui - Under The Influence Of Alcohol 22410 Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 22411 Dui - Under The Influence Of Alcohol 10 122411 Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 62430 Possession Adult Use Cannabis In Passenger Area Of Motor Vehicle - Driver 2 22435 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 62436 Leaving Scene Property Damage Accident 22447 Speeding - Over Statutory Limit 22454 Operation Of Motor Vehicle When Registration Suspended For Noninsurance 42462 Improper Use Of Registration 22465 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 4 22470 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 22480 Suspended/revoked Drivers License 122480 Fleeing Or Attempting To Elude A Peace Officer 22495 Aggravated Dui - No Driver's License, Permit, Restricted Driving Permit, Judicial Driving Permit, Monitoring Device Permit 2 22517 Other Offenses Violation Order Of Protection 2 24387 Violation Of Order Of Protection 44387 Interfering With The Reporting Of Domestic Violence 24751 In-state Warrant 12 26 105081 Sex Offenses Solicitation Of A Sexual Act 21504 Theft Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Over $500 20815 Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 10 140860 44 132 54TOTAL *Felonies & Misdemeanors (Excludes Petty Offenses). Any 2410 Arrests are for all individual citations. This number does not reflect the number of individual occurrances since a single offender may recieve multiple citations, e.g. DUI Alcohol & DUI >.08. Page 6 of 26January 2024 Operations Report 603 202420232022 January Juvenile Arrests* Battery Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 20410 Aggravated Battery - Teacher Or School Employee - Minor Or No Injury - No Dangerous Weapon 2 20433 Battery 10 2 20460 Cannabis Control Act Possession Of Cannabis - More Than 10g But Less Than 30g 21810 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 61814 Criminal Damage & Trespass to Property Criminal Damage To Property 81310 Disorderly Conduct Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 8 2 42890 Mob Action 83100 Drug Paraphernalia Act Possession Of Drug Paraphernalia 22170 Possession Of Drug Paraphernalia (civil Law Violation) 22171 Liquor Control Act Violations Illegal Possession Alcohol By Minor 22220 Motor Vehicle Offenses Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 22470 Offenses Involving Children Minor Remains In Public Place Or On Premises Of Any Establishment During Curfew Hours 21730 Theft Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 80860 Possession Of Stolen Vehicle 22476 44 24 10TOTAL *Felonies & Misdemeanors (Excludes Petty Offenses). Any 2410 Arrests are for all individual citations. This number does not reflect the number of individual occurrances since a single offender may recieve multiple citations, e.g. DUI Alcohol & DUI >.08. Page 7 of 26January 2024 Operations Report 604 PLAINFIELD POLICE DEPARTMENT Case Status Reports Detective 2022 2023 2024 Active (02) Pending Case Assignments as of: February 20, 2024* ALLEN, CHRISTOPHER 196 26 32 20 BAYLESS, ZACHARY 197 30 COLUMBUS, CODY 198 33 DABEZIC, DINO 194 21 24 FELGENHAUER, AMANDA 116 19 17 7 KAMINSKI, JEFFREY 192 22 15 7 MARSHALL, CHRISTOPHER 195 17 MCQUAID, KEVIN 107 7 3 2 MIKOS, RONALD 113 12 95 91 128TOTAL 0 5 10 15 20 25 30 35 ALLEN,CHRISTOPHER 196BAYLESS,ZACHARY 197COLUMBUS,CODY 198FELGENHAUER,AMANDA 116KAMINSKI,JEFFREY 192MARSHALL,CHRISTOPHER 195MCQUAID,KEVIN 107MIKOS,RONALD 113DABEZIC,DINO 1942022 2023 2024 *Active case assignements and pending investigations will not typically be equal because multiple officers may be assigned to follow up on one case that may have multiple offenses. Page 8 of 26January 2024 Operations Report 605 