Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My Public Portal
About
02-06-24 Plan Commission Agenda Packet
Plan Commission Tuesday, February 06, 2024 7:00 PM Village Boardroom 24401 W. Lockport Street Plainfield, IL 60544 Agenda CALL TO ORDER PLEDGE TO THE FLAG ROLL CALL APPROVAL OF MINUTES Seeking a motion to approve the Minutes of Plan Commission meeting held on January 16, 2024. 01-16-24 Plan Commission Minutes.pdf PUBLIC COMMENTS DEVELOPMENT REPORT OLD BUSINESS NEW BUSINESS 1.TERRABIS - 16020 S. ROUTE 59 (CASE 2040-010424.SU) 1.a.Seeking a motion to open the Public Hearing for the proposed special use for the property located at 16020 S. Route 59. 1.b.Seeking a motion to close the Public Hearing for the proposed special use for the property located at 16020 S. Route 59. 1.c.Seeking a motion to adopt the findings of fact of staff as the findings of fact of the Plan Commission and, furthermore, recommend approval of the proposed special use Adult-Use Cannabis Dispensary for the property located at 16020 S. Route 59, subject to the stipulations in the staff report. 1 Plan Commission Page - 2 Terrabis Staff Report Packet 2.WOODMAN'S FOOD MARKET (CASE 2041-010724.AA.REZ.SU.SPR.PP) 2.a.Seeking a motion to open the Public Hearing for the proposed annexation, rezoning, and special use for Planned Development for the property located at northeast corner Route 59 and 119th St. 2.b.Seeking a motion to close the Public Hearing for the proposed annexation, rezoning, and special use for Planned Development for the property located at northeast corner Route 59 and 119th St. 2.c.Seeking a motion to recommend approval of annexation of the commercial development (PIN 07-01-22-300-017-0000), located generally on the northeast corner of S. Route 59 and W. 119th Street, as a logical extension of the Village boundary. Woodman's Food Market Staff Report Packet 2.d.Seeking a motion to adopt the findings of fact of staff as the findings of fact of the Plan Commission and recommend approval of the requested map amendment (re-zoning) of the subject site (PIN 07-01-22-300-017-0000) from R-1 Low Density Single-Family Residential District to B-3 Highway Business District. 2.e.Seeking a motion to adopt the findings of fact of staff as the findings of fact of the Plan Commission and, furthermore, recommend approval of the special use for planned development to permit the subject zoning variations and drive-through uses for the Woodman’s commercial development (PIN 07-01-22-300-017-0000), subject to the stipulations in the staff report. 2.f.Seeking a motion to recommend approval of the requested site plan review for the Woodman’s Food Market development at the northeast corner of S. Route 59 and W. 119th Street (PIN 07-01-22-300-017-0000), subject to the stipulations in the staff report. 2.g.Seeking a motion to recommend approval of the Preliminary Plat of Subdivision for a commercial development located at the northeast corner of S. Route 59 and W. 119th Street (PIN 07-01-22-300-017-0000), subject to the stipulations in the staff report. 3.HAWK AUTO - 16761 S. ROUTE 59 (CASE 2036-120723.SPR.FP) 3.a.Seeking a motion to recommend approval of the proposed Hawk Auto Final Plat of Subdivision, subject to the stipulations in the staff report. Hawk Auto Staff Report Packet 3.b.Seeking a motion to recommend approval of the proposed site plan review for the Hawk 2 Plan Commission Page - 3 Auto Site Plan, subject to the stipulations in the staff report. DISCUSSION ADJOURN REMINDERS - February 8th - Historic Preservation Commission at 7:00 p.m. February 12th - Committee of the Whole Workshop at 7:00 p.m. February 14th - Coffee with the Mayor – 9:00 a.m. at the Village Hall February 19th - Village Office Closed February 20th - Plan Commission at 7:00 p.m. 3 Plan Commission Record of Minutes Date: January 16, 2024 Location: Village Hall CALL TO ORDER Chairman Minnis called the Plan Commission meeting to order at 7:00 p.m. PLEDGE TO THE FLAG Chairman Minnis led the pledge to the flag. ROLL CALL Present: Commissioners Campanella, Heinen, Nicholson, Sula, Valerga, Womack and Chairman Minnis Absent: Commissioner Faheem and Goins Staff: Jake Melrose, Economic Development Director; Jonathan Proulx, Director of Planning; and Basmah Nadeem, Associate Planner APPROVAL OF MINUTES Commissioner Valerga made a motion to approve the Minutes of Plan Commission meeting held on December 5, 2023 as presented. Second by Commissioner Heinen. The motion carried unanimously by voice vote: PUBLIC COMMENTS No Public Comments. DEVELOPMENT REPORT Mr. Proulx provided an update on the following: Lockley Park, Parsonage Events, and Adult Use Cannabis Text Amendment OLD BUSINESS No Old Business. NEW BUSINESS PLAINFIELD LOGISTICS CENTRE (CASE 2035-120623.FP) Commissioner Heinen recused himself from this case. Mr. Proulx introduced the proposed final plat. Applicants were present for questions. There was a brief discussion regarding road connectivity and timeline of the road construction. Commissioner Valerga made a motion to recommend approval of the Final Plat of Subdivision of the Plainfield Logistics Centre, subject to the following two stipulations: 1. Compliance with the requirements of the Village Engineer; and 2. Compliance with the requirements of the Plainfield Fire Protection District. Ayes: Campanella, Heinen, Nicholson, Valerga, Womack and Minnis Nays: None Absent: Goins 4 Plan Commission Minutes January 16, 2024 Page 2 of 4 Commissioner Nicholson seconded the motion. The motion carried 6:0 by roll call vote. AUTUMN GLEN SUBDIVISION (CASE 2037-121223.FP.SSA) Mr. Proulx introduced the proposed final plat. Chairman Minnis swore in Vince Rosanova, attorney: and Michael Stowell, applicants. There was discussion regarding driveway access, parking, landscaping for parcels along the gas station, lack of access to RT 126, price point, how the current plan and elevation compare to what was initially approved for Onyx, lighting, the park site, windows on side elevations, and landscaping in the park site. Commissioner Valerga made a motion to recommend approval of the Final Plat of Subdivision of Autumn Glen, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District; and 3. Payment of recapture fees prior to final plat recording. Commissioner Womack seconded the motion. The motion carried 6:0 by roll call vote. TOWN HOME & COMMERICAL CONCEPT PLAN RT 59 & FRASER RD. (CASE 2034-120523.CP) Ms. Nadeem provided an overview of the proposed concept plan. Chairman Minnis swore in Param Vijay, applicant; and David Rawlings, architect. Mr. Rawlings provided a description of the proposed development. The following concerns and suggestions were provided by the Plan Commission: Concerns Internal site traffic generated from four (4) drive-thru users. The amount of commercial proposed for the development. Architecture being out of place with what is currently in Plainfield. Building height exceeding code. Containing groundwater and stormwater on the site. Proposed access points on RT 59 not being allowed by IDOT. Suggestions Creating a long building on RT 59 rather than having multiple commercial buildings. Detention pond being lined and having a zero-release pond. Ayes: Campanella, Nicholson, Valerga, Womack and Minnis Nays: None Absent: Goins Recused: Heinen Ayes: Campanella, Heinen, Nicholson, Valerga, Womack and Minnis Nays: None Absent: Goins 5 Plan Commission Minutes January 16, 2024 Page 3 of 4 Enhancing the landscaping buffer adjacent to the existing residential. Eliminating the commercial piece on the northwest corner and converting it to multi-family residential. Relocating the stormwater near the culvert so buffer is created from the existing residential. Working with the Village to have a full access point on Fraser Rd. into the commercial area. More multi-family less commercial because of limited access to RT 59. Green roofs to help with water detention. Moving the sidewalk to the opposite side of the building for safety. Identifying the drive-thru locations or the Village providing a set number of drive-thru’s to be allowed. VIDEO GAMING TEXT AMENDMENT (CASE 2033-120523.TA) Commissioner Valerga made a motion to open a Public Hearing for proposed text amendments to the Village of Plainfield Zoning Ordinance. Second by Commissioner Nicholson. The motion carried unanimously by voice vote: Mr. Melrose introduced the proposed Video Gaming Text Amendment. Chairman Minnis asked for public comments and there was no response. There was discussion regarding number of machines allowed in an establishment, history of the Video Gaming discussion at Village Board, how the location of a religious assembly affects the ability of a business to have video gaming, what type of businesses would be allowed to have video gaming, how neighboring communities are handling video gaming, and will there be a limit on the number locations permitted. Several commissioners indicated that the downtown businesses should be allowed to have video gaming, so they did not support restricting it in the B5 Overlay. Commissioner Valerga a motion to close the Public Hearing for proposed text amendments to the Village of Plainfield Zoning Ordinance. Second by Commissioner Heinen. The motion carried unanimously by voice vote: Commissioner Womack made a motion to recommend approval of the proposed text amendments to the Village of Plainfield Zoning Ordinance as outlined in the staff report and attachments. Commissioner Nicholson seconded the motion. The motion failed 6:0 by roll call vote. Ayes: Campanella, Heinen, Nicholson, Valerga, Womack and Minnis Nays: None Absent: Goins Ayes: Campanella, Heinen, Nicholson, Valerga, Womack and Minnis Nays: None Absent: Goins Ayes: None Nays: Campanella, Heinen, Nicholson, Valerga, Womack and Minnis Absent: Goins 6 Plan Commission Minutes January 16, 2024 Page 4 of 4 DISCUSSION No Discussion. Chairman Minnis read the reminders. ADJOURN Chairman Minnis adjourned the Plan Commission meeting at 8:39 p.m. Respectfully submitted by Tracey Erickson Tracey Erickson, Recording Secretary Click here to view the video of the meeting. 7 TO: PLAN COMMISSION FROM: BASMAH NADEEM, ASSOCIATE PLANNER MEETING DATE: FEBRUARY 6, 2024 SUBJECT: REPORT TO THE PLAN COMMISSION TERRABIS (ADULT-USE CANNABIS DISPENSARY) CASE # 2040-010424.SU REQUEST: Special Use for Adult-Use Cannabis Dispensary (Public Hearing) PETITIONER(S): Terrabis (Nicholas Liaromatis) LOCATION: 16020 S. Route 59 ZONING: B-3 Highway Business District COMP. PLAN: General Commercial DISCUSSION The petitioner, Terrabis, is seeking a recommendation of approval for a special use to permit an Adult-Use Cannabis Dispensary at 16020 S. Route 59. The applicant will be preserving the existing 3,140 square foot structure on the lot as well as maintaining the current general site layout. Per the Plainfield Municipal Code (Sec. 9-37), “… there are certain uses that, because of their unique characteristics, cannot be properly classified in any particular district or districts, without consideration in each case of the impact of those uses on adjacent properties and of the public need for the particular use in the particular location.” Due to this, the petitioner is applying for a special use intended for the cannabis dispensary as it is a use with unique characteristics and circumstances. Existing Conditions/ Site Context The subject site has been vacant since the departure of the Hardee’s establishment. The property is located in the Vintage Harvest Commercial subdivision, located on Route 59, and is adjacent to other B-3 Commercial uses. The adjacent land uses, zoning and street classifications are as follows: North: B-3 Highway Business District East: B-3 Highway Business District John F. Argoudelis PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally Larson Tom Ruane Brian Wojowski 8 REPORT TO THE PLAN COMMISSION Page #2 of 3 2040-010424.SU 02/06/2024 TERRABIS (ADULT-USE CANNABIS DISPENSARY) S. Route 59 (Major Arterial) South: B-3 Highway Business District West: B-3 Highway Business District ANALYSIS The applicant is seeking approval for a special use permit for an Adult-Use Cannabis Dispensary establishment. The petitioner is requesting this use for a lot located in the B-3 Highway Business District which is the sole zoning district this particular business establishment is permitted, through a special use. If granted, the subject site will be the first cannabis dispensary permitted in the Village. The operation will fulfill the standard for permitting one (1) cannabis dispensary south of Lockport Street and one (1) out of two (2) dispensary establishments permitted for the Village as a whole. If approved, subsequent prospective applicants will be precluded from applying for a cannabis dispensary positioned south of Lockport Street. Therefore, the use follows the code requirement in regards to location and the permittable amount of cannabis dispensary establishments. Per Sec. 9-78, one (1) parking stall is required per 200 square feet for Adult-Use Cannabis Dispensaries. As the existing structure will not be expanded, the current 3,140 square foot structure requires sixteen (16) parking stalls. The provided and extant 42 stalls, two (2) of which are ADA compliant, are well above the minimum standards. In order for the Plan Commission to recommend approval of a special use, it must make two findings of fact, as follows: a.) The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor substantially diminish property values within the neighborhood; and Staff finds that the special use will not be injurious to the use and enjoyment of other properties, nor will it diminish property values in the immediate area. Traffic for dispensaries is considered equal to the generation of Quick Service Restaurants (QSR), which is what this building previously was. A QSR is considered a permitted use in the subject zoning district. Furthermore, the subject site is surrounded by commercial properties, ensuring that it meets the standards for the neighborhood. Specifically, the proposed operation’s site is positioned further than the minimum 250 feet from schools, day care centers or homes, and residential parcels, ensuring a buffer. Additionally, the structure adheres to the standard of maintaining a distance of at least 1,500 feet from another adult-use cannabis facility as this would be the first one permitted thus far. The lot has been vacant since the departure of the Hardee’s establishment and has incurred over twenty (20) visits from the Village Code Enforcement department for its maintenance, causing issues that has the potential to being resolved with the proposed use. Instead of diminishing property values, the dilapidated structure can potentially improve the existing circumstances with the proposed use and drive new traffic to the center. 