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED HOMICIDE Homicide First Degree 50110 5Total: Homicide ROBBERY Armed Robbery 10310 1Total: Robbery BATTERY Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 10410 Aggravated Battery - Peace Officer - Great Bodily Harm/permanent Disability/disfigurement 10412 Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 1 20434 Aggravated Battery - Merchant Detaining Person For Retail Theft - Minor Or No Injury - No Dangerous Weapon 10445 Battery 5 30460 Domestic Battery 4 150486 Aggravated Domestic Battery 30488 11 25Total: Battery ASSAULT Aggravated Assault - Offense Based Only On Location (public Way/property/amusement Place/sports Venue) 10510 1Total: Assault BURGLARY Burglary - Building 8 10610 Residential Burglary 70625 Burglary - Motor Vehicle 14 20760 29 3Total: Burglary THEFT Theft From Motor Vehicle 5 10710 Theft 20711 Theft Of Lost Or Mislaid Property 10805 Retail Theft - Alters, Transfers, Removes Label Or Price Tag And Attempts To Purchase At Less Than Full Retail Value 20810 Retail Theft - Removal Of Shopping Cart With Intent To Deprive Merchant Of Possession 1 10814 Theft Over $500 30815 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Over $500 4 170815 Retail Theft - Falsely Represents To Merchant As Owner Of Property Seeking Money, Merchandise Credit, Other Property 10816 Retail Theft - Theft By Emergency Exit 40819 Page 9 of 26January 2024 Operations Report 606 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED THEFT Retail Theft - Permissive Inference - Concealment And Removal Of Merchandise Beyond Last Payment Station 1 20820 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Less Than $500 4 60825 Theft $500 And Under 10825 Retail Theft 90860 Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 21 230860 Identity Theft 3 31137 Theft - Obtained By Deception Control Over Property Of The Owner 4 71139 Identity Theft - Building Permit Application - Falsely Providing License Number Of Contractor 11141 Internet Offenses - Online Theft By Deception 11146 Theft/labor/services/property 11210 46 83Total: Theft MOTOR VEHICLE THEFT Motor Vehicle Theft 7 10910 Recovered Stolen Vehicle 15084 8 1Total: Motor Vehicle Theft DECEPTIVE PRACTICES Deceptive Practice 31110 Deceptive Practices - General Deception 6 101110 Deceptive Practices - Bad Checks 31111 Deceptive Practices - Bank-related Fraud - False Statement, Possession Stolen Fraudulently Obtained Checks 21112 Deceptive Practices - Bank Related Fraud - Possession Of Implements Of Check Fraud 11113 Forgery 1 21120 Financial Institution Fraud 11121 Fraud 31130 Possession Lost Or Mislaid Credit/debit Card With Intent To Use/sell/transfer To Another Person 11163 Use Of Credit//debit Card With Intent To Defraud 21167 Use Of Credit/debit Card With Intent To Defraud 1 11167 Fraud 11191 Financial Exploitation Of Elderly Or Person With A Disability 11195 Computer Fraud 11242 Home Repair Fraud 17309 12 29Total: Deceptive Practices CRIMINAL DAMAGE & TRESPASS TO PROPERTY Criminal Damage To Property 20 41310 Page 10 of 26January 2024 Operations Report 607 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED CRIMINAL DAMAGE & TRESPASS TO PROPERTY Criminal Damage Property 1 21310 Criminal Trespass To Real Property 21330 Criminal Damage To Government Supported Property 11340 Criminal Trespass To Vehicles 11360 Criminal Trespass Vehicle 11360 Criminal Trespass To Residence 21365 Trespass Warning 19375 29 6Total: Criminal Damage & Trespass to Property DEADLY WEAPONS Unlawful Use Of Weapon 11410 Unlawful Use Weapon 1 11410 Unlawful Possession Firearm/ammunition 11425 Possession Of A Stolen Firearm 11438 Firearm Owner's Identification Card Required - Acquire Or Possess Firearm