9 REPORT TO THE PLAN COMMISSION Page #3 of 3 2040-010424.SU 02/06/2024 TERRABIS (ADULT-USE CANNABIS DISPENSARY) b.) The establishment of the special use will not impede the normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff submits that the proposed cannabis establishment will not impose on the normal and orderly development for adjacent properties in the subject zoning district. The site layout will be similar as to what is proposed. The positioning of the subject site adjacent to Route 59 – a major arterial – and the provided parking stalls and ingress/egress, ensures that the site, and the adjacent properties are accustomed to the use. Public Notice Feedback Staff received two (2) phone calls in regard to the case, one requesting information pertaining to the special use request and one speaking in support. One resident spoke about concerns for security purposes and staff has outlined that the dispensary stock items will be secured with restricted and limited access. In addition, staff received one (1) letter of support which is enclosed as an exhibit. CONCLUSION/ RECOMMENDATION In conclusion, staff submits that the presented Adult-Use Cannabis Dispensary meets the findings of fact for the special use provisions. The lot has been sitting dilapidated since it’s vacancy and can offer a more pragmatic use with the cannabis dispensary that meets all the standards for special use and dispensaries. Based on the foregoing analysis, prior to any public comment or discussion by the Plan Commission, staff recommends approval. Should the Plan Commission concur, the following motion is offered for your consideration: I move we adopt the findings of fact of staff as the findings of fact of the Plan Commission and, furthermore, recommend approval of the proposed special use Adult-Use Cannabis Dispensary for the property located at 16020 S. Route 59, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; and 2. Compliance with the requirements of the Plainfield Fire Protection District. 3. Compliance with the requirements of the Village’s administrative site plan review. 10 16020 S RT 59 County of Will, Maxar, Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Utility Addresses Village Address Points Development Site Proposed Approved Parcels Plainfield Municipal Boundary 1/8/2024, 9:12:52 AM 0 0.1 0.20.05 mi 0 0.15 0.30.07 km 1:9,028 Plainfield Staff County of Will, Esri, HERE, Garmin, INCREMENT P, USGS, EPA, USDA | Plainfield GIS | NPMS National Repository | Will County GIS | Will County Clerk Tax Extension | Will County Supervisor of Assessments Office, Bureau of Land Management | County of Will,11 12 153 SF SECURED ENTRY 104 961 SF DISPENSING FLOOR 105 181 SF POS 106 175 SF DAY STORAGE 107 247 SF VAULT 108 383 SF BREAK AREA 109 8 SF JAN 110 87 SF MEN 111 80 SF WOMEN 112 59 SF SERVER 113 38 SF MECH 114 145 SF EXIT VESTIBULE 115 8'-1" 24'-8" 8'-7"15'-2"18'-6"4'-2"6'-0" 2'-1"3'-0"10'-8"7'-11" 36'-3" 8'-0" 6'-9"5'-6"1'-6"5'-11"10'-0" 24'-11"9'-11"10'-8"16'-6"22'-7"ADA STATION15'-2"2'-8" 8'-3" 3'-10"11'-2"7'-10" 12'-8"6'-7"4'-2"4'-8" 10'-6"14'-9"4'-0"153 SF SECURED ENTRY 104 961 SF DISPENSING FLOOR 105 181 SF POS 106 175 SF DAY STORAGE 107 247 SF VAULT 108 383 SF BREAK AREA 109 8 SF JAN 110 87 SF MEN 111 80 SF WOMEN 112 59 SF SERVER 113 38 SF MECH 114 145 SF EXIT VESTIBULE 115 0024 ACCESS LEGEND RESTRICTED ACCESS LIMITED ACCESS PUBLIC ACCESS BLDG. DEPT. APPROVAL 1242 MONTEGUT STREET NEW ORLEANS, LA 70117 SEAL DATE SCALE DRAWN CHECKED PROJECT NO. © 2023 FLEX DESIGN STUDIO, LLC.All rights reserved. No part of this document may be reproduced or utilized in any form, without prior written authorization by Flex Design Studio, LLC.4201 LAKE COOK ROAD, SUITE 102 NORTHBROOK, IL 60062 3/16" = 1'-0"12/27/2023 3:18:56 PMINTERIOR REMODEL OF EXISTING RETAIL SPACE 16020 S ROUTE 59 PLAINFIELD, IL 60544 NOT FOR CONSTRUCTION FLOORPLAN 001 12/27/23 AAF JHB #2.1.012 8'16'4'2'0 N SCALE: 3/16" = 1'-0"1 LEVEL 01 - FLOORPLAN SCALE: 3/16" = 1'-0"2 LEVEL 01 - ACCESS PLAN # DESCRIPTION DATE 13 Arbor of PlainfieldFairfield CommonsParkview Meadows Renwick Community Park Renwick Place Villas at Fox Run Vintage Harvest Pavillion PSD 202District OfficesCentral Elementary McMillen Farm Renwick Heights Renwick PointeLichtenwalter Subdivision JEC Lichtenwalter Commercial Spangler Farm HOWARD STFEENEY DRFRASER RD RENWICK RD IL-59RT 59County of Will, Maxar, Microsoft 250ft Buffer around schools, daycares & R-1/R-2 Zoning Business Transition Designation Business Convenience District Highway Business District Renwick & IL 59: 250 Foot Buffers For Schools, Daycares, & R-1/R-2 Residence Disclaimer: The Village of Plainfield provides no warranty, expressed or implied, as to the accuracy,reliability or completeness of furnished data. Users are cautioned to consider carefully the provisionalnature of these data and information before using them for decisions that concern personal or publicsafety or the conduct of business that involves substantial monetary or operational consequences.Conclusions drawn from, or actions undertaken on the basis of, such data and information are the soleresponsibility of the user. Maps and data are to be used for reference purposes only. 0 675 1,350337.5 Feet Subject Site 14 15 John F. Argoudelis PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally Larson Tom Ruane Brian Wojowski TO: PLAN COMMISSION FROM: BASMAH NADEEM, ASSOCIATE PLANNER MEETING DATE: FEBRUARY 6, 2024 SUBJECT: REPORT TO THE PLAN COMMISSION WOODMAN’S FOOD MARKET CASE NUMBER 2041-010724.AA.REZ.SU.SPR.PP REQUEST: Annexation (Public Hearing) Rezoning (Public Hearing) Special Use for Planned Development (Public Hearing) Site Plan Review Preliminary Plat LOCATION: NEC of S. Route 59 and W. 119th Street APPLICANT: Woodman’s Food Market (Bret Backus) ZONING: Will County A-1 Agricultural COMP. PLAN: General Commercial DISCUSSION The applicant, Woodman’s Market, is requesting annexation by annexation agreement, as well as rezoning from R-1 to B-3, a special use for a planned development (PD), site plan review, and preliminary plat of subdivision review to permit the construction of a Woodman’s grocery store with a gas station, car wash and oil change center along with 7 other outlots on approximately 36 acres at the northeast corner of S. Route 59 and W. 119th Street. The commercial development consists of nine (9) lots, landscaping buffers, stormwater detention, and accesses via S. Route 59 and W. 119th Street. A significant portion of the development includes the Woodman’s Food Market store, fuel station, convenience store, car wash, and oil change center, compromising of 27.3 acres. Woodman’s Food Market is an employee-owned company that presently manages and oversees operations across 19 establishments in Wisconsin and Illinois. Woodman’s offers an extensive array of grocery selections, alongside supplementary services including fuel stations. The Woodman’s development will act as a retail anchor for the seven (7) outlots. These outlots will be developed in forthcoming phases and will be considered for future site plan reviews. The subject site had previously been considered for a more expansive development known as “Shops at the Polo Club,” which included nearly 500,000 square feet of commercial space. This project consisted of a 16 REPORT TO THE PLAN COMMISSION Page #2 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET shopping center that would service the Village with various shops, large anchor tenants, movie theater restaurants, pedestrian amenities, etc. The plans were presented between 2006 and 2008, but ultimately did not move forward due to the economic downturn. The site is now proposed for the Woodman’s project, which has taken the layout and conceptual plan of the “Shops at the Polo Club” into consideration and has incorporated a few of the same details in the master site plan. These changes for the proposed new development will reflect the current economic and retail landscape. Existing Conditions/Site Context The subject property is approximately 36 acres and is unincorporated agricultural land. Currently, the property is vacant with a one-story metal building at the southeast corner of the lot on W. 119th Street. Existing vegetation buffers the subject site from the adjacent property directly east. The adjacent land uses, zoning, and functional street classifications are identified below: North: Naperville R1A Low Density Single-Family Residence District East: Will County A-1 Agricultural South: Will County I-1 Limited Industrial W. 119th Street (Major Arterial) (IDOT Strategic Regional Arterial) West: B-3 Highway Business District PUD – Plainfield Retail Center R-1 Low Density Single-Family Residential – Champion Creek S. Route 59 (Major Arterial) (IDOT Strategic Regional Arterial) ANALYSIS Annexation The applicant is seeking a recommendation of approval from the Plan Commission in order to annex into the Village of Plainfield by annexation agreement. The subject property is contiguous to the Village’s municipal boundary, located directly west of the site. As shown on the "Future Land Use Plan" of the Village's Comprehensive Plan, the subject site is included in the Village's boundaries as well as the Village’s Planning Area. Therefore, staff submits that the annexation of the property would be a logical extension of the Village's boundaries. Rezoning Upon annexation, the subject property is given a R-1 (Low Density Single-Family) zoning designation. The petitioner is seeking rezoning to B-3 Highway Business District to facilitate the development of the proposed Woodman’s project alongside the outlots. In order for the Plan Commission to recommend approval of the requested map amendment, it must make the following findings of fact based on the evidence presented. a. That the rezoning promotes the public health, safety, comfort, convenience, and general welfare, and complies with the polices and plans of the Village; The proposed B-3 zoning complies with the future land use designation (General Commercial) in the Village’s Comprehensive Plan. It will promote commercial development, which will help diversify the Village’s property tax base, provide opportunities for shopping and employment, and generate sales tax revenue. A fiscal impact study conducted for the project estimates that it would yield over 500 employment opportunities, generate sales tax revenue on the order of $41 million, and an estimated $6 million in property taxes during a 15-year duration. The project would achieve 17 REPORT TO THE PLAN COMMISSION Page #3 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET an improvement in the diversification of the Village’s property tax base, shifting more property tax burden away from homeowners. The development will also be required to provide all necessary road improvements to accommodate the traffic generated from the project, which is extrapolated to exceed $10 million in improvements. All of these are advantages that are conducive to enhancing the public health, safety and general welfare of the community in furtherance of implementation of the Village’s Comprehensive Plan. b. That the trend of development in the area is consistent with the requested rezoning; The requested zoning is consistent with the B-3 zoning in the immediate vicinity, which includes B-3 commercial areas west of S. Route 59 and unincorporated non-residential at the SEC of S. Route 59 and W. 119th Street. c. That the new zoning requested allows uses that are more suitable than those allowed under the existing zoning; Staff maintains that the proposed B-3 commercial use is more appropriate than the default R-1 zoning that would be established following annexation. The subject property is adjacent to two major arterials – Route 59 and 119th Street – both designated by the Illinois Department of Transportation as a strategic regional arterial; and the property is westerly adjacent to existing B-3 commercial developments. These commercial developments can benefit from the increased traffic and would not be negatively impacted by the noise and other aspects of this highly trafficked locale. d. That the property cannot yield a reasonable use under the existing zoning; and As stated above, staff observes that the location adjacent to major arterial roadways, in proximity to commercial and industrial uses, corroborates the subject site as untenable for single-family development and the highest/best use of the proposed property is B-3 as planned by the Village for numerous years. This position is further supported by considering the ample alternative locations available for single-family development and the limited (i.e., not infinite) housing demand. e. That the rezoning would not alter the essential character of the neighborhood, nor would it be a substantial detriment to adjacent properties. The rezoning would facilitate a continuation of the Route 59 commercial corridor. It would further support the commercial developments adjacent to the subject site and is projected to create employment opportunities as well as generate tax revenue. Staff maintains that the rezoning would not alter the essential character of the neighborhood, instead it would bolster the opportunities for the neighboring adjacent properties. Special Use for Planned Development The petitioner is seeking a special use permit for a planned development to allow for drive-thru operations for the proposed car wash operation and future outlot development in Lots 2, 3, 4, 5, 7, and 8, as well as zoning flexibility outlined below. Planned Development (PD) Drive-Thru Staff presents that the drive-thru uses are appropriate for the Route 59 corridor. Per Sec. 9-78, the Woodman’s car wash positioned south of the gas station site will include three (3) washing bays that meet 18 REPORT TO THE PLAN COMMISSION Page #4 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET and exceed the required stacking standard of six (6) spaces per washing bay. As for the future drive-thrus, the petitioner is requesting entitlements for drive-thru operations for all outlots positioned towards the southern boundary of the subject site, as well as two (2) outlots adjacent to the western boundary. These will still require site plan approval that will give the Village ample opportunity to enforce screening and orientation requirements for the drive-thrus on the outlots. Considering the size of the development and the numerous access points throughout, staff finds the proposed uses acceptable. In order for the Plan Commission to recommend approval of a special use for the drive-thru operation, it must make two findings of fact based on the specific circumstances of this project as follows: a. The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor would it substantially diminish property values within the neighborhood; and Staff finds that the special use will not be injurious to the use and enjoyment of other properties, nor will it diminish property values in the immediate area. The subject site is surrounded by commercial properties, ensuring that it meets the standards for the neighborhood. Specifically, the petitioner is implementing a landscape buffer surrounding the fuel station site which will aid in preventing any potential unsightly views or noises from adjacent properties and roadways. b. The establishment of the special use will not impede normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff submits that the proposed drive-thru operations will not impose on the normal and orderly development for adjacent properties in the subject zoning district and can instead spur additional development for the outlots. Planned Development (PD) Zoning Flexibility The planned development approach provides the flexibility needed to promote innovative and creative land development that achieves the community vision outlined in the Comprehensive Plan. The planned development will provide for a coordinated development plan with consistent and compatible architectural design and landscaping throughout the subject site. The applicant will provide more information pertaining to the planned development agreement as the project progresses. Staff submits that the requested zoning reliefs from the Village Zoning Ordinance are appropriate and beneficial to the area, playing a pivotal role in sustaining the project’s future development endeavors. The applicant has proposed relief from the following: Section 9-121. – Lighting Per code, the light levels at the lot lines, with the exception of ingress and egress points, should be a maximum of 0.5 footcandles. The lighting spillover in proximity to the lot boundaries on the southwest corner of the designated site (up to 1.5 footcandles) arises from the presence of the fuel station, a common occurrence in gas dispensary developments and alongside the Route 59 commercial corridor. Staff deems that the landscape area oriented on the southwest corner of the subject property is sufficient to minimize the lighting from affecting adjacent roadways or properties. Section 9-116. – Design requirements As outlined in the code, if there were to be a façade that exceeds 100 feet, it shall incorporate some horizontal architectural relief. The Village requires this so as to amplify the existing architectural amenities. 19 REPORT TO THE PLAN COMMISSION Page #5 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET An uninterrupted façade exceeding 100 feet (approximately 142 feet) west of the food market’s parcel pick-up and east of the secondary Woodman’s signage does not include the required architectural relief. Staff contends that this aspect is not imperative for the architectural enhancement of the façade, given that the applicant has sufficiently incorporated features throughout other sections of the structure and Woodman’s is unique in its size comparatively to other commercial users. The petitioner is proposing another relief from the design standards, in regard to integrating sidewalks no less than eight (8) feet in width along the full length of any building façade featuring a customer entrance and abutting a public parking area. The sidewalk width adjacent to the Woodman’s grocery store structure is diminished in various strategic places on the site plan so as to aid in the aforementioned architectural enhancements, provide wider drive aisles, and create accessible parking stalls. The narrowest width on the main façade measures at 6.5 feet, a dimension deemed ample by staff for private sidewalk requirements. For main entrances, more space is provided that generally meets or exceeds the eight (8) foot standard. In addition, the applicant is requesting relief from the standard to include a public space within the vicinity of the grocery store structure’s main pedestrian entrance. The applicant is already implementing one such feature, exemplified by seasonal plantings, in the vicinity of the main entrance. However, the other features as required by the code are mostly in relation to larger retail developments where pedestrian amenities are also enhanced, such as shopping centers. As this is a retail anchor located in the B-3 Highway Business District, staff maintains that this is not a necessary requirement for this project as the definition of this district calls for customers arriving mostly through automobile use. Other pedestrian features will be added to enhance the user experience, such as connecting walkways to paths oriented on arterial roads. Future outlot development can potentially aid in providing more of these features. The last design guideline the applicant is requesting relief from is in relation to the maximum height of the Woodman’s food market structure. A commercial structure with a flat roof design, as is the Woodman’s Food Market, shall incorporate a parapet that provides for 100 percent screening of HVAC or mechanical equipment for public view. The height shall not exceed one-third of the height of the supporting wall. The height of the parapet is 51 feet whereas the height of the supporting wall is at an estimated 30 feet. Based on this, the height should not exceed 40 feet. The applicant is requesting this relief so as to aid in screening of HVAC and mechanical equipment located on the roof. Additionally, staff asserts that the Woodman’s parapet is integral to the project’s character and development, given its widespread use across various Woodman’s locations. Section. 9-78. – Schedule of off-street parking requirements Per code, the amount of parking stalls provided at minimum for the Woodman’s Food Market shall be one (1) space per 200 square foot of gross floor area. Based on this guideline, the required amount would be 1,218 stalls. The project has provided 613 stalls. Staff submits that this is a sufficient amount as the proposed Woodman’s Food Market will have 136,000 square feet of selling area and the remainder of the building, approximately 107,500 square feet, will be warehouse/storage space. This holds considerable importance regarding parking for consumers, as the parking demand is primarily contingent upon the square footage of the sales area, rather than storage space. This would result in a reduction of the requirement to 680 stalls, a figure much closer to the proposed quantity. Staff supports the parking relief as the required amount would be excessive for this project and would ultimately create parking that remains unused. 20 REPORT TO THE PLAN COMMISSION Page #6 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET In exchange for the relief identified above, the developer commits to exceeding the Village's Zoning Code requirements as follows: • Enhanced corner-lot and buffer landscaping • Off-site street improvements • Ample amount of stacking for drive-thru operations In order for the Plan Commission to recommend approval of a special use for a planned development and the deviations associated with the specific case, the applicant must demonstrate additional findings per the below. The findings of fact associated with the planned development are applied to the requests from the PD (i.e. zoning variations, special use requests) and not the development as a whole. a. The special use will not be injurious to the use and enjoyment of other property in the immediate area for the purposes already permitted, nor would it substantially diminish property values; Staff deems that the planned development requests would not be detrimental to adjacent properties nor would it diminish property values. Staff submits that this development is compatible and consistent with the planning of the area for nearly 20 years and the requests are reasonable. b. The establishment of the special use will not impede normal and orderly development and improvement of the adjacent properties for uses permitted in the subject zoning district. Staff maintains that the proposed plan is compatible with adjacent commercial projects and will be consistent with the trend of development in the area. Indeed, the implementation of offsite roadway enhancements will foster additional improvements and developments in the surrounding areas contiguous to the subject site. The requested relief would also enhance the character and compatibility of the site with adjacent properties. c. The planned development fulfills the objectives of the comprehensive plan and the land use policies of the Village and presents an innovative and creative approach to the development of land and living environments; The proposed project would fulfill the intent of the Comprehensive Plan’s future land use designation as “General Commercial” for the subject property. The proposed relief granted by the planned development will further achieve objectives and goals as outlined in the Village’s Comprehensive Plan including, “Foster a wide-ranging tax base that increases employment opportunities within Plainfield” and “Strategically provide convenient business locations to provide residents with desired access to goods and services.” d. The proposed land uses fulfill, or can reasonably be expected to fulfill, a need or demand for such uses within the Village; Staff finds that the requested planned development fulfills a demand for an additional affordable grocery store option within the Village, filling the role after Walmart’s departure. Woodman’s products and services can supply a more cost-effective alternative for both Plainfield and Naperville residents. Staff also deems that a flexible nature to a project of this magnitude is of the utmost importance as the Village seeks to recruit more retail development for this endeavor and further diversify the local tax base. 21 REPORT TO THE PLAN COMMISSION Page #7 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET e. The physical design of the planned development efficiently utilizes the land, adequately provides for transportation and public facilities, and preserves natural features of the site, and that the property is suitable for the proposed purposes and land uses; Staff deems that the requested site plan and parking relief adequately provides for the subject property. In addition, the projected offsite street improvements will garner enhancements for transportation efforts on these major arterial roads. As for preservation, there are no existing natural features, such as trees, located on the site. The eastside abundance of vegetation is located primarily on the adjacent property and will remain as is. Therefore, staff submits that the proposed land use plan utilizes the site efficiently and the requested relief would only further enhance the compatibility of the site as a whole. f. Any exceptions to bulk and density regulations of the underlying zoning shall be solely for the purpose of promoting an efficient and coordinated site plan, no less beneficial to the residents or occupants of such development, as well as the neighboring property, than would be obtained under the bulk and density regulations of this ordinance for buildings developed on separate zoning lots; Staff asserts that the requested bulk and density relief, in regard to the building height and parking relief, are appropriate for the project and are in efforts to promote an efficient and coordinated site plan, as well as architecture, for the structure. Increasing the parking capacity will impact the overall site layout, create a desolate landscape of over abundant parking stalls particularly at non-peak hours, and is not necessary for this development as the requested amount is sufficient. Additionally, the building height request is essential to the character of the Woodman’s project and if the max building height was utilized at 35 feet, the entryway parapet would be a five (5) foot variance. Further, staff has found many communities have allowed for the proposed type of height in their intense highway zoning districts. For instance, Naperville’s comparable zoning district does not have a building height maximum but instead utilizes floor area ratio as the tool to control height within a development, which this project would comply with. If approved, the relief requests would benefit the surrounding neighborhood as it would further enhance the attributes of the site. g. The planned development meets the requirements and standards of the planned development regulations; The proposed planned development complies with the requirements of the planned development standards in the zoning code. h. Open spaces and recreational facilities are provided; The anticipated development has a proposed stormwater detention east of the subject area which could provide scenic open space. However, as mentioned above, the public facility standard is not suitable for this development as the amenities for this type of project are automobile-oriented, a difference from the shopping center or residential development this requirement is tailored towards. Instead, Woodman’s is offering improved pedestrian connectivity to the street walkways. Staff considers that the proposed features of the site remain in accordance with the required standard. i. The planned development is compatible with the adjacent properties and the neighborhood, and along the periphery of the planned development, yards or setbacks shall be provided that meet or exceed the regulations of the district in which the planned development is located; 22 REPORT TO THE PLAN COMMISSION Page #8 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET As mentioned, staff submits that the proposed planned development is compatible with adjacent commercial and industrial properties. Landscaping buffers have been proposed along the corner lot where the fuel station site is oriented, with additional dense buffers positioned north of the site separating the project from residentially zoned homes. This buffer area exceeds the required yard amount in the Village code. From this it is evident that the yard setbacks meet or exceed the required standard and provide an ample amount of space between adjacent properties and roadways. j. That the land uses permitted are necessary or desirable and are appropriate with respect to the primary purpose of the planned development; Staff submits that this project will enhance commercial and retail development within the Village, improve street connectivity, aid in traffic management for the expanding area, and efficiently utilize land. k. That the land uses are not of such a nature, or so located, as to exercise a detrimental influence on the surrounding neighborhood. Staff submits that the requested planned development is appropriate and compatible with adjacent communities for the proposed land use and designs as this area has been planned for commercial development for over 20 years. Impacts are being mitigated through buffer yards and implementation of Village development standards. Site Plan Review Site Plan The overall site encompasses the Woodman’s project (food market, fuel station, convenience store, car wash, and oil change center) as well as the seven (7) outlots, proposed stormwater detention, landscaping, parking, access drives and drive aisles – totaling an estimated 36 acres. The grocery store will be centrally located within the development and occupy a significant portion of the area, with the lot itself encompassing approximately 24 acres and featuring a proposed structure spanning an estimated 243,500 square feet. The southwest corner lot of the subject site will be developed for the gas dispensers, convenience shop, car wash facility, and oil change service. The oil change center and the convenience store will share the same structure, the shop located on the east side of the building and the auto service provided on the west. All of these services in combination would relatively add up to 3.29 acres. The Woodman’s project would occupy two (2) of the total nine (9) lots in the proposed development. The seven (7) outlots and the requested drive-thru operations are to be reviewed as development occurs and site plan review will be required. It should be noted that outlot nine (9), directly adjacent to the residential area, is not proposed to include a drive-thru operation. Additionally, this lot will be required to adhere to any transitional buffer yard requirements established by the Village at that time. The overall site layout, and specifically Woodman’s project, is in compliance with the B-3 district standards as outlined below in Table 1. 