Ammunition 11461 4 2Total: Deadly Weapons SEX OFFENSES Criminal Sexual Assault 1 10260 Criminal Sexual Assault-victim Unable To Understand/unable To Give Consent 10262 Predatory Criminal Sexual Assault Child 20280 Criminal Sexual Abuse - Sexual Conduct - Use Or Threat Of Force 11563 Public Indecency 11570 Criminal Sexual Abuse - Sexual Conduct - Offender Under 17 Yoa And Victim 9 To 17 Yoa 11571 Non-consensual Dissemination Of Private Sexual Images 31581 Child Pornography 71582 Aggravated Criminal Sexual Abuse - Offender 17 Yoa Or Older And Victim Is Less Than 13 Yoa 11594 15 4Total: Sex Offenses OFFENSES INVOLVING CHILDREN Endangering The Life Or Health Of A Child - Causes, Permits Or Places Child In Circumstances (family Related) 21711 Contributing To Dependency/neglect Child 11720 Runaway (m.r.a.i.) 11740 Juvenile Bullying 19279 2 3Total: Offenses Involving Children CANNABIS CONTROL ACT Possession Of Cannabis Over 10gm To 100gm (misdemeanor) 11810 Possession Of Cannabis - More Than 30g But Less Than 100g 11811 Page 11 of 26January 2024 Operations Report 608 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED CANNABIS CONTROL ACT Possession Of Cannabis Over 100gm (felony) 1 11813 Possession Of Cannabis - More Than 100g But Less Than 500g 1 11813 Civil Law Cannabis (not More Than 10grams) 11814 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 21814 Possession Of Cannabis - More Than 5,000g 11819 Delivery/manufacture Of Cannabis 10gm And Under (misdemeanor) 11821 Delivery/manufacture Of Cannabis Over 30gm (felony) 11822 Delivery/manufacture Of Cannabis 10gm And Over (felony) 11822 Manufacture, Deliver, Possess With Intent To Deliver Cannabis - More Than 30g But Less Than 500g 11824 Unlawful Production Of Cannabis Sativa Plant - More Than 50 But Less Than 200 Plants 11853 10 5Total: Cannabis Control Act CONTROLLED SUBSTANCE ACT Manufacture Of Controlled Substance 12011 Delivery Of Controlled Substance 32012 Possession With Intent To Deliver 12013 Possession Of Controlled Substance 42020 Possession Controlled Substance 6 42020 Drug Overdose (misc/unknown) 39185 17 5Total: Controlled Substance Act DRUG PARAPHERNALIA ACT Possession Of Drug Paraphernalia 12170 Possession Drug Equipment 12170 Civil Law Paraphernalia 12171 3Total: Drug Paraphernalia Act DISORDERLY CONDUCT Harassment By Telephone 12825 Harassment Through Electronic Communications 12826 False Police Report 12860 Disorderly Conduct 12890 Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 5 22890 Mob Action 13100 6 6Total: Disorderly Conduct INTERFERENCE WITH PUBLIC OFFICERS Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 2 13711 Obstructing Justice 13730 Page 12 of 26January 2024 Operations Report 609 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED INTERFERENCE WITH PUBLIC OFFICERS 2 2Total: Interference with Public Officers TRAFFIC CRASHES Accident: Hit And Run (property Damage) 46548 Accident: Property Damage 16558 Accident: Leaving Scene Of Accident 16572 Accident: Hit And Run (personal Injury) 18527 Accident: Hit And Run (property Damage) 18528 8Total: Traffic Crashes PARKING Parking: Overnight Prohibited/specific Hours 16310 1Total: Parking MOTOR VEHICLE OFFENSES Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Dui - Under The Combined Influence Alcohol, Other Drugs, Intoxicating Compounds 22421 Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 12430 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 22436 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Passenger 12437 Leaving Scene Property Damage Accident 12447 Improper Lane Usage 12455 Cancelled/suspended/revoked Registration 12460 Operation Of Uninsured Motor Vehicle 32461 Operation Uninsured Motor Vehicle 12461 