23 24 25 REPORT TO THE PLAN COMMISSION Page #11 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET The gas dispensary, oil change service, convenience store, and car wash have similar architectural features as the food market. Landscape Plan The applicant has submitted an overall landscape plan for the project. The plan includes parkway tree plantings, landscaped buffers, corner-lot landscaping, and internal parking lot plantings. There is an existing buffer for the adjacent property east of the site, with tall trees lining the neighboring site. The stormwater detention positioned near the east boundary of the subject property will add to the buffer from the building to the eastern unincorporated property. A transitional yard/landscaped buffer is provided on the north side of the subject property, adjacent to the Naperville South Pointe subdivision. This area includes a five (5) foot berm over 400 feet long with dense landscaping mixed with evergreen trees for seasonal screening. The transitional buffer area is positioned with a separation of over 100 feet from the parking lot and over 160 feet from the building, ensuring ample space and distance between each component. A landscape buffer or transitional yard will need to be implemented at the time of development for the outlot adjacent to South Pointe. The parkway tree plantings and shrubs on the corner lot – the location of the gas station site – also has an attractive cluster of plantings fronting Route 59 and 119th Street. Internally, the food market development’s central parking lot has varying plantings spaced proportionately throughout the site. Trash Enclosure Trash compactors are presented east of the grocery store, in the rear of the food market structure, as well as the south side of the convenience store. The trash enclosure for both structures will be constructed with similar materials utilized on the primary structure. Lighting In most cases, the proposed photometric plan conforms to the zoning code (Sec. 9-121), which indicates that no more than 0.5 footcandles can spill onto adjacent properties other than for ingress/egress. The notable exception to this is that the spillage on the southwest side of the property is as high as 1.5 footcandles. As suggested in the special use section above, staff proposes its inclusion in the PD. The spillage extends onto the right-of-way but does not impact adjacent commercial properties. The light fixtures also generally conform to the code. The light fixtures utilized around the primary Woodman’s structure are predominantly ornamental in design and add to the character and enhancement of the project. Staff notes the use of this ornamental light fixture on the north side of the structure, facing the residential subdivision, can raise concerns over exposure. Some of the exterior lights on this façade are compact, directly attached to the façade, and downlit. Staff suggests considering a dark-sky compliant approach to the northern façade. Engineering/Stormwater Management Final engineering approval is not required during consideration of the zoning entitlements; however, Woodman’s has been coordinating with the Village engineering department for months prior to this meeting. The applicant has proposed stormwater detention area on the east side of the property and extensive improvements to the surrounding street network. Specifically, the applicant is projected to widen and improve W. 119th Street and S. Route 59 near the subject site. These improvements will serve and benefit the surrounding commercial, industrial, and residential areas. Separately, the applicant will dedicate sufficient right-of-way at the southern boundary of the site onto W. 119th Street for additional right-turn 26 REPORT TO THE PLAN COMMISSION Page #12 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET improvements to this intersection. A traffic impact study has been under IDOT review, and the applicant and Village staff has also been coordinating with Pulte’s engineering group as it relates to the W. 119th Street improvements. Preliminary Plat The petitioner has submitted a preliminary plat of subdivision with two (2) lots proposed for development, one of which would encompass stormwater detention, and seven (7) outlots for future development. Each lot conforms to the minimum zoning requirements in regards to lot and setback standards. The applicant is proposing dedicating right-of-way on the southside boundary of the subject site. Staff notes that this may require further coordination in the final engineering phase as well as other utilities that will be evaluated during the final engineering review. Public Notice Feedback Staff has received feedback from the general public in relation to the proposed development. One common question residents raised pertained to the Walmart vacancy and the rationale behind Woodman’s inability to fill the vacant structure. Staff has explained, as directed by the Village’s press release on the matter, that the applicant and the Village did collaborate with Walmart in efforts to redevelop the vacant storefront. Ultimately, the combined efforts were unsuccessful and instead the subject site is being proposed for the Woodman’ development as it holds for a more efficient site layout. Other concerns were in relation to traffic which staff has addressed that the petitioner is providing offsite improvements to aid in this matter. Residents expressing support for the development conveyed enthusiasm regarding the potential employment opportunities, the extensive array of affordable products the market could offer, and the projected roadway improvements for the major arterial roads. CONCLUSION/RECOMMENDATION In summary, staff submits that the proposed project represents a logical extension of the Village's boundaries, with a development that complies to the standards of the Village’s Zoning Code as shown in the applicant’s site plan and preliminary plat. The proposed use is appropriate at the subject location and staff supports the relief requested from the Zoning Ordinance. Staff maintains that the findings of fact have been demonstrated to support the annexation, proposed map amendment (rezoning), and special use for planned development. Based on the foregoing analysis, prior to any public comment or discussion by the Plan Commission, staff recommends approval. Should the Plan Commission concur, the following motions are offered for your consideration: Annexation I move we recommend approval of annexation of the commercial development (PIN 07-01-22-300-017-0000), located generally on the northeast corner of S. Route 59 and W. 119th Street, as a logical extension of the Village boundary. Zoning Map Amendment (Re-Zoning) I move we adopt the findings of fact of staff as the findings of fact of the Plan Commission and recommend approval of the requested map amendment (re-zoning) of the subject site (PIN 07-01-22-300-017-0000) from R-1 Low Density Single-Family Residential District to B-3 Highway Business District. Special Use for Planned Development I move we adopt the findings of fact of staff as the findings of fact of the Plan Commission and, furthermore, recommend approval of the special use for planned development to permit the subject 27 REPORT TO THE PLAN COMMISSION Page #13 of 13 2041-010724.AA.REZ.SU.SPR.PP 02/06/2024 WOODMAN’S FOOD MARKET zoning variations and drive-through uses for the Woodman’s commercial development (PIN 07-01-22-300-017-0000), subject to the following two (2) stipulations: 1. Compliance with the requirements of the Village Engineer; and 2. Compliance with the requirements of the Plainfield Fire Protection District; and Site Plan Review I move we recommend approval of the requested site plan review for the Woodman’s Food Market development at the northeast corner of S. Route 59 and W. 119th Street (PIN 07-01-22-300-017-0000), subject to the following two (2) stipulations: 1. Compliance with the requirements of the Village Engineer; and 2. Compliance with the requirements of the Plainfield Fire Protection District. Preliminary Plat I move we recommend approval of the Preliminary Plat of Subdivision for a commercial development located at the northeast corner of S. Route 59 and W. 119th Street (PIN 07-01-22-300-017-0000), subject to the following two (2) stipulations: 1. Compliance with the requirements of the Village Engineer; and 2. Compliance with the requirements of the Plainfield Fire Protection District. 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 From:michelle.zieg To:Basmah Nadeem Subject:RE: *NEW SUBMISSION* Contact Us Date:Monday, January 22, 2024 12:39:27 PM Hello Basmah Nadeem, Thank you very much for your prompt response. I am glad to hear this is being discussed as part of the planning for the development given the issues we already experience at 119th/59. I am very much looking forward to this addition to Plainfield! Thank you,Michelle -------- Original message -------- From: Basmah Nadeem <bNadeem@goplainfield.com>Date: 1/22/24 12:20 PM (GMT-06:00) To: Subject: RE: *NEW SUBMISSION* Contact Us Hi Michelle, We are still in the preliminary stages of discussing this with the Woodman’s team. They are currently proposing changes to both RT 59 and 119th St. to aid with the traffic, such as addedtraffic signals and turn lanes for both of these roads. We will continue to keep this concern over traffic into consideration for our future discussions with the team. Let me know if you have any other questions or concerns on the matter. Regards, Basmah Nadeem (They/She) 75 Associate Planner -- Village of Plainfield, IL (815)-230-2034 From: govAccess CMS Site <plainfield-il@enotify.visioninternet.com> Sent: Friday, January 19, 2024 1:10 PMTo: Village of Plainfield info <info@goplainfield.com>Subject: *NEW SUBMISSION* Contact Us Contact Us Submission #:2947602 IP Address: Submission Date:01/19/2024 1:10 Survey Time:10 minutes, 11 seconds You have a new online form submission. Note: all answers displaying "*****" are marked as sensitive and must be viewed after yourlogin. Name Michelle Ziegenhagen Address Reason for Contact Mayor's Office Please provide a brief description of how we can assist you, include an address or 76 location if applicable: Hello Mayor Argoudelis, I am beyond excited to see the potential of a Woodman's come to Plainfield. This will be a great addition to replace the void that Walmart left in our more affordable grocery options. I do hope this is approved by the board and comes to fruition. Seeing 119th and 59 already experiences major traffic issues backing up 119th, especially on the East side, even with the Polo Club development only considering adding turn lanes, (not enough in my opinion ), I would like to know more about what the road plans will be bringing Woodman's, a large footprint store, to that corner. Will 119th get additional lanes and will this be something Woodman's would be paying for or would this come out of tax payer dollars? Will there be changes/lights on 59? While I know a lot of this may still be in talks and plans not yet drawn up, if answers cannot yet be provided, please take these concerns into consideration when working with Woodman's on future discussions. Thank you for your time, Michelle Ziegenhagen Phone Email Thank you,Village Of Plainfield, IL This is an automated message generated by Granicus. Please do not reply directly to this email. ATTENTION: This email originated from a sender that is outside the Village of Plainfield'semail system. Please exercise caution when replying to this message or clicking on links orattachments. ATTENTION: This email originated from a sender that is outside the Village of Plainfield'semail system. Please exercise caution when replying to this message or clicking on links orattachments. 77 From:Basmah Nadeem To:Russell Smith Subject:RE: Delivery Status Notification (Failure) Date:Thursday, January 25, 2024 12:21:00 PM Attachments:image001.png We will note your comment. Basmah Nadeem (They/She) Associate Planner -- Village of Plainfield, IL (815)-230-2034 From: Russell Smith Sent: Thursday, January 25, 2024 11:57 AM To: Basmah Nadeem <bNadeem@goplainfield.com> Subject: Re: Delivery Status Notification (Failure) Ok thanks, but pass this message on if you wish, we don’t want some high end developers taken over our land and fields to line their pockets with money. I will be standing in the way, I have lawyers ready to fight plainfield and Naperville . More taxes ,more traffic ,less fields in an already congested area. Won’t happen on my watch . Thanks On Thu, Jan 25, 2024 at 9:26 AM Basmah Nadeem <bNadeem@goplainfield.com> wrote: https://www.plainfieldil.gov/government/agendas-meetings Basmah Nadeem (They/She) Associate Planner -- Village of Plainfield, IL (815)-230-2034 From: Russell Smith Sent: Thursday, January 25, 2024 9:21 AM To: Basmah Nadeem <bNadeem@goplainfield.com> Subject: Re: Delivery Status Notification (Failure) Where will it be posted On Thu, Jan 25, 2024 at 9:19 AM Basmah Nadeem <bNadeem@goplainfield.com> wrote: Russell – 119th will not be a one-way road and they will expand part of 119th to make room for the turn lanes. 