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 12470 Suspended/revoked Drivers License 42480 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 12480 Fleeing Or Attempting To Elude A Peace Officer 12495 Flee/attempt To Elude Peace Officer 32495 Aggravated Fleeing/attempting To Elude Peace Officer - Involves Disobedience Of 2 Or More Traffic Devices 1 22499 Failure To Signal 16584 Speeding: Over 26 - 34 Mph Over Posted Limit 26594 Speeding: Radar 2 16601 Traffic Sign Violation 16605 Improper Lane Usage 26608 Failure To Report Accident 16624 Improper Lighting (one Headlight) 16633 Page 13 of 26January 2024 Operations Report 610 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED MOTOR VEHICLE OFFENSES Warning Ticket - Equipment Violations 16643 Other Equipment Violations (citations Issued) 16648 Improper Display Of Registration 1 16653 Failure To Yield: Private Road Or Drive 16683 Fictitious Or Altered Driver's License/id Card 16688 Expired Registration 16712 Speeding: Over 26 - 34 Mph Over Posted Limit 18563 Improper Passing 18575 Failure To Yield: Stop Sign 18586 Improper Lighting (driving Without Lights) 18593 Improper Lighting (no Taillights) 18594 Disobey Traffic Control Device 28619 38 15Total: Motor Vehicle Offenses OTHER OFFENSES Violation Of Order Of Protection 1 54387 Violation Order Of Protection 1 24387 Violation Of Stalking No Contact Order 14389 In-state Warrant 35081 Out-of-state Warrant 15082 Expunged Offense 27001 Violation Of Bail Bond 19175 7 10Total: Other Offenses SUSPICIOUS ACTIVITY Investigation Quasi-criminal 3 19100 Damage To Property: Non Criminal 19104 Neighborhood Trouble/neighbor Dispute 19105 Disturbance/disputes 19110 Suspicious Circumstances 19356 6 2Total: Suspicious Activity LOST/FOUND PROPERTY Found Property 3 19246 3 1Total: Lost/Found Property SUICIDE & DEATH INVESTIGATIONS Suicide: By Firearm 19401 Death: Suspicious Circumstances 3 19432 Death: Other Sudden Death/bodies Found (death Investigation) 19438 5 1Total: Suicide & Death Investigations AGENCY ASSIST Assist: Other Police Department 19004 Assist: Ambulance 1 39083 Page 14 of 26January 2024 Operations Report 611 Active Cases and Warrants Listed by Primary Offense as of: February 20, 2024 02 - PENDING INVESTIGATION 15 - WARRANT/COMPLAINT ISSUED AGENCY ASSIST 2 3Total: Agency Assist CRISIS INTERVENTION Parent-juvenile: Crisis Intervention 19603 Mental Illness: Crisis Intervention 1 29604 Other: Crisis Intervention 19608 Child Abuse: Crisis Intervention 19612 2 4Total: Crisis Intervention OTHER INCIDENTS Other Investigations 19119 Wire Fraud 19125 Interfering With The Reporting Of Domestic Violence 29132 Released Vehicle/property 29325 Search Warrant 19331 Station Information 29507 Follow Up 19700 Welfare Check 1 29798 Fights, Riots, Brawls 19918 7 7Total: Other Incidents 275 222TOTAL Page 15 of 26January 2024 Operations Report 612 Closed Cases by Offense Administratively Closed Adult Arrest Juvenile Arrest January 2024 Closed Cases (by Disposition and Primary Offense) Victim Refusal to Cooperate Prosecution Declined Referred to Other Jurisdiction 1 Agency Assist 14 All Other Offenses 2 Animal Complaints 5 Battery 4 5 4 Burglary 8 Citizen Assist 58 Criminal Damage & Trespass to Property 15 4 Crisis Intervention 70 Deceptive Practices 4 2 Disorderly Conduct 3 2 Lost/Found Property 1 Missing Persons 19 Motor Vehicle Offenses 63 Motor Vehicle Theft 6 Offenses Involving Children 1 Other Incidents 20 Other Offenses 30 20 2 Sex Offenses 2 2 Suicide & Death Investigations 27 Suspicious Activity 1 3 Theft 37 7 2 Traffic Crashes 8 Vehicle Tow 1 337 104 2TOTAL 4 4 2 Page 16 of 26January 2024 Operations Report 613 PLAINFIELD POLICE DEPARTMENT Offense Reports 2022 2023 2024 Monthly Offenses Reported: January Motorist