78 Again, the roadway plans are still in the preliminary stages and the concept plan will be posted soon. If interested, I suggest keeping an eye out for that. Basmah Nadeem (They/She) Associate Planner -- Village of Plainfield, IL (815)-230-2034 From: Russell Smith Sent: Wednesday, January 24, 2024 9:53 AM To: Basmah Nadeem <bNadeem@goplainfield.com> Subject: Re: Delivery Status Notification (Failure) That’s not going to work, 119 th needs to be widened not just 2 turn lanes . Right now sometimes 119 th street is backed up from rt 59 all the way to book rd and that’s with out 401 homes and that’s with out a woodmens . I can speak for the 82 homes in my subdivision we aren’t going to wait 30 min to make a left hand turn onto 119 th . I also heard they were going to make 119 th street a one way road? Is that correct? Because that absolutely won’t work. I know this is all about money but people who plan this needs to be considerate of the home owners who have lived in wolf creek/ sterling estates for years . I would like to see a road plan on what they are proposing . Otherwise I’ll take this to court and drag it out as long as possible until woodmens backs out and goes someplace else . Thanks On Wed, Jan 24, 2024 at 9:45 AM Basmah Nadeem <bNadeem@goplainfield.com> wrote: Hi Russell, We are still in the preliminary stages of discussing this with the Woodman’s team. They are currently proposing changes to both RT 59 and 119th St. to aid with potential traffic, such as added traffic signals and turn lanes for both of these roads. Woodman's is projected to contribute an estimated $10 million for these improvements and is working alongside the Illinois Department of Transportation (IDOT) to obtain these approvals for the added traffic signals and turn lanes. We will continue to keep this concern over traffic into consideration for our future discussions with the team. Best, Basmah Nadeem (They/She) Associate Planner -- 79 80 Address not found Your message wasn't delivered to building@goolainfield.com because the domain goolainfield.com couldn't be found. Check for typos or unnecessary spaces and try again. LEARN MORE The response was: DNS Error: DNS type 'mx' lookup of goolainfield.com responded withcode NXDOMAIN Domain name not found: goolainfield.com Learn more athttps://support.google.com/mail/?p=BadRcptDomain ---------- Forwarded message ---------- From: Russell Smith To: building@goolainfield.com Cc: Bcc: Date: Mon, 22 Jan 2024 09:26:15 -0600 Subject: Good morning To whom it may concern, I’m a resident in unincorporated Plainfield in wheatland township off 119 th between rt 59 and naperplainfield rd , To my understanding woodmens is expected to build on the corner of 119 th and 59. My questions are , what are they going to do about the traffic and why can’t they take over the old Walmart? In our subdivision we have 1 way in and 1 way out, to turn left out of our subdivision onto 119 th is a nightmare and they haven’t even built 140 homes yet let alone a woodmens. There are 82 homes that are affected by the traffic . We were against the homes going in and now we are against the woodmens going in unless they widen 119 th or open our emergency exit so we can leave our neighborhood safely. Pass this on to the correct person and I want to know what there plans are for our neighborhood and traffic . If nothing is done we will file a lawsuit against the village of Plainfield , pulte and woodmens . Thanks you 81 From:Jeffrey Pawlicki To:Jake Melrose Subject:Woodman"s et al Date:Tuesday, January 23, 2024 8:25:20 AM Hello Mr. Melrose, I am a resident of Plainfield since 2009 and I was just reading about the Woodman’s development. I would like to express my disappointment with the news of new construction when the Walmart facility stands vacant. I think the village officials of Plainfield need to rethink this new construction and utilize and repurpose a building that is becoming aneyesore and could potentially be a location for suspect activities if left vacant too long, meaning the Walmart building. Also, there are three other grocery stores located very close to this location, so I don’t understand how Woodman’s fill a consumers void. Considering the Woodman’s news, this prompted me to express another huge disappointment in Plainfield government. I was floored when I saw that a new Aldi’s was being constructed almost in the same exact location of the current location, but just across the street. This is redundant. What is going on here? UNBELIEVEABLE! What is going to happen to the current Aldi’s? I think Plainfield government is very short sighted and only interested in taxes and revenue as the priority. I think the residents and taxpayers need a very public transparent explanation into the rationale of these projects. My opinion of Plainfield in 2009 when I first moved in was positive. As time goes on, my opinion of local government has been diminishing over the years by seeing so much retaildevelopment and as time progresses it has become increasingly worse. I think there needs to be more thought into developing open spaces into green spaces instead of brick andmortar. Maybe some of these development questions should be put to the voters. Maybe the revenues from brick-and-mortar retail could be earmarked or made part of the contractwith these retailers to be focused on new library, public green spaces, etc. as part of the development deal. I remember some years ago a referendum was put to the voters to build a new library, but it was voted down. This was a huge disappointment as libraries are a huge cultural asset to the community. I would suggest that effort should be focused and accelerated into projects like a new library or more useful green spaces. I look forward to hearing back from you on these topics. Thank you and best regards, Jeffrey Pawlicki ATTENTION: This email originated from a sender that is outside the Village of Plainfield'semail system. Please exercise caution when replying to this message or clicking on links orattachments. 82 24401 W. Lockport Street Plainfield, IL 60544 Phone (815) 436-7093 Fax (815) 436-1950 Web www.plainfieldil.gov TO: PLAN COMMISSION FROM: ALYSSA MARTIN, AICP DATE: FEBRUARY 5, 2024 SUBJECT: HAWK AUTO SITE PLAN REVIEW & FINAL PLAT CASE NUMBER: 2036-120723.SPR.FP REQUEST: Site Plan Review and Final Plat LOCATION: 16761 S Route 59 APPLICANTS: Simon Design Group on behalf of Hawk Auto CURRENT ZONING: B3 Highway Business District COMP. PLAN: General Commercial DISCUSSION The petitioner, Hawk Auto, is proposing to construct a new car dealership on a vacant 89 acre parcel located approximately at 16761 IL Route 59 just north of Rolf Road and Plainsman Terrace subdivision. The applicant is seeking site plan approval and re-approval of the previously approved final plat at the March 27, 2023, Plan Commission hearing and the April 3, 2023, Village Board hearing. The proposed site is zoned B3 Highway Business District and auto sales is considered a permitted use in the subject zoning district. A rezoning from R1 to B3 was approved at the previously mentioned hearings. Existing Conditions/Site Context The adjacent land-uses, zoning and functional street classifications are identified below: North: Utility easement East: Vacant Lot and wetlands (R1 Low Density Single-family Residential) South: Plainsman Terrace Subdivision Residential (R1 Low Density Single-family Residential) West: R-1 Single Family Residential District/Fritz Farm (Rte 59 – Major Arterial) JOHN F. ARGOUDELIS PRESIDENT Michelle Gibas VILLAGE CLERK TRUSTEES Margie Bonuchi Patricia T. Kalkanis Richard Kiefer Cally J. Larson Tom Ruane Brian Wojowski 83 REPORT TO THE PLAN COMMISSION Page #2 of 4 CASE #2036-120723.SPR.FP 2/1/2024 HAWK AUTO SITE PLAN & PLAT 24401 W. Lockport Street Plainfield, IL 60544 Phone (815) 436-7093 Fax (815) 436-1950 Web www.plainfieldil.gov SITE PLAN ANALYSIS The new proposed Hawk Auto car dealership contains four separate buildings, each containing a separate dealer, with each building ranging in size from 16,900 square feet to 28,700 square feet. The site location is situated off S Rte 59 between Rolf Road and Dayfield Drive. Two dealerships are currently moving forward at this time, Cadillac and Volkswagen, which are for the two southern buildings. Hawk Auto is seeking approval of the full master plan of the site and the other two dealerships will come in under administrative site plan review and final engineering. Specific site plan aspects are discussed below. Parking, Access, and Circulation Three access points are proposed for the site spaced evenly across the site along Rte 59 (~583ft from northern to the middle access and 563ft from the middle to the southern access). The southern and northern access points are right-in/right-out, while the middle access is a full access with a lane for ingress and a right and left turn lane for egress with a proposed signalized intersection. A new left turn, southbound lane will be constructed as part of the project in accordance with IDOT standards. The applicant is seeking a traffic signal; however, this is under IDOT’s control. Two 12 x 65’ loading spaces are provided to the rear of buildings at the southern end of the site. One space per building is provided along the sides of the northern structures. By its nature, the dealership has expansive parking. All parking meets Village Ordinance size, spacing, and required counts. Customer parking is situated along the front and side facades of each building with employee parking to the rear. 84 REPORT TO THE PLAN COMMISSION Page #3 of 4 CASE #2036-120723.SPR.FP 2/1/2024 HAWK AUTO SITE PLAN & PLAT 24401 W. Lockport Street Plainfield, IL 60544 Phone (815) 436-7093 Fax (815) 436-1950 Web www.plainfieldil.gov Engineering / Stormwater Management Current Village policy does not require final engineering at the time of site plan review; however, a preliminary engineering review has been done regarding stormwater management and the detention pond proposed directly east of the dealership. As a stipulation of approval, all requirements of the Village Engineer must be met with final engineering. Zoning Ordinance Compliance Staff notes the following with respect to additional development standards of the B-3 zoning district not discussed above: Development Standard Required Provided Minimum Lot Area 43,560 sf complies Minimum Lot Width (sf) 100 ft >100 ft Maximum Building Height 35 ft ~25 ft Floor-Area Ratio 0.4 complies Minimum Front Setback 30 ft complies Minimum Interior Side Setback 15 ft complies Minimum Rear Setback 30 ft complies Elevations / Façade / Architecture Elevations have been provided presenting buildings utilizing large glass areas providing views into the showroom. For the VW building, white concrete is proposed for the front façade (with the majority being windows) and aluminum composite for the secondary façades. The Cadillac building will mainly have aluminum siding with large showroom windows. Building articulation has been provided, particularly on the Cadillac elevation, and the elevations meet the site plan requirements of the Village Code. Landscaping The applicant submitted a landscape plan as part of the site plan review application that conforms to the Village code and requirements previously imposed regarding the transitional yard and berm separation from the residential area to the south of the site. Vegetation will line the shared internal access, as well as the front/rear/north side of the property. Street trees are provided at regular intervals along Rte 59. The required 60’ landscape buffer on the southern end of the property will be built on a berm of varying height from 1-3’ tall (majority of berm is 3’ feet in height). Staff had recommended the berm is undulating to provide a more natural aesthetic and be covered with evergreen trees and shrubs so as to maintain visual separation even in the winter months, which was updated on the landscaping plan. In addition, a 6’ tall cedar plank fence will be placed on the south end of the property along the parking lot directly in front of the berm. Lighting / Photometrics The applicant has submitted a photometric plan that demonstrates that the light spill diminishes to at or below the maximum permitted levels at the property line (0.5 footcandles). The proposed mounting height of the parking lot light fixtures does not exceed the principal height of the building, in accordance with the site plan review 85 REPORT TO THE PLAN COMMISSION Page #4 of 4 CASE #2036-120723.SPR.FP 2/1/2024 HAWK AUTO SITE PLAN & PLAT 24401 W. Lockport Street Plainfield, IL 60544 Phone (815) 436-7093 Fax (815) 436-1950 Web www.plainfieldil.gov ordinance. The applicant has also provided cut sheets of the proposed fixtures. The initial photometric plan provided showed intense lighting levels but has been greatly reduced after comments by staff were provided. FINAL PLAT As previously mentioned, the final plat was approved by the Village Board on April 3, 2023. The original parcel is being subdivided into two parcels. Lot 1 will contain the dealership, and Lot 2 will contain stormwater detention and possible future development. The stormwater area has since changed from the initial approval and now abuts the residential area providing additional buffer from future development of the vacant land area. CONCLUSION/RECOMMENDATION The site plan proposal and final plat meets all requirements of the Village Ordinance. Prior to any public comment or Plan Commission feedback, staff recommends approval of the proposed site plan and final plat. Should the Plan Commission concur, the following motion is offered for your consideration: FINAL PLAT MOTION I move we recommend approval of the proposed Hawk Auto Final Plat of Subdivision, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District 3. Compliance with the requirements of IDOT SITE PLAN MOTION I move we recommend approval of the proposed site plan review for the Hawk Auto Site Plan, subject to the following three (3) stipulations: 1. Compliance with the requirements of the Village Engineer; 2. Compliance with the requirements of the Plainfield Fire Protection District 3. Compliance with the requirements of IDOT 86 FIR 5/8FCCFCCFIPFCCFCCFIR_5/8.CAP.ORG 27NQXFIR 5/8 BENTFIR 5/8 YLW CAPFIR 5/8 CAP.YLWFIR 5/8 CAP.YLWFIR 5/8FIR_CAP.2INFIR_CAP.2IN_IDOTFIR_5/8_CAP.YLWFIR_5/8_CAP.YLWFIR_5/8FIR_5/8 BENTFIP_1.5FCC602.52SBM_HYD.NW.TAGBOLTFIR_5/8FIP_3/4FIP_3/4FIR_5/8FIR_5/8FIP_1FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8FIR_5/8.BENTFCC100SIR_CAP101SCC102SCC103SCC104SCC105SCC106SCC108SCC109SCC111SCC112SCC113SCC114SCC115SCCFCC_TCFADFADFIR_5/8.CAP.YLWWETLAND11.28 AC.WETLANDS01° 49' 00"E 1640.35'N88° 55' 12"E 2569.29'N01° 55' 23"W 307.78'S88° 04' 37"W5.00'N01° 55' 23"W 747.00'N88° 04' 37"E5.00'N01° 55' 23"W 258.85'S88° 54' 06"W 1248.03'N01° 54' 18"W 328.07'S88° 52' 50"W 1318.30'35' DRAINAGE EASEMENTSTORMWATERRETENTION & DRAINAGEEASEMENTDRAINAGEEASEMENT123456781415161312111718192021222324PLAINSMAN TERRACEDOC. R75-32760 REC. NOV. 26, 1975PLAINSMAN TERRACEDOC. R75-32760 REC. NOV. 26, 197520' DRAINAGE EASEMENT10' UTILITY EASEMENT10' P.U.E.UNSUBDIVIDED20' DRAINAGE EASEMENT N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9N. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE1/4 OF THE NW 1/4 OF SEC. 27-36-9E. LINE OF THE NW 1/4 OF SEC. 27-36-9 W. LINE OF THE NW 1/4 OF SEC. 27-36-9 UNSUBDIVIDEDUNSUBDIVIDEDUNSUBDIVIDEDIL RTE 59 UNSUBDIVIDEDEXCEPTION EXCEPTIONEXCEPTION N. LINE OF THE NW 1/4 OF SEC. 27-36-9P.O.B.EXCEPTION69.30'(N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)(S01° 55' 33"E)(S88° 04' 27"W)(S01° 55' 33"E)(258.88')70.99'N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')HERETOFORE CONVEYED TO IDOT PER DOC. R2011031724 1.20' N &0.18' E0.35' SAT CORNER0.18' W2.98' WAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNERAT CORNER0.13' W0.12' N0.06' EON LINE0.11' N0.30' S0.43' SONLINEONLINE0.10' N0.91' N &0.20' WHERETOFORE DEDICATED PER DOC. 463161AT CORNERAT CORNERAT CORNERAT CORNER14.28' NE14.75' SE18.78' ELYUNSUBDIVIDEDSHED X4.06' SSHED X3.91' SSHED X5.13' WFENCE X0.22' S0.16' WFENCE X0.17' WFENCE XONLINEFENCE X1.11' NFENCE X2.44' NWOODFENCECHAINLINK FENCECHAINLINK FENCEFENCE X0.63' SFENCE X0.37' SFENCE XONLINESHED X1.32' SFENCE X0.40' SSHED X3.95' SFENCE X3.07' SFENCE X3.81' SCHAINLINK FENCE20' UTILITY EASEMENT PER DOC. R2003-10559830' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYTEMPORARY CONSTRUCTIONEASEMENT PER DOC. R2011-317240.11' ESIGN X0.51' W21.93' SEINLET11.32' SLIMITS O F " Z O N E A " A S S C A L E D F R O M FIRM M A P PANEL N O . 1 7 1 9 7 C 0 1 3 0 G LIMITS OF 0.2% ANNUALCHANCE FLOOD HAZARDCHAINLINK FENCEWOODFENCEWOOD POSTSHEDSHEDSHEDSHEDSHEDSHEET 3MATCH LINESHEET 2SHEET 4SHEET 5SHEET 4 SHEET 3 SHEET 5 SHEET 2 SHEDSHEDSHEDSHEDCONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.GRAVELIL RTE 59 275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYAT CORNERDETENTION BASINONLY ONLY BLDG - 120,000 SFBLDG -316,900 SFBLDG - 227,000 SFTRASHHWL 595.3NWL 590.3LOT 1LOT 2LANDSCAPE BERM AREA: SEEGRADING PLAN FOR DETAILSPROPOSEDSIGNALIZEDINTERSECTION24' (TYP)18.5' (TYP)24'24'24' (TYP)18' (TYP)29'24' (TYP)18' (TYP)26.4'18.5'149.9'36'24' (TYP)30.4'9' (TYP)18' (TYP)24.1'18.5' (TYP)24' (TYP)18.5' (TYP)140.4'18' (TYP)27'18.5' (TYP)135.3'18' (TYP)32'25'18'25'29'39'18' (TYP)31'31'60'LANDSCAPEBUFFER 563.8'583.3'5'9' (TYP)24' (TYP)15114121214449261212484826243415231081756141534241614142028144211119617336234101010101830814241246461612522PROPOSED 6'CEDAR PLANKFENCE42PROPOSEDSECURITY GATE(TYP.)12' X 65'12' X 65'12' X 65'12' X 65'12' X 65'12' X 65'LOADING STALL(TYP.)CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDPARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*13 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (7,400 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (41,582 SF/5000)ADA STALLSTOTAL39258476REQUIRED392515483PROVIDEDBUILDING #1LOADING STALLSBICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)1122PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*21 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,462 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (23,301 SF/5000)ADA STALLSTOTAL6385480REQUIRED6327114105PROVIDEDBUILDING #2LOADING STALLS2222BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*23 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,360 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (32,952 SF/5000)ADA STALLS69874REQUIRED6922374PROVIDEDBUILDING #4TOTAL22LOADING STALLS22BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)88132PARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*11 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (1,700 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (41,816 SF/5000)ADA STALLS3368249REQUIRED332014269PROVIDEDBUILDING #3LOADING STALLS11BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)22TOTALPARKING DATASERVICE BAY PARKING (SERVICE/SALES) (3*21 BAYS)INTERIOR DISPLAY PARKING (SALES/OFFICE) (2,462 SF/300)OUTDOOR STORAGE PARKING (SERVICE/SALES) (23,301 SF/5000)ADA STALLSTOTAL204472814293REQUIRED204947714389PROVIDEDOVERALL SITETOTAL VEHICLE STORAGE671LOADING STALLS6688BICYCLES (1 PER 40 EMPLOYEES, NO MORE THAN 80 EMPLOYEES AT A TIME)DRAWING NO.C1.0N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.0 Site220957.dwg1/25/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS OVERALL SITE PLAN HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALE87 FCCFCCFIPFCCFCCFIR 5/8 BENTFIR 5/8 YLW CAPFIR_CAP.2INFIR_CAP.2IN_IDOTFIR_5/8_CAP.YLWFIR_5/8_CAP.YLWFCCFIR_5/8602.52SBM_HYD.NW.TAGBOLT101SCC106SCC108SCC109SCCN01° 55' 23"W 307.78'S88° 04' 37"W5.00'69.30'(N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')1.20' N &0.18' EAT CORNERAT CORNER14.28' NE14.75' SE21.93' SEIL RTE 59 AT CORNERONLY ONLY BLDG - 120,000 SFBLDG -316,900 SFLOT 1NEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGCUSTOMERPARKINGUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYEMPLOYEEPARKINGEMPLOYEEPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYCUSTOMERPARKINGEV QUARANTINE AREA -16'-0" AROUND CARUSED VEHICLEDISPLAYSTUB FOR FUTURELOT 2 DEVELOPMENT29' 39'31'STUB FOR FUTURELOT 2 DEVELOPMENT30' BUILDING SETBACK5' PARKING SETBACK5' PARKING SETBACK15' BUILDING SETBACK30' BUILDING SETBACK20' PARKING SETBACK BACK OF CURB (TYP)18'18'24'18'24'18'18.5'30.4'11'9.5'9'18'24.1'18.5'18'24'18'18'24'18.5'140.4'18'27'18'24'18'18'24'18.5'135.3'18'32'18'24'18.5'18'25'18'18'24'18.5'18'25'18'BACK OF CURB (TYP)PROPOSEDSIGNALIZEDINTERSECTION5' (TYP.)583.3'PROPOSED SECURITYGATE (TYP.)NOTES:1. ALL DIMENSIONS SHOWN ARE TO BACK OF CURB UNLESSOTHERWISE NOTED.2. ALL PROPOSED ON-SITE STRIPING SHALL BE PAINTEDYELLOW UNLESS OTHERWISE NOTED.3. BUILDING DIMENSIONS ARE TO OUTSIDE FACE OFBUILDING UNLESS OTHERWISE NOTED.4. ALL CURB AND GUTTER SHALL BE B6.12 UNLESSOTHERWISE NOTED.CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDDRAWING NO.C1.1N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.1 Lay220957.dwg1/24/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS LAYOUT AND PAVING PLAN - NORTH HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALEFOR CONTINUATION SEE C1.288 FIR 5/8FIR_5/8FIR_5/8 BENTFIP_1.5FIR_5/8FCC105SCC113SCC114SCC115SCCFADFADFIR_5/8.CAP.YLWN01° 55' 23"W 747.00'N88° 04' 37"E5.00'N01° 55' 23"W 258.85'S88° 54' 06"W 1248.03'2021IL RTE 59 (S01° 55' 33"E)(S88° 04' 27"W)(S01° 55' 33"E)(258.88')70.99'N01° 50' 58"W 1313.63'(N01° 51' 07"W)(1313.81')0.43' SONLINEONLINE0.10' N0.91' N &0.20' WAT CORNERAT CORNER18.78' ELYSHEET 3SHEET 2ONLY ONLY BLDG - 227,000 SFTRASHLOT 1CUSTOMERPARKINGCUSTOMERPARKINGNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYSERVICE VEHICLESTAGINGNEW VEHICLEDISPLAYEMPLYEEPARKINGNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYCUSTOMERPARKINGCUSTOMERPARKINGCUSTOMERPARKINGVEHICLEDISPLAYVEHICLEDISPLAYEV QUARANTINE AREA -16'-0" AROUND CAREMPLOYEEPARKINGEMPLOYEEPARKINGUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYUSED VEHICLEDISPLAYSERVICE CUSTOMER PARKINGNEW VEHICLEDISPLAYEMPLOYEEPARKINGNEW VEHICLEDISPLAYNEW VEHICLEDISPLAYUSED VEHICLEDISPLAYNEW VEHICLEDISPLAYSTUB FOR FUTURELOT 2 DEVELOPMENT29' 39'18'24'18.5'18'24'18.5'18' 18'24'18.5'24'18' 18' 29'18'24'18'18'26.4'18.5'9'31'60'LANDSCAPEBUFFER 149.9'PROPOSED LIFT STATIONTO BE DESIGNED AND SUBMITTEDIN FINAL ENGINEERING20' BUILDING SETBACK30' BUILDINGSETBACK5' PARKING SETBACK30' BUILDING SETBACK20' PARKING SETBACK 36'BACK OF CURB (TYP)LANDSCAPE BERM AREA: SEEGRADING PLAN FOR DETAILSPROPOSEDSIGNALIZEDINTERSECTION5' (TYP.)563.8'PROPOSED 6' CEDARPLANK FENCEPROPOSED SECURITYGATE (TYP.)NOTES:1. ALL DIMENSIONS SHOWN ARE TO BACK OF CURB UNLESSOTHERWISE NOTED.2. ALL PROPOSED ON-SITE STRIPING SHALL BE PAINTEDYELLOW UNLESS OTHERWISE NOTED.3. BUILDING DIMENSIONS ARE TO OUTSIDE FACE OFBUILDING UNLESS OTHERWISE NOTED.4. ALL CURB AND GUTTER SHALL BE B6.12 UNLESSOTHERWISE NOTED.CONCRETE PAVEMENTREGULAR HMA PAVEMENT1.5" HMA SURFACE COURSE, MIX D N502.5" HMA BINDER COURSE, IL90, N5010" AGGREGATE BASE COURSE - CA66" P.C. CONCRETE PAVEMENT WITH (6X6/W2.9=W2.9) W.W.F.8" AGGREGATE BASE COURSE - CA65" P.C. CONCRETE PAVEMENT4" AGGREGATE BASE COURSE - CA6CONCRETE SIDEWALKPAVING LEGENDDRAWING NO.C1.2N:\2022\220957 Hawk Plainfield\Drawings\ACAD\LD\S03\Sheet Drawings\C1.1 Lay220957.dwg1/24/2024PROJECT NO.: PROJECT MANAGER: DRAWN BY: DESIGNED BY: 220957 JR DB RMW 16761 SOUTH ROUTE 59PLAINFIELD ILLINOIS LAYOUT AND PAVING PLAN - SOUTH HAWK AUTO - PLAINFIELDwww.v3co.com DESCRIPTIONDATENO. R E V I S I O N S 1 1/25/24 REVISED PER VILLAGE COMMENTS ORIGINAL ISSUE DATE:12-05-2023 DESCRIPTIONDATENO. 7325 Janes Avenue Woodridge, IL 60517 630.724.9200 phoneGRAPHIC SCALEFOR CONTINUATION SEE C1.189 EXL-6 EXL-6EXL-6EXL-6EXL-6EXL-6EXL-6EXL-6 EXL- 6EXL-6EXL-6EXL-4 EXL-4 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL- 5 EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5 EXL- 5 EV QUARANTINE AREA -16'-0" AROUND CAR ID HUB1A0.50a23TYP3TYP3TYP#TYP2 2 KEYED NOTES1.FUTURE ELECTRICAL VEHICLE CHARGING STATION. 2" UNDERGROUND CONDUIT.CONDUIT SIZES MAY NEED TO BE ADJUSTED FOR LONG RUNS TO ACCOMMODATEVOLTAGE DROP. CONDUIT SIZE TO ADHERE TO ELECTRICAL CODES AND CHARGINGSTATION EQUIPMENT REQUIREMENTS. SEE ELEC. PANEL SCHEDULE FOR LOAD CAPACITY.2.CONDUIT TO BE INSTALLED FROM EV STATION TO ELECTRICAL DISTRIBUTION SOURCEFOR FUTURE UNIT PLANCEMENT.3.6" HIGH CONCRETE CURB.4.PROPERTY LINE.5.PROVIDE RAMPED SIDEWALK FOR ACCESSIBLE ENTRY6.LANDSCAPED AREA7.PYLON SIGN OR DIRECTIONAL SIGN, ACTUAL LOCATIONS TO BE COORDINATED WITHSIGN SUPPLIER. SIGN REVIEW SHALL BE UNDER SEPARATE PERMIT, SHOWN FORREFERENCE ONLY.8.TRASH ENCLOSURE9.UTILITY TRANSFORMER10.REFER TO SITE DETAILS ON SHEET A0.51. PROVIDE ALL EXTERIOR PAVING/ MATERIAL/FINISHES IN FRONT OF DEALERSHIP AND CUSTOMER PARKING AS INDICATED ONENLARGED PAVING PLAN. PROVIDE EV CHARGERS IN CUSTOMER PARKING AREA AND NEWCAR DISPLAY AREA LOCATIONS.11.EV QUARANTINE ZONE OF 16'-0" CLEAR AROUND DESIGNATED AFFECTED EV CAR INPARKING LOT.LEGENDNOTE DESIGNATOR - REFER TO DRAWING NOTES ON THIS SHEETPARKING LOT POLESELECTRIC VEHICLE CHARGINGEVXEXISTING STREET LIGHTDARK PAVERS (PV-2)STAMPED CONCRETE OR ASPHALT (SEE FINISH MATERIALS SCHEDULE) (PV-1)CONCRETE (UNFINISHED UNLESS OTHERWISE NOTED)FIELD TURF (FT-1) OR KENTUCKY BLUEGRASSCRUSHED GRAVEL (CG)XDECORATIVE STONE (ST-1) ALT: UNILOCK PAVER 4x12, 4x8 OR 6x12 INNORDIC STAYA.ACCOMMODATE DC FAST CHARGING AND NETWORK CONNECTIVITY WITH CAT6. RUN CONDUIT FROM ALL EV STATION LOCATIONS TO ELECTRICALDISTRIBUTION SOURCE. FINAL EV LOCATIONS TO BE COORDINATED BY GC.B.ALL SIGNAGE IS SHOWN FOR DESIGN INTENT ONLY. PLAN REVIEW SHALL BEUNDER A SEPARATE PERMIT, SUBMITTED BY THE SIGN FABRICATOR. GC TOCOORDINATE.C.SEE SHEET AX.XX FOR SITE LIGHTING DESIGN CRITERIA.D.SEE SHEET AX.XX FOR BUILDING GRAPHICS LOCATIONS.E.SITE SIZE = 0.XX ACRESF.INDICATES GREEN SPACE/LOW LANDSCAPING. SEE SHEET AX.XXFOR PROTOTYPE LANDSCAPE PLANGENERAL NOTESSCALE:SITE PLAN1" = 30'-0"1©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager90 LEGENDNOTE DESIGNATOR - REFER TO DRAWING NOTES ON THIS SHEETPARKING LOT POLESELECTRIC VEHICLE CHARGINGEVXEXISTING STREET LIGHTDARK PAVERS (PV-2)STAMPED CONCRETE OR ASPHALT (SEE FINISH MATERIALS SCHEDULE) (PV-1)CONCRETE (UNFINISHED UNLESS OTHERWISE NOTED)FIELD TURF (FT-1) OR KENTUCKY BLUEGRASSCRUSHED GRAVEL (CG)DECORATIVE STONE (ST-1) ALT: UNILOCK PAVER 4x12, 4x8 OR 6x12 INNORDIC STAYCUSTOMERPARKING2A0.50aTYP.WC-13TAGCGCGWC-13CGWC-13PV-1TAGWC-13ST-1WC-13PV-1PV-1WC-13ST-1WC-13ST-1ST-1NOTE: TEXT IS TO BE CENTERED INBOTTOM THIRD OF PARKING SPACEKEYED NOTES1.REFER TO EXTERIOR FINISH SCHEDULE FOR EXTERIORMATERIALS INFORMATION.2.PROVIDE AND SIZE CONDUIT TO EV CHARGER STATIONSAS FOLLOWS:a.ACCOMMODATE DC FAST CHARGING AND NETWORKCONNECTIVITY WITH CAT 6. RUN CONDUIT FROM ALLEV STATION LOCATIONS TO ELECTRICALDISTRIBUTION SOURCE.b.CONDUIT SIZES MAY NEED TO BE ADJUSTED FORLONG RUNS TO ACCOMMODATE VOLTAGE DROP.c.CONDUIT SIZE TO ADHERE TO ELECTRICAL CODESAND CHARGING STATION EQUIPMENT REQUIREMENTS.d.CONDUIT TO BE INSTALLED FROM EV STATION TOELECTRICAL DISTRIBUTION SOURCE FOR FUTURE UNITPLACEMENT.3.WC-1 TO BE WHITE CONCRETE SUPPLEMENTALCEMENTITIOUS CONCRETE MATERIAL OF LIMESTONE OREQUAL TYPE. FINAL MOCK-UP OF WHITE CONCRETE TOBE APPROVED BY ARCHITECT.XSCALE:CUSTOMER PARKING DETAIL1/8" = 1'-0"1SCALE:ENLARGED STALL DETAIL1/2" = 1'-0"2©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager91 ALIGNMENTEXPRESSEXPRESSEXPRESSEXPRESSEXPRESSEXPRESS#KEYED NOTESDRAWING NOTESSCALE:FLOOR PLAN1/8"14'X4' 67"DIA67"DIA 4'X4' 67"DIA 67"DIA 4TYP.4TYP.4TYP.4TYP.13TYP.255SCALE:FLOOR PLAN - MEZZANINE1/8"2©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGN92 Service XpressService Xpress16761Hawk PlainfieldServiceService XpressDRAWING NOTES#GENERAL NOTESLEGENDX-?EG-?