Assist 18519 1Total: BATTERY Aggravated Battery - Great Bodily Harm Or Permanent Disability Or Disfigurement 10410 Aggravated Battery - Peace Officer - Great Bodily Harm/permanent Disability/disfigurement 10412 Aggravated Battery - Teacher Or School Employee - Minor Or No Injury - No Dangerous Weapon 2 10433 Aggravated Battery - Peace Officer, Policing Volunteer, Fireman, Security Ofc - Minor/no Injury - No Dangerous Weapon 1 2 10434 Battery 7 3 20460 Domestic Battery 3 7 60486 Aggravated Domestic Battery 10488 Ritualized Abuse Of A Child 10492 13 15 11Total: Battery ASSAULT Assault 20560 2Total: Assault BURGLARY Burglary - Building 3 6 60610 Home Invasion 20650 Burglary - Motor Vehicle 1 30760 4 8 9Total: Burglary THEFT Theft From Motor Vehicle 1 30710 Theft 20711 Theft Of Lost Or Mislaid Property 20805 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Over $500 5 9 40815 Retail Theft - Falsely Represents To Merchant As Owner Of Property Seeking Money, Merchandise Credit, Other Property 20816 Retail Theft - Use Or Possess Theft Detection Shielding Device Or Remover To Deprive Merchant Of The Possession 10817 Retail Theft - Failure To Return Leased Property Or Pay Contract In Full 10818 Theft - Obtains/exerts Unauthorized Control Over Property Of The Owner Less Than $500 1 1 40825 Page 17 of 26January 2024 Operations Report 614 2022 2023 2024 Monthly Offenses Reported: January THEFT Retail Theft - Taking Merchandise From Retail Establishment With Intent To Deprive Merchant Without Paying 7 13 100860 Identity Theft 2 4 51137 Theft - Obtained By Deception Control Over Property Of The Owner 2 21139 Theft Of Motor Vehicle Parts Or Accessories-misdemeanor 12475 Possession Of Stolen Vehicle 12476 Theft Of Motor Vehicle Parts Or Accessories-felony 12476 15 34 35Total: Theft MOTOR VEHICLE THEFT Motor Vehicle Theft 3 10 20910 Recovered Stolen Vehicle 25084 3 12 2Total: Motor Vehicle Theft DECEPTIVE PRACTICES Deceptive Practices - General Deception 2 5 11110 Deceptive Practices - Bad Checks 1 21111 Deceptive Practices - Bank-related Fraud - False Statement, Possession Stolen Fraudulently Obtained Checks 11112 Deceptive Practices - Bank Related Fraud - Possession Of Implements Of Check Fraud 21113 Forgery 2 11120 Use Of Credit//debit Card With Intent To Defraud 11167 Fraud 2 21191 Computer Fraud 11242 7 13 3Total: Deceptive Practices CRIMINAL DAMAGE & TRESPASS TO PROPERTY Criminal Damage To Property 14 12 91310 Criminal Trespass To Real Property 21330 Criminal Damage To Government Supported Property 11340 Criminal Trespass To Vehicles 11360 Criminal Trespass Residence 21365 Trespass Warning 2 2 39375 17 18 13Total: Criminal Damage & Trespass to Property DEADLY WEAPONS Unlawful Use Weapon 11410 Aggravated Unlawful Use Of Weapon 11411 1 1Total: Deadly Weapons SEX OFFENSES Criminal Sexual Assault-threat Or Use Of Force 20260 Criminal Sexual Assault 3 20260 Criminal Sexual Assault With An Object - Rape 10281 Solicitation Of A Sexual Act 21504 Page 18 of 26January 2024 Operations Report 615 2022 2023 2024 Monthly Offenses Reported: January SEX OFFENSES Criminal Sexual Abuse - Sexual Conduct - Use Or Threat Of Force 1 11563 Grooming 11567 Criminal Sexual Abuse - Sexual Conduct - Offender Under 17 Yoa And Victim 9 To 17 Yoa 11571 Non-consensual Dissemination Of Private Sexual Images 31581 Child Pornography 1 1 21582 Aggravated Criminal Sexual Abuse - Offender 17 Yoa Or Older And Victim Is Less Than 13 Yoa 11594 6 5 11Total: Sex Offenses OFFENSES INVOLVING CHILDREN Runaway (m.r.a.i.) 11740 Juvenile Bullying 19279 Possession Of Tobacco/minor 16 9 49910 16 11 4Total: Offenses Involving Children CANNABIS CONTROL ACT Possession Of Cannabis - More Than 10g But Less Than 30g 1 11810 Possession Of Cannabis 