#SCALE:EXT ELEVATION - FRONT1/8"1SCALE:EXT ELEVATION - LEFT3/32"2SCALE:EXT ELEVATION - RIGHT1/8"3SCALE:EXT ELEVATION - BACK1/8"4©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGN93 SCALE:EXT ELEVATION - FRONT1/8"1©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager94 ©2023 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveHawk Volkswagen16761 Route 59Plainfield, ILELEC ENGIN:ARCHITECT:CIVIL:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:500 Lake Cook Road, Suite 350Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNV3 Companies7325 Janes Avenue,D: 630.724.9200| C 630.947.9946|E: rwagner@v3co.comAttn: Ryan Wagner, P.E., Sr. Project Manager95 SERVICE LANESSHOWROOMGUEST LOUNGESALESNEW CAR DELIVERYSERVICE RECEPTIONBUILDING SUPPORTPARTS + SERVICESCALE:FLOOR PLAN1/8"1©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner96 LEVEL 010' - 0"ACM1ACM FACADEWITH BONELINECADILLAC SIGNAGEACM2ACM FACADEEXGL1CLEAR SHOWROOM GLASSACM2DISPLAY FRAMEEPT1EXTERIOR PAINTACM1ACM FACADEEXGL2EXTERIOR GLAZING8'-0"2'-0"LEVEL 010' - 0"CADILLAC SIGNAGEACM2DISPLAY FRAMEACM2ACM FACADEACM2ACM FACADEACM1ACM FACADEWITH BONELINEEXGL1CLEAR SHOWROOM GLASSACM1ACM FACADEACM1ACM FACADE12'-0"FULL HEIGHT GLASSDOOR - COILING ORSECTIONALCADILLAC SERVICESIGNAGELEVEL 010' - 0"EPT1EXTERIOR PAINTLEVEL 010' - 0"EXGL1EPT1EXTERIOR PAINTACM1ACM FACADECLEAR SHOWROOM GLASSACM2ACM FACADESCALE:EXT ELEVATION - FRONT1/8"1SCALE:EXT ELEVATION - LEFT3/32"2SCALE:EXT ELEVATION - RIGHT1/8"3SCALE:EXT ELEVATION - BACK1/8"4©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner97 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan WagnerSCALE:EXT RENDERING-198 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner99 ©2024 SIMON ARCH, LLCS I M O NDESIGN GROUP, LLCplanning - retail - automotiveELEC ENGIN:ARCHITECT:STRUCTURAL ENGIN:MECH / PLUMB ENGIN:807 Lake Cook Road, Suite 150Deerfield, IL 60015Tel: 847-571-3814Attn: Simon YuARCHITECTUREDESIGNHawk Cadillac16761 South Route 59Plainfield, IL- Franchise BCIVIL ENGIN:V3 Engineering7325 Janes AveWoodridge, IL 60517Tel: 630-724-9200Attn: Ryan Wagner100 101 1.01.62.85.510.814.324.025.324.018.713.58.66.96.77.17.68.28.89.09.29.29.29.08.78.58.58.78.88.88.88.68.58.58.88.98.98.98.78.58.58.78.98.98.98.78.48.07.36.76.15.13.82.60.90.40.20.11.01.62.95.17.39.223.024.224.920.215.111.79.57.97.57.77.87.77.98.59.09.39.18.97.97.47.58.28.68.68.67.87.47.58.28.78.78.78.07.57.47.88.68.68.78.27.46.86.56.66.35.84.53.30.90.40.20.10.81.42.12.83.85.119.423.421.917.512.39.58.58.18.08.18.38.17.28.58.98.98.68.37.67.07.17.77.97.97.97.57.07.17.78.08.08.07.77.17.07.68.08.08.07.77.06.46.36.26.25.84.93.80.90.40.20.10.60.81.01.31.93.720.816.811.38.67.97.87.98.08.15.65.55.75.75.33.50.90.50.30.20.30.40.50.71.21.820.616.611.48.98.17.87.87.87.84.84.75.25.55.53.51.00.50.30.20.20.20.30.50.81.820.116.211.79.28.58.17.97.87.77.36.86.46.25.95.44.84.34.04.04.24.44.44.54.44.34.44.75.05.05.15.15.05.15.25.45.45.35.04.64.34.14.24.85.15.03.61.00.60.30.20.10.10.20.30.61.919.57.36.96.55.95.55.14.63.93.43.33.33.53.73.83.83.83.94.04.34.64.84.94.84.85.05.15.45.55.34.94.54.24.04.24.74.84.43.81.00.60.30.20.10.10.10.20.71.818.06.96.56.25.54.74.23.63.12.72.52.62.83.13.33.43.53.63.94.24.54.74.84.84.94.95.35.55.75.45.04.64.44.24.34.74.74.03.31.00.60.30.20.10.10.20.61.717.86.35.95.85.04.23.52.92.21.82.12.12.22.52.83.23.53.84.14.34.64.85.05.15.25.45.46.06.15.95.45.04.74.54.64.74.13.52.71.00.60.30.20.10.10.10.20.51.618.95.95.85.31.61.92.12.53.03.74.34.64.74.74.95.35.65.75.75.65.96.46.35.95.45.24.94.94.94.33.62.70.90.50.20.10.10.10.10.30.51.519.35.45.14.71.31.51.82.33.03.94.64.94.94.74.85.25.65.75.75.65.45.26.36.25.96.05.75.55.35.04.23.30.90.40.20.10.10.10.20.30.62.019.64.44.13.91.11.31.62.12.73.64.44.74.64.44.75.25.75.85.75.75.55.24.65.56.36.76.56.16.05.54.73.80.80.40.20.10.10.10.20.40.62.019.33.43.23.05.86.36.56.55.95.43.50.70.30.10.10.10.10.20.40.61.418.62.25.95.96.26.56.15.73.40.70.30.10.10.10.10.10.40.61.618.01.76.56.66.46.45.85.13.40.70.30.10.10.10.10.20.30.71.716.81.46.36.46.36.15.54.53.60.70.30.10.10.10.10.20.61.717.11.66.06.26.15.85.03.92.90.70.30.20.10.10.10.20.41.518.82.16.06.26.15.54.23.22.30.70.40.20.10.10.20.41.319.72.75.85.95.85.14.03.02.20.60.40.20.10.10.10.41.820.43.65.05.15.14.74.23.32.60.60.40.20.20.10.10.31.820.44.63.74.14.24.34.03.53.10.50.40.30.20.10.10.31.316.220.719.65.53.13.33.64.14.14.12.80.60.40.30.20.10.20.41.415.917.218.26.26.05.74.63.73.22.62.01.61.51.61.71.92.22.82.92.52.42.42.42.53.03.02.62.52.62.93.44.14.43.74.54.24.34.84.84.93.10.80.50.30.20.10.10.20.51.612.113.115.26.86.46.05.14.23.63.02.42.12.12.22.52.83.13.53.63.43.13.13.13.33.63.63.43.33.53.84.45.05.14.54.94.74.75.15.14.83.51.00.60.30.20.10.10.20.61.610.010.512.57.37.06.25.34.53.83.22.72.52.62.93.33.63.94.14.14.03.73.63.63.83.93.93.94.04.24.65.15.55.55.15.35.15.15.35.14.53.91.10.60.30.10.10.20.30.61.515.57.57.16.25.34.54.03.42.92.72.93.54.04.44.64.74.64.44.13.93.94.04.14.34.44.54.75.15.55.75.75.45.55.45.45.55.14.23.51.20.60.30.10.10.10.20.30.51.417.37.37.06.25.34.54.03.53.13.03.44.04.85.25.35.15.04.84.34.03.94.04.24.34.75.05.25.35.55.55.55.35.65.65.75.64.73.93.01.20.60.30.10.10.10.20.30.51.418.46.76.96.25.54.64.03.63.33.44.04.75.45.46.05.85.55.04.54.14.04.04.34.64.94.95.35.55.55.45.45.45.55.35.95.85.14.13.11.20.60.20.10.10.20.30.52.019.55.66.46.15.44.74.23.93.83.94.65.45.85.86.66.25.54.84.64.34.14.14.54.85.04.55.15.65.65.45.55.55.54.45.76.15.84.73.81.30.60.20.10.10.10.30.51.819.85.36.05.65.14.54.34.24.24.55.26.06.46.37.06.65.85.04.64.34.14.14.44.84.94.25.05.35.35.25.35.35.34.35.56.05.85.14.31.20.60.30.10.10.10.20.41.420.05.35.55.04.64.44.34.44.75.15.66.26.96.76.96.45.85.14.54.14.14.24.44.64.84.74.94.95.04.94.94.95.04.65.35.75.85.53.91.20.60.30.10.10.20.51.720.95.34.84.44.24.24.44.85.25.55.96.46.86.96.76.05.55.04.64.24.24.34.44.54.74.74.74.74.74.84.74.64.64.64.75.25.45.63.71.20.60.30.10.10.10.61.721.94.54.03.83.84.14.65.15.76.06.36.56.66.66.25.85.24.94.64.54.54.54.64.84.74.64.64.84.94.84.74.54.14.04.04.64.84.83.71.10.60.20.10.10.10.41.721.34.03.53.33.54.04.65.35.95.96.46.56.56.35.95.55.04.84.64.54.64.74.84.94.84.84.84.94.94.94.64.23.83.53.53.94.13.93.50.90.60.30.10.10.10.41.521.13.22.82.73.03.64.45.25.44.86.06.16.05.75.44.84.44.34.24.14.24.54.54.84.74.74.74.84.74.64.23.73.32.92.83.13.22.92.60.70.50.30.20.10.20.42.021.217.211.57.76.34.84.03.12.52.12.12.53.13.94.75.24.35.45.45.25.14.84.23.83.83.73.53.84.14.14.54.54.74.94.94.74.23.73.22.72.22.22.42.11.91.70.50.40.20.10.10.20.42.020.816.610.87.45.54.13.22.62.11.81.82.12.63.33.94.44.34.84.74.34.54.23.43.03.33.12.62.82.82.94.34.64.95.14.84.74.03.42.82.31.81.82.01.91.71.50.30.30.20.10.10.20.41.520.115.910.46.64.63.42.72.21.91.61.61.92.22.63.03.43.63.63.53.84.54.95.14.24.64.13.42.72.11.71.72.02.32.12.00.20.20.10.10.10.20.51.620.016.210.36.04.02.92.32.01.71.51.61.82.02.22.42.62.72.72.74.14.85.25.23.84.64.13.42.62.11.61.62.12.52.52.40.10.10.10.10.10.10.20.61.520.516.89.75.33.42.41.91.61.51.41.51.61.81.92.02.02.02.02.04.04.54.95.04.44.43.93.22.51.91.51.62.22.83.22.10.10.10.10.10.10.10.20.41.319.315.59.24.93.02.01.61.41.41.41.51.21.31.31.33.53.94.34.64.54.03.42.82.31.91.51.62.32.93.52.10.10.10.10.10.10.20.20.918.514.18.64.73.02.01.61.51.51.51.23.23.53.83.93.83.42.92.52.11.81.51.52.22.73.02.20.10.10.10.10.10.20.21.318.614.18.24.83.22.42.01.92.01.81.93.03.33.43.33.22.82.52.21.91.71.51.62.12.42.42.30.10.10.10.10.10.10.11.418.814.28.24.93.52.82.52.42.42.42.53.03.03.02.82.52.22.01.81.61.41.31.62.02.21.91.80.10.10.10.10.10.10.10.818.313.88.45.13.73.02.93.03.23.33.32.82.82.62.32.01.71.51.31.31.21.31.61.91.71.61.30.20.20.10.10.10.10.818.214.39.05.33.93.43.43.74.04.24.32.52.32.22.01.81.61.41.21.21.21.41.82.22.11.91.60.30.20.10.10.10.10.31.019.115.69.05.24.03.73.94.24.64.85.01.81.91.92.01.81.81.61.51.51.61.82.22.83.12.82.40.40.20.10.10.10.10.21.018.715.19.05.34.13.94.24.04.14.35.11.51.61.82.02.12.12.02.02.02.22.32.73.43.83.63.10.50.20.10.10.10.10.20.818.013.88.75.24.03.74.14.34.44.75.11.51.61.82.02.22.32.42.42.52.72.83.23.94.34.43.00.50.20.10.10.10.10.20.31.218.013.68.05.03.93.53.74.04.34.34.01.61.71.82.12.32.52.62.93.23.43.53.74.34.74.82.90.50.20.10.20.20.30.30.51.818.413.87.94.93.93.33.33.63.73.63.22.70.10.11.91.81.92.12.32.63.03.43.84.04.14.14.54.64.33.00.50.20.10.30.50.60.70.91.817.913.38.05.34.03.43.23.13.12.92.62.21.90.21.91.81.82.02.32.73.33.84.14.24.34.54.64.33.73.10.40.20.10.50.81.21.51.82.717.913.59.06.24.73.93.42.92.72.42.11.91.81.61.41.51.61.92.32.83.43.83.93.83.94.44.54.13.22.30.40.20.10.71.11.82.94.25.618.915.511.38.46.65.03.62.82.42.12.02.02.02.11.61.91.91.51.51.51.62.12.11.81.61.51.62.02.01.61.91.81.92.22.52.93.43.94.24.44.44.34.03.22.41.70.50.20.10.71.11.93.56.810.016.518.020.119.415.712.49.05.53.52.62.11.91.81.81.92.12.32.22.11.91.81.82.02.32.42.21.91.81.92.22.21.92.12.02.12.42.73.13.43.74.04.24.13.83.32.72.11.40.50.20.10.81.21.83.26.612.717.920.221.921.418.715.39.25.13.52.92.52.22.02.12.22.32.52.72.52.42.42.42.52.72.72.62.52.42.42.52.52.32.52.52.62.93.33.53.63.84.04.13.93.63.02.51.91.20.50.20.10.81.32.03.35.511.016.922.326.123.819.014.58.75.74.33.53.12.82.72.82.92.93.02.92.82.83.03.13.43.43.33.22.92.72.93.03.13.13.33.23.23.53.83.94.14.34.34.23.93.52.82.21.71.20.60.30.10.10.50.91.62.85.210.616.015.616.216.818.414.58.95.84.13.22.82.93.03.33.43.23.02.72.22.73.13.43.83.83.53.22.82.32.63.13.33.63.83.53.43.33.53.94.14.44.44.13.63.02.21.81.41.00.60.30.10.10.10.20.20.20.41.01.72.43.03.23.73.73.12.52.02.02.53.03.73.83.22.72.21.92.22.83.34.04.03.42.92.31.92.22.73.23.84.03.53.12.82.83.33.84.34.33.62.92.21.61.31.00.80.50.30.10.10.10.20.30.60.91.52.32.72.42.42.62.31.71.72.22.62.32.42.62.41.81.41.72.42.92.62.62.82.51.91.51.72.42.82.52.52.92.72.22.22.73.02.62.52.72.31.61.00.80.60.50.30.20.10.10.10.20.30.30.30.30.30.20.20.10.10.10.20.20.20.20.20.20.30.30.30.30.40.40.40.40.40.30.30.30.30.30.30.40.40.40.40.40.40.30.30.20.20.20.20.20.20.20.20.20.10.10.10.10.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.117.226.08.18.18.08.07.97.67.16.66.46.36.46.76.76.66.56.46.46.66.86.96.86.76.66.66.76.86.96.96.66.36.016.725.77.77.57.27.06.86.45.85.45.25.25.35.45.45.45.45.45.55.75.85.85.75.75.75.85.95.95.85.75.417.021.417.018.313.914.913.814.716.818.016.721.016.125.016.024.816.420.516.517.413.514.213.614.316.717.916.521.016.025.215.925.212.813.616.117.015.720.915.925.316.324.617.720.817.818.816.717.818.319.517.722.316.9 16.926.117.521.918.018.916.217.017.117.817.019.715.723.715.624.815.921.017.117.815.616.016.216.616.918.515.422.315.224.515.321.316.917.816.317.116.312.38.88.48.38.27.917.012.48.68.28.28.17.816.612.08.87.97.57.47.215.411.48.57.26.66.46.315.110.27.56.35.65.35.415.39.46.65.44.74.54.514.88.95.84.63.93.73.514.08.75.54.03.22.92.72.62.413.99.25.63.82.92.52.32.11.815.19.65.84.13.22.72.32.015.510.26.54.83.93.22.72.41.915.110.97.65.94.84.03.53.12.515.711.08.16.95.85.04.43.93.216.610.98.07.16.55.85.24.74.116.611.38.17.37.06.35.95.55.015.711.18.47.87.26.96.55.85.614.711.18.97.97.27.17.014.010.78.37.47.27.37.413.410.27.67.07.07.27.413.29.77.46.66.56.87.313.39.37.16.36.16.57.114.09.16.86.26.26.56.915.29.67.06.36.36.66.715.710.37.66.56.36.46.416.211.38.16.86.26.16.117.712.38.87.26.35.85.612.88.67.56.45.75.118.213.08.57.26.45.44.617.312.38.06.85.84.83.90.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.05.15.11.627.026.219.10.10.10.10.20.53.117.719.121.117.411.67.25.34.94.23.42.92.62.52.52.62.72.82.92.92.82.72.72.72.72.72.72.82.83.14.05.16.17.08.08.99.610.110.310.110.09.89.38.47.77.26.45.23.91.20.50.20.10.10.10.10.30.42.818.121.120.716.211.37.86.14.94.03.32.92.62.62.62.72.82.93.13.12.92.82.82.72.72.72.72.82.93.24.15.26.27.17.98.99.810.410.410.110.010.09.58.77.97.05.94.73.41.20.50.20.10.10.10.10.30.52.618.125.220.715.910.77.66.04.84.03.53.12.92.92.93.03.23.43.63.63.43.22.92.92.82.72.82.93.23.84.65.76.57.17.98.79.410.010.210.09.99.89.38.57.87.15.94.83.51.20.50.20.10.10.10.20.40.62.818.426.720.816.110.57.56.05.04.44.03.73.53.43.53.73.94.34.64.54.33.93.63.33.13.13.33.53.94.75.66.57.17.37.98.27.98.19.59.79.79.27.97.17.37.26.55.34.01.20.50.20.10.10.10.20.40.73.018.523.320.916.010.87.76.45.55.14.84.64.44.24.34.54.95.15.45.45.14.84.44.03.73.84.04.45.05.76.57.17.47.57.67.87.98.28.68.78.78.47.87.16.86.86.35.54.41.20.50.20.10.10.10.20.40.83.818.920.321.216.711.58.16.75.95.65.55.35.15.05.15.35.65.75.55.65.55.65.14.84.54.64.95.36.06.16.77.07.37.36.97.07.27.37.37.27.27.16.96.35.96.06.05.73.91.10.50.20.10.10.10.20.41.03.817.819.022.217.911.68.27.16.46.06.06.05.95.75.65.76.06.15.96.06.16.15.75.55.55.65.86.16.56.97.17.27.57.06.66.56.46.46.26.06.06.05.75.35.05.35.45.63.61.00.50.20.10.10.10.20.40.93.818.219.621.917.812.18.97.77.06.76.76.86.66.36.06.06.16.26.46.56.56.56.46.36.36.36.76.76.97.17.57.67.36.86.46.15.95.85.65.45.35.14.84.34.14.54.74.73.50.90.40.20.10.10.20.40.73.619.021.421.717.512.79.58.67.97.87.67.36.76.56.46.05.96.16.26.56.66.76.97.17.26.97.27.27.17.17.37.37.16.76.46.15.95.65.25.14.84.54.13.63.53.84.03.73.30.70.40.20.10.10.10.30.73.119.025.622.217.913.110.19.18.98.78.27.76.86.66.45.85.65.65.85.86.06.87.17.57.77.27.47.67.37.06.96.86.76.46.16.05.85.34.84.44.13.73.22.82.73.13.22.82.40.60.40.20.10.10.10.30.63.219.322.518.613.510.69.59.38.98.47.96.66.66.05.45.15.25.45.45.76.17.17.47.87.47.77.47.06.56.46.26.36.06.06.05.85.34.63.93.42.92.42.12.12.32.11.91.60.40.30.20.10.10.30.63.119.025.222.518.313.911.110.29.38.68.07.66.75.74.74.03.65.96.76.97.06.66.05.85.85.65.75.65.85.95.85.34.53.73.02.41.91.51.72.01.91.71.50.30.20.20.10.10.20.63.619.321.722.718.814.511.410.49.28.27.56.85.94.84.03.53.15.76.26.56.45.85.25.25.45.35.45.55.86.05.65.14.63.82.92.31.71.41.52.02.32.11.90.20.10.10.10.10.10.20.83.918.420.123.420.014.310.79.58.87.96.96.05.14.13.93.54.14.95.25.34.54.14.33.82.92.21.61.21.42.02.52.52.50.10.10.10.10.10.10.20.83.918.219.923.319.613.89.68.28.07.06.05.14.23.24.04.54.95.25.14.74.23.62.82.11.51.21.42.22.83.22.20.10.10.10.10.10.10.30.63.518.920.921.717.612.79.07.66.55.64.73.93.12.43.54.04.34.64.74.33.83.12.52.01.51.21.42.32.93.52.20.20.10.10.10.10.10.20.30.62.918.323.820.816.011.07.86.25.04.13.52.92.31.83.23.53.84.04.03.73.32.72.32.01.61.31.52.22.83.12.30.20.10.10.10.10.10.20.40.62.918.426.620.315.69.86.64.93.93.22.72.31.81.53.23.43.53.53.53.22.82.52.22.01.71.51.72.22.62.62.50.20.20.10.10.10.10.20.40.72.718.024.220.014.89.25.84.13.12.62.32.01.61.33.13.43.33.33.23.02.72.52.42.21.91.82.02.42.62.32.00.30.30.20.10.10.10.20.40.73.218.220.319.814.89.35.53.72.82.32.11.91.51.33.43.63.33.33.23.12.92.82.82.62.42.42.52.72.42.11.70.50.30.20.10.10.20.40.83.517.618.520.315.89.35.43.62.72.32.11.91.51.23.73.73.43.43.43.43.43.53.43.23.13.03.13.33.02.62.10.60.40.20.10.10.10.20.30.83.416.917.920.916.39.55.53.93.02.52.21.91.51.23.23.43.53.73.84.04.14.14.03.93.83.63.63.93.93.52.90.70.40.20.10.10.10.10.30.53.318.019.019.815.39.96.14.43.42.92.62.32.01.81.92.33.13.74.14.65.35.85.75.55.35.14.84.03.43.13.23.33.94.04.24.44.74.94.94.74.74.74.64.34.24.44.54.23.60.80.40.20.10.10.10.10.20.42.417.421.819.614.89.86.65.14.03.32.92.52.11.91.92.33.03.74.35.05.76.26.16.15.85.54.94.13.43.13.13.33.94.24.65.05.45.75.85.65.65.55.35.04.75.05.25.13.50.90.40.20.10.10.10.20.32.217.225.119.615.19.86.85.74.74.03.32.82.42.22.22.63.34.14.75.56.46.86.46.66.66.15.34.63.83.43.43.64.34.75.35.86.16.66.86.86.66.46.05.65.45.85.85.73.61.00.40.20.10.10.10.32.116.623.719.314.89.76.75.85.44.73.93.43.02.72.73.13.84.65.26.06.77.26.47.27.36.65.75.04.33.83.84.24.95.46.06.15.96.47.87.97.77.05.75.25.96.36.05.53.91.00.40.20.10.10.10.32.315.718.818.413.99.56.86.05.75.24.54.03.53.33.33.74.45.15.66.26.87.37.37.47.56.96.05.44.74.34.44.95.55.96.57.07.58.18.78.68.48.07.36.66.56.55.95.14.11.10.50.20.10.10.10.42.513.715.116.312.48.86.66.35.85.34.84.44.13.93.94.45.05.66.16.46.87.47.87.97.67.06.45.75.25.05.15.56.06.46.77.38.18.79.09.08.78.37.87.16.56.35.84.63.51.10.50.20.10.10.10.41.98.89.811.910.37.66.15.75.55.35.05.04.94.84.95.35.86.36.76.97.27.57.87.97.57.46.96.56.05.85.96.26.76.97.27.88.49.09.29.19.08.78.17.36.65.95.14.12.91.20.60.20.10.10.10.10.20.41.65.66.17.07.56.35.25.15.25.35.55.65.85.76.06.36.97.37.57.67.77.98.18.38.27.97.67.37.06.87.07.37.67.77.98.28.89.39.79.79.49.18.47.56.65.84.94.02.71.30.60.30.10.10.10.20.51.54.24.95.05.35.34.64.54.95.46.06.46.66.57.27.68.08.38.48.28.18.28.58.88.78.68.37.97.77.98.28.48.68.68.48.69.39.910.110.39.99.38.77.86.96.05.03.92.61.30.60.30.10.40.61.01.83.56.49.39.99.610.09.26.85.45.45.86.56.86.66.87.68.48.99.09.08.16.97.78.69.19.19.18.27.17.48.39.19.19.38.87.87.58.910.010.210.39.78.57.57.47.06.05.03.92.51.20.60.30.11.01.72.84.88.913.719.121.821.619.316.311.27.66.66.46.87.47.78.18.49.19.19.19.18.78.38.48.99.08.99.18.78.48.59.09.29.19.39.08.68.79.29.69.69.79.58.88.27.66.85.74.73.72.31.10.50.30.11.11.72.74.69.714.422.226.326.522.717.611.77.46.56.56.87.48.18.79.09.19.29.29.08.88.78.68.78.98.98.88.88.78.78.89.19.19.08.98.88.89.09.19.29.29.08.78.37.56.65.84.73.62.30.90.50.20.10.