10gm Or Less (ordinance Or Civil Violation) 4 31814 Possession Of Cannabis - Less Than 10g (civil/ordinance Violation) 71814 5 4 7Total: Cannabis Control Act CONTROLLED SUBSTANCE ACT Possession Controlled Substance 2 32020 Drug Activity 19183 Drug Overdose (misc/unknown) 19185 4 3Total: Controlled Substance Act DRUG PARAPHERNALIA ACT Possession Of Drug Paraphernalia 12170 1Total: Drug Paraphernalia Act LIQUOR CONTROL ACT VIOLATIONS Illegal Possession Alcohol By Minor 12220 Illegal Consumption Of Liquor By Person Under 21 Years Of Age 12230 1 1Total: Liquor Control Act Violations DISORDERLY CONDUCT Harassment By Telephone 12825 Harassment Through Electronic Communications 1 22826 Harassment Through Electronic Communications-threatening Injury To Person (family Or Household) Or Property 12827 Threaten Destruction Of School Or Violence, Death, Or Bodily Harm Against Persons At School, School Function, Or Event 12851 Disorderly Conduct - Actions Alarm Or Disturb Another Provoking Breach Of Peace 6 6 32890 Page 19 of 26January 2024 Operations Report 616 2022 2023 2024 Monthly Offenses Reported: January DISORDERLY CONDUCT Mob Action 13100 8 8 6Total: Disorderly Conduct INTERFERENCE WITH PUBLIC OFFICERS Resisting Or Obstructing Peace Officer, Firefighter, Or Correctional Institution Employee 1 2 13711 Obstructing Identification 23731 1 4 1Total: Interference with Public Officers TRAFFIC CRASHES Accident: Hit And Run (property Damage) 36548 Accident: Fatal 16555 Accident: Personal Injury 7 96556 Accident: Non-injury 101 676557 Accident: Property Damage 13 176558 Accident: Village /city/county Property 16562 Accident: Private Property 16563 Accident: Hit And Run (property Damage) 18528 Accident: Fatal 18535 Accident: Personal Injury 108536 Accident: Non-injury 908537 Accident: Property Damage 138538 Accident: Private Property 48543 121 99 119Total: Traffic Crashes VEHICLE TOW Tow: Abandoned Vehicle 26723 Tow: Vehicle 18668 2 1Total: Vehicle Tow PARKING Parking: All Other Violations 46300 Parking: Handicapped Violation 36304 Parking: Over Sidewalk (blocking Sidewalk) 56308 Parking: Overnight Prohibited/specific Hours 123 336310 Parking: Where Prohibited (sign Posted) 6 46312 Parking: Left Wheel To Curb 28507 Parking: Over Sidewalk (blocking Sidewalk) 118509 Parking: Overnight Prohibited/specific Hours 2668511 Parking: Where Prohibited (sign Posted) 98513 Parking: With Motor Running 18514 Parking: Within 15ft Of Fire Hydrant 18517 138 40 290Total: Parking MOTOR VEHICLE OFFENSES Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 4 82410 Dui - Under The Influence Of Alcohol 22410 Page 20 of 26January 2024 Operations Report 617 2022 2023 2024 Monthly Offenses Reported: January MOTOR VEHICLE OFFENSES Dui - Alcohol Concentration In Blood Or Breath 0.08 Or More 22411 Dui - Under The Influence Of Alcohol 10 102411 Dui - Under The Influence Of Drugs Or Combination Of Drugs 22420 Illegal Transportation Or Possession Of Alcoholic Liquor By Driver In Motor Vehicle 42430 Illegal Transportation Or Possession Of Alcoholic Liquor By Passenger In Motor Vehicle 22431 Possession Adult Use Cannabis In Passenger Area Of Motor Vehicle - Driver 12435 Possession Adult Use Cannabis In Motor Vehicle Outside Approved Container - Driver 8 12436 Reckless Driving - Drives Vehicle With Willful Or Wanton Disregard For Safety Of Persons Or Property 6 12440 Failure To Remain At The Scene Of A Vehicle Damage Accident 22447 Leaving Scene Property Damage Accident 3 32447 Squealing Or Screeching Tires 12448 Street Racing - Engaging In Street Racing On Any Street Or Highway - Driver 12450 Speeding - Over Statutory Limit 1 32454 Improper Lane Usage 7 8 92455 Operation Of Vehicle Without Registration 4 152456 Cancelled/suspended/revoked Registration 5 112460 Operation Of A Vehicle With Cancelled, Suspended Or Revoked Registration 72460 Operation Of Uninsured Motor Vehicle 85 60 352461 Operation Vehicle W/suspended Registration (no Insurance) 232462 Operation Of Motor Vehicle When Registration Suspended For Noninsurance 2 272462 Improper Use Of Registration 22465 Operating A Motor Vehicle With No Valid License, Permit, Or Restricted Driving Permit 15 19 62470 Driving While Driver's License, Permit, Or Privilege To Operate Motor Vehicle Is Suspended Or Revoked 1 132480 Suspended/revoked Drivers License 26 342480 Driver And Passenger Required To Use Safety Belts 112485 Driver And Passenger Safety Belts 7 32485 Unlawful Use Of Driver's License 12490 Fleeing Or Attempting To Elude A Peace Officer 22495 Aggravated Dui - No Driver's License, Permit, Restricted Driving Permit, Judicial Driving Permit, Monitoring Device Permit 2 12517 Child Restraint (improper Restraint Violation) 2 16148 Failure To Reduce Speed To Avoid Accident 35 136581 Failure To Signal 2 86584 Tire Violations 16592 Page 21 of 26January 2024 Operations Report 618 2022 2023 2024 Monthly Offenses Reported: January MOTOR VEHICLE OFFENSES Voided Tickets 0 06593 Speeding: Over 26 - 34 Mph Over Posted Limit 11 86594 Speeding: Over 35+ Mph Over Posted Limit 6 76595 Speeding: Radar 749 5026601 Too Fast For Conditions 3 196604 Traffic Sign Violation 34 206605 Traffic Signal Violation 10 46606 Improper Passing 4 26607 Improper Lane Usage 10 276608 Following Too Closely 1 26609 Improper Turn At Intersection 16611 Improper U-turn 16613 Failure To Yield: Intersection 16616 Failure To Yield: Turning Left 3 46617 Failure To Yield: Private Road 26618 Failure To Yield: Stop Sign 9 26620 Failure To Report Accident 16624 No Driver's License On Person 26625 Graduated License Violation(s) 16626 Improper Backing 16628 Improper Lighting (driving Without Lights) 2 186630 Improper Lighting (no Taillights) 21 146631 Failure To Dim Headlights 16632 Improper Lighting (one Headlight) 35 226633 Muffler Violations 4 26634 No Valid Safety Test (sticker) 46635 Rr Crossing Violations 16640 Warning Ticket - Moving Violations 1 16642 Warning Ticket - Equipment Violations 14 76643 Other Equipment Violations (citations Issued) 14 36648 Other Moving Violations (citations Issued) 16649 Improper Display Of Registration 26 396653 Violation Of Dl Classification 16662 Improper Overtaking 16665 Disobey Traffic Control Device (red Light) 5 76669 Driving In Wrong Lane 1 16677 Failure To Yield: Private Road Or Drive 36683 Obstructed/tinted Window(s) 3 96685 Improper Equipment 36699 Improper Turn 26700 All Other Traffic 1 16701 Illegal Use Of Cell Phone While Driving 25 96707 Page 22 of 26January 2024 Operations Report 619 2022 2023 2024 Monthly Offenses Reported: January MOTOR VEHICLE OFFENSES Operating Vehicle Not Equipped With Baid When Required 16711 Expired Registration 73 1436712 Expired/invalid Registration 13 106715 Unsafe Equipment 16717 Commercial Drivers License Or Permit Violations 17000 Failure To Give Aid/information 1 37002 Failure To Reduce Speed To Avoid Accident 218558 Failure To Signal 38559 Tire Violations 18561 Voided Tickets 08562 Speeding: Over 26 - 34 Mph Over Posted Limit 68563 Speeding: Over 35+ Mph Over Posted Limit 48564 Speeding: Radar 1628569 Too Fast For Conditions 78572 Traffic Sign Violation 88573 Traffic Signal Violation 48574 Improper Passing 28575 Improper U-turn 18580 Failure To Yield: Intersection 18582 Failure To Yield: Turning Left 38583 Failure To Yield: Private Road 18584 No Driver's License On Person 18590 Improper Lighting (driving Without Lights) 78593 Improper Lighting (no Taillights) 68594 Improper Lighting (one Headlight) 138596 Muffler Violations 18597 No Valid Safety Test (sticker) 28598 Warning Ticket - Equipment Violations 88605 Failure To Notify Sos Of Address Change 18607 Other Equipment Violations (citations Issued) 28609 Improper Display Of Registration 288614 Disobey Traffic Control Device 18619 Driving In Wrong Lane 28626 Failure To Yield: Private Road Or Drive 18631 Obstructed/tinted Window(s) 118633 Illegal Use Of Cell Phone While Driving 78654 Expired Registration 948656 Expired/invalid Registration 38659 Defective Windshield, Side Or Rear Window 19162 1295 1139 552Total: Motor Vehicle Offenses CITIZEN ASSIST Rescue 19029 Page 23 of 26January 2024 Operations Report 620 2022 2023 2024 Monthly Offenses Reported: January CITIZEN ASSIST Lock Out 27 24 369031 Found Bicycle 19068 Citizen Assist 29760 Abandoned Vehicle 1 19908 28 24 41Total: Citizen Assist MISSING PERSONS Missing Person: Adult Male 1 2 29064 Missing Person: Adult Female 19065 Found Missing Person 19069 1 2 4Total: Missing Persons OTHER OFFENSES Violation Of Order Of Protection 24387 Violation Order Of Protection 54387 Interfering With The Reporting Of Domestic Violence 14751 Domestic Dispute 10 14 94870 All Other Criminal Offenses 15000 In-state Warrant 9 13 55081 Expunged Offense 117001 30 33 17Total: Other Offenses SUSPICIOUS ACTIVITY Investigation Quasi-criminal 29100 Suspicious Auto 19101 Damage To Property: Non Criminal 2 29104 Disturbance/disputes 19110 Shots Fired/heard 19112 Nuisance/harassing Phone Calls 19118 Suspicious Circumstances 29356 5 5 2Total: Suspicious Activity LOST/FOUND PROPERTY Lost Driver's License/plates 1 19063 Found Property 1 1 19246 Lost/stolen Wallet/purse 19285 2 2 2Total: Lost/Found Property SUICIDE & DEATH INVESTIGATIONS Suicide: By Firearm 19401 Suicide: Other 19409 Suicide Attempt: By Drugs 1 29414 Death: Natural Causes 1 29431 Death: Other Sudden Death/bodies Found (death Investigation) 29438 Suicide Threat: Crisis Intervention 29607 2 5 5Total: Suicide & Death Investigations Page 24 of 26January 2024 Operations Report 621 2022 2023 2024 Monthly Offenses Reported: January AGENCY ASSIST Assist: Fire Department 1 19001 Assist: Other Police Department 2 1 39004 Assist: Other Government Agency 19005 Assist: Ambulance 3 5 39083 6 6 8Total: Agency Assist ANIMAL COMPLAINTS Dog Bite: Home 29201 Dog Bite: Other 1 1 19204 Stray Dogs/leash Law 1 19209 Animal (found) 19215 Destroy Injured Animal 29220 Animal Cruelty/well Being Check 19225 4 2 5Total: Animal Complaints CRISIS INTERVENTION Transportation Of Mental Cases 39301 Domestic Trouble: Crisis Intervention 2 1 19600 Marriage: Crisis Intervention 19601 Family: Crisis Intervention 2 19602 Parent-juvenile: Crisis Intervention 19603 Mental Illness: Crisis Intervention 9 28 189604 Deliquent Minor: Crisis Intervention 19613 Runaway: Crisis Intervention [juvenile Problems] 29637 Drugs: Crisis Intervention [therapy] 19647 18 31 22Total: Crisis Intervention OTHER INCIDENTS Evidence/property Duties 29099 Remove Subject/unwanted Subject (no Arrest) 1 19138 Civil Matter 1 1 19150 Threats 19366 Harassment 39367 Uninhabitable Residence 19380 Station Information 3 3 39507 Follow Up 29700 Welfare Check 3 69798 Fights, Riots, Brawls 3 39918 Service Of Order Of Protection 2 3 19933 14 14 16Total: Other Incidents Page 25 of 26January 2024 Operations Report 622 1767 1540 1189TOTAL *On 02/17/2023 and 10/12/2023 the Department made changes to many of the reportable offense codes (UCR) as required by the FBI and State of Illinois. This will explain some offenses seeming to be redundant as cases before 02/18 used a different set of codes. 14300 S. Coil Plus Drive, Plainfield, Illinois 60544-7704 Main Office # (815) 436-6544 Executive Office Fax # (815) 436-9681 Page 26 of 26January 2024 Operations Report 623