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.028.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.30.30.30.40.40.50.50.50.50.50.50.40.60.60.50.50.50.50.50.50.50.50.50.50.50.50.50.50.40.50.50.40.40.40.40.40.30.30.30.30.30.20.20.10.10.10.10.20.20.30.30.30.30.40.40.50.60.60.70.80.90.90.91.01.01.00.80.90.90.90.90.80.80.70.70.70.70.70.80.80.90.90.91.01.01.11.11.01.01.00.90.80.70.60.60.50.40.30.20.10.10.10.10.20.30.40.50.60.60.70.80.80.91.01.11.31.51.11.71.61.61.61.61.51.51.51.41.31.21.11.11.11.01.01.01.11.31.51.61.61.71.81.91.92.02.01.91.71.51.31.11.10.90.70.50.30.20.10.10.10.20.30.50.91.52.43.33.33.43.64.13.93.94.44.54.54.54.74.54.34.64.64.24.14.34.13.73.73.93.53.53.63.83.63.94.74.54.54.75.35.35.45.65.14.94.84.23.12.31.91.51.10.70.40.20.10.10.10.30.50.61.22.03.14.04.95.55.55.04.84.75.25.96.56.35.65.15.05.25.56.06.05.34.74.24.34.65.15.34.74.34.24.55.46.06.66.46.16.36.46.77.27.06.15.03.92.92.31.91.40.80.40.20.10.71.01.93.13.53.64.96.57.57.26.76.46.16.06.05.96.36.56.35.95.86.05.95.85.85.75.45.04.94.84.74.94.84.64.64.95.15.76.06.46.66.97.77.67.27.37.26.65.94.83.52.72.21.60.80.30.20.12.44.17.712.414.817.119.118.917.714.310.68.87.67.06.76.36.35.86.05.96.06.25.65.65.55.45.14.84.74.54.54.44.14.04.34.84.95.55.86.36.67.27.97.87.57.37.26.76.15.34.33.32.51.80.70.30.10.12.43.98.013.216.922.225.122.018.715.110.78.67.76.96.36.05.75.25.25.35.55.44.75.14.74.64.44.03.63.63.73.53.03.03.63.94.04.95.25.86.36.67.07.37.27.06.86.35.75.34.94.03.02.20.70.30.10.12.34.59.513.515.517.220.520.620.018.012.58.67.36.76.15.65.34.84.74.84.94.74.44.33.93.94.55.25.25.05.46.46.86.76.15.14.54.85.24.83.83.00.70.30.12.54.67.08.610.011.817.317.418.417.413.28.87.36.86.15.45.14.84.54.44.54.54.44.04.44.95.35.55.76.26.26.26.05.65.25.15.24.94.33.50.70.30.12.02.83.64.55.36.716.918.019.816.211.98.97.76.86.05.35.04.64.22.93.94.24.54.95.25.65.75.65.55.55.34.94.74.95.04.93.20.70.30.11.01.31.72.32.74.117.919.820.415.711.28.67.66.65.85.34.83.92.82.43.63.94.14.54.85.05.15.04.95.04.74.44.34.64.85.13.20.70.30.10.50.60.91.31.83.317.523.921.016.211.08.47.26.45.65.14.23.42.63.63.84.14.24.44.64.64.64.64.44.23.83.74.14.44.53.20.70.30.10.10.20.40.60.91.33.417.927.421.417.111.38.37.06.15.44.64.03.22.33.74.04.14.24.44.44.34.44.23.93.63.33.23.63.83.63.20.60.30.20.10.10.20.40.71.23.018.225.521.617.211.88.87.26.05.14.53.82.82.03.94.14.24.24.34.24.03.83.63.32.92.62.62.93.02.72.40.50.30.20.10.10.20.30.61.02.919.221.822.017.912.88.97.66.35.44.63.82.82.04.04.14.24.34.24.03.73.33.02.72.21.92.02.22.01.81.60.40.30.10.10.10.10.30.51.13.318.820.322.919.613.79.47.97.16.15.14.23.22.63.84.04.34.54.54.23.83.22.72.31.81.51.61.91.81.61.50.20.20.10.10.10.10.20.41.13.318.319.723.720.414.29.98.67.96.95.84.93.92.92.52.02.13.34.14.54.74.84.54.03.42.72.11.61.31.41.92.32.12.00.20.10.10.10.10.10.20.40.83.019.521.222.619.214.510.79.68.47.46.45.64.63.52.72.33.74.14.54.43.93.84.14.34.14.54.64.94.94.74.44.13.72.82.21.61.21.32.02.52.52.40.10.10.10.10.10.10.10.30.72.618.624.322.518.414.011.310.08.77.67.06.25.34.23.43.04.65.05.25.24.74.44.44.54.44.64.65.05.04.84.54.23.72.82.21.51.11.32.12.73.22.10.10.10.10.10.10.10.10.30.72.918.322.518.813.610.69.78.88.17.46.96.15.14.23.75.15.66.06.05.65.24.94.84.64.74.74.95.15.14.84.13.42.72.01.51.21.32.22.93.52.10.10.10.10.10.10.10.10.30.52.718.326.722.318.413.210.19.08.78.37.97.66.76.35.75.25.05.14.84.44.85.25.46.56.87.16.86.66.15.75.45.15.04.84.84.94.84.33.73.02.42.01.51.21.42.12.73.02.20.20.10.10.10.10.10.20.30.72.518.722.321.817.813.19.58.58.28.07.77.56.06.76.45.95.65.65.35.05.35.76.36.77.17.06.37.06.76.25.85.65.34.94.74.54.33.73.22.62.21.91.61.41.52.12.52.52.40.20.10.10.10.10.10.20.30.82.818.419.721.618.012.59.08.07.37.27.27.15.76.86.56.26.05.95.75.55.66.16.26.66.96.86.27.06.86.56.36.05.65.04.54.23.83.32.82.52.22.01.71.61.72.22.42.12.00.30.20.20.10.10.10.20.40.92.917.318.321.918.111.88.27.06.56.36.46.76.36.66.46.26.16.26.16.06.06.06.06.26.36.56.66.76.76.86.76.55.95.14.54.13.63.12.72.52.42.32.01.92.12.42.11.91.60.40.30.20.10.10.10.20.40.82.718.519.620.816.811.37.76.45.85.75.86.16.26.16.06.06.16.26.26.16.05.95.65.55.55.86.16.36.56.87.06.86.25.44.74.13.73.33.02.92.92.82.62.52.72.92.72.32.00.60.40.20.10.10.10.20.40.72.318.222.220.615.910.77.56.25.55.35.35.35.45.45.55.65.95.75.65.45.55.75.24.94.84.95.35.66.26.46.66.66.35.85.04.54.13.83.63.63.63.53.43.23.33.63.83.32.90.70.40.20.10.10.10.20.40.72.617.726.120.616.110.37.35.95.24.94.84.74.64.64.85.05.55.75.45.35.55.24.64.34.04.14.54.95.66.06.36.46.46.05.34.94.74.54.44.34.34.34.23.93.94.34.44.23.60.80.40.20.10.10.10.20.30.62.517.526.120.516.110.37.15.74.84.44.03.93.83.83.94.24.64.95.15.04.74.44.03.63.33.43.64.14.75.46.06.46.46.05.75.75.85.75.75.45.45.55.34.94.75.05.25.23.61.00.50.20.10.10.10.10.30.52.117.822.120.415.910.87.45.84.73.93.53.23.03.03.23.43.74.14.34.23.93.53.33.02.82.83.03.33.74.45.25.86.26.26.36.67.07.17.07.06.96.86.66.15.75.96.06.03.81.10.50.20.10.10.10.10.20.52.418.119.320.816.911.67.86.04.83.93.32.92.62.62.72.83.03.23.43.43.23.02.82.72.62.62.72.83.13.64.45.36.06.67.17.68.08.38.68.78.58.37.66.96.76.76.45.94.21.20.50.20.10.10.10.10.20.62.716.717.921.818.211.87.76.05.04.13.32.82.62.52.52.72.72.83.03.02.82.82.72.72.72.72.72.72.83.24.05.16.16.97.88.38.08.59.89.89.69.27.76.97.47.16.65.74.51.20.50.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.027.90.10.10.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.50.50.50.30.50.50.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.20.30.30.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.72.02.82.92.82.82.93.02.92.31.71.10.80.50.40.30.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.71.72.32.42.32.22.22.32.42.31.91.41.00.70.50.30.20.20.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.50.81.11.41.71.81.81.81.81.92.02.01.70.90.20.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.30.30.30.40.40.40.40.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.30.30.30.30.30.20.30.30.30.30.30.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.30.30.30.30.30.30.30.40.30.40.40.40.40.30.30.30.30.30.30.30.30.30.40.40.40.30.30.30.30.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.20.20.20.20.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.03.1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-4EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-4EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5 EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1AEXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1A EXL-1AEXL-1AEXL-1EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1B EXL-1B EXL-1BEXL-1BEXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1AEXL-1AEXL-1APlan ViewScale - 1" = 40ftDesignerKyser MccrammerDate01/17/2024ScaleNot to ScaleVersion No.001SummaryDescription Symbol Avg Max Min Max/Min Avg/MinCalc Zone Bldg 2 & 4 CustomerParking7.8 fc 19.1 fc 1.6 fc 11.9:1 4.9:1Calc Zone Bldg 2 & 4 Front Row 13.5 fc 26.2 fc 5.1 fc 5.1:1 2.6:1Calc Zone Bldg #1 Entire Site 4.0 fc 27.9 fc 0.0 fc N/A N/ACalc Zone Bldg #3 Entire Site 5.7 fc 28.1 fc 0.0 fc N/A N/AProperty Line 0.3 fc 3.1 fc 0.0 fc N/A N/ACalc Zone Bldg 2 & 4 Entire Site 4.6 fc 27.0 fc 0.0 fc N/A N/ANOTES:1. CALCULATION POINT WORK PLANE: Ground Level2. FIXTURE MOUNTING HEIGHT: 22'6" AFFGUARANTEE OF PERFORMANCE. ACTUAL LIGHT LEVELS MAYVARY.**Light Loss FactorSymbol Label Quantity Manufacturer Catalog Number Number Lamps DescriptionLumensPerLampWattageEXL-13 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 134.5EXL-1A17 Lithonia Lighting [...] 1 [...] 33580.49830.94Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 L901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left33580 415.47Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 R901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right33580 415.47EXL-1B23 Lithonia Lighting [...] 1 [...] 4846.149101.8Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 L901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left4846 50.9Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 R901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right4846 50.9EXL-250 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 269EXL-42 Lithonia Lighting DSX1 LED P6 50K80CRI T3M1 D-Series Size 1 Area Luminaire P6Performance Package 5000K CCT 80CRI Type 3 Medium18938 165.25EXL-538 Lithonia Lighting DSX1 LED P1 50K80CRI T4M1 D-Series Size 1 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 4 Medium7106 50.9**This document contains confidential and proprietary information of KSA Lighting & Controls. This document may only be used by or for the benefit of KSA Lighting & Controls representatives and customers. This lighting layout is not a professional engineering drawing and is provided for informational purposes only, without warranty as to accuracy, completeness, reliability or otherwise. KSA Lighting & Controlsis not responsible for specifying the light fixtures or illumination requirements for any specific project, nor is it responsible for meeting municipal or building code requirements. It is the obligation of the end-user to consult with a professional engineering advisor to determine whether this lighting layout meets the applicable project requirements for lighting system performance, safety, suitability and effectivenessfor use in a particular application. Field verification is recommended when calculations are based on end-user or customer-provided information. End-user environment and application (including, but not limited to, voltage variation and dirt accumulation) can cause actual field performance to differ from the calculated photometric performance represented in this lighting layout. In no event will KSA Lighting &Controls be responsible for any loss resulting from any use of this drawing.1.01.62.85.510.814.324.025.324.018.713.58.66.96.77.17.68.28.89.09.29.29.29.08.78.58.58.78.88.88.88.68.58.58.88.98.98.98.78.58.58.78.98.98.98.78.48.07.36.76.15.13.82.60.90.40.20.11.01.62.95.17.39.223.024.224.920.215.111.79.57.97.57.77.87.77.98.59.09.39.18.97.97.47.58.28.68.68.67.87.47.58.28.78.78.78.07.57.47.88.68.68.78.27.46.86.56.66.35.84.53.30.90.40.20.10.81.42.12.83.85.119.423.421.917.512.39.58.58.18.08.18.38.17.28.58.98.98.68.37.67.07.17.77.97.97.97.57.07.17.78.08.08.07.77.17.07.68.08.08.07.77.06.46.36.26.25.84.93.80.90.40.20.10.60.81.01.31.93.720.816.811.38.67.97.87.98.08.15.65.55.75.75.33.50.90.50.30.20.30.40.50.71.21.820.616.611.48.98.17.87.87.87.84.84.75.25.55.53.51.00.50.30.20.20.20.30.50.81.820.116.211.79.28.58.17.97.87.77.36.86.46.25.95.44.84.34.04.04.24.44.44.54.44.34.44.75.05.05.15.15.05.15.25.45.45.35.04.64.34.14.24.85.15.03.61.00.60.30.20.10.10.20.30.61.919.57.36.96.55.95.55.14.63.93.43.33.33.53.73.83.83.83.94.04.34.64.84.94.84.85.05.15.45.55.34.94.54.24.04.24.74.84.43.81.00.60.30.20.10.10.10.20.71.818.06.96.56.25.54.74.23.63.12.72.52.62.83.13.33.43.53.63.94.24.54.74.84.84.94.95.35.55.75.45.04.64.44.24.34.74.74.03.31.00.60.30.20.10.10.20.61.717.86.35.95.85.04.23.52.92.21.82.12.12.22.52.83.23.53.84.14.34.64.85.05.15.25.45.46.06.15.95.45.04.74.54.64.74.13.52.71.00.60.30.20.10.10.10.20.51.618.95.95.85.31.61.92.12.53.03.74.34.64.74.74.95.35.65.75.75.65.96.46.35.95.45.24.94.94.94.33.62.70.90.50.20.10.10.10.10.30.51.519.35.45.14.71.31.51.82.33.03.94.64.94.94.74.85.25.65.75.75.65.45.26.36.25.96.05.75.55.35.04.23.30.90.40.20.10.10.10.20.30.62.019.64.44.13.91.11.31.62.12.73.64.44.74.64.44.75.25.75.85.75.75.55.24.65.56.36.76.56.16.05.54.73.80.80.40.20.10.10.10.20.40.62.019.33.43.23.05.86.36.56.55.95.43.50.70.30.10.10.10.10.20.40.61.418.62.25.95.96.26.56.15.73.40.70.30.10.10.10.10.10.40.61.618.01.76.56.66.46.45.85.13.40.70.30.10.10.10.10.20.30.71.716.81.46.36.46.36.15.54.53.60.70.30.10.10.10.10.20.61.717.11.66.06.26.15.85.03.92.90.70.30.20.10.10.10.20.41.518.82.16.06.26.15.54.23.22.30.70.40.20.10.10.20.41.319.72.75.85.95.85.14.03.02.20.60.40.20.10.10.10.41.820.43.65.05.15.14.74.23.32.60.60.40.20.20.10.10.31.820.44.63.74.14.24.34.03.53.10.50.40.30.20.10.10.31.316.220.719.65.53.13.33.64.14.14.12.80.60.40.30.20.10.20.41.415.917.218.26.26.05.74.63.73.22.62.01.61.51.61.71.92.22.82.92.52.42.42.42.53.03.02.62.52.62.93.44.14.43.74.54.24.34.84.84.93.10.80.50.30.20.10.10.20.51.612.113.115.26.86.46.05.14.23.63.02.42.12.12.22.52.83.13.53.63.43.13.13.13.33.63.63.43.33.53.84.45.05.14.54.94.74.75.15.14.83.51.00.60.30.20.10.10.20.61.610.010.512.57.37.06.25.34.53.83.22.72.52.62.93.33.63.94.14.14.03.73.63.63.83.93.93.94.04.24.65.15.55.55.15.35.15.15.35.14.53.91.10.60.30.10.10.20.30.61.515.57.57.16.25.34.54.03.42.92.72.93.54.04.44.64.74.64.44.13.93.94.04.14.34.44.54.75.15.55.75.75.45.55.45.45.55.14.23.51.20.60.30.10.10.10.20.30.51.417.37.37.06.25.34.54.03.53.13.03.44.04.85.25.35.15.04.84.34.03.94.04.24.34.75.05.25.35.55.55.55.35.65.65.75.64.73.93.01.20.60.30.10.10.10.20.30.51.418.46.76.96.25.54.64.03.63.33.44.04.75.45.46.05.85.55.04.54.14.04.04.34.64.94.95.35.55.55.45.45.45.55.35.95.85.14.13.11.20.60.20.10.10.20.30.52.019.55.66.46.15.44.74.23.93.83.94.65.45.85.86.66.25.54.84.64.34.14.14.54.85.04.55.15.65.65.45.55.55.54.45.76.15.84.73.81.30.60.20.10.10.10.30.51.819.85.36.05.65.14.54.34.24.24.55.26.06.46.37.06.65.85.04.64.34.14.14.44.84.94.25.05.35.35.25.35.35.34.35.56.05.85.14.31.20.60.30.10.10.10.20.41.420.05.35.55.04.64.44.34.44.75.15.66.26.96.76.96.45.85.14.54.14.14.24.44.64.84.74.94.95.04.94.94.95.04.65.35.75.85.53.91.20.60.30.10.10.20.51.720.95.34.84.44.24.24.44.85.25.55.96.46.86.96.76.05.55.04.64.24.24.34.44.54.74.74.74.74.74.84.74.64.64.64.75.25.45.63.71.20.60.30.10.10.10.61.721.94.54.03.83.84.14.65.15.76.06.36.56.66.66.25.85.24.94.64.54.54.54.64.84.74.64.64.84.94.84.74.54.14.04.04.64.84.83.71.10.60.20.10.10.10.41.721.34.03.53.33.54.04.65.35.95.96.46.56.56.35.95.55.04.84.64.54.64.74.84.94.84.84.84.94.94.94.64.23.83.53.53.94.13.93.50.90.60.30.10.10.10.41.521.13.22.82.73.03.64.45.25.44.86.06.16.05.75.44.84.44.34.24.14.24.54.54.84.74.74.74.84.74.64.23.73.32.92.83.13.22.92.60.70.50.30.20.10.20.42.021.217.211.57.76.34.84.03.12.52.12.12.53.13.94.75.24.35.45.45.25.14.84.23.83.83.73.53.84.14.14.54.54.74.94.94.74.23.73.22.72.22.22.42.11.91.70.50.40.20.10.10.20.42.020.816.610.87.45.54.13.22.62.11.81.82.12.63.33.94.44.34.84.74.34.54.23.43.03.33.12.62.82.82.94.34.64.95.14.84.74.03.42.82.31.81.82.01.91.71.50.30.30.20.10.10.20.41.520.115.910.46.64.63.42.72.21.91.61.61.92.22.63.03.43.63.63.53.84.54.95.14.24.64.13.42.72.11.71.72.02.32.12.00.20.20.10.10.10.20.51.620.016.210.36.04.02.92.32.01.71.51.61.82.02.22.42.62.72.72.74.14.85.25.23.84.64.13.42.62.11.61.62.12.52.52.40.10.10.10.10.10.10.20.61.520.516.89.75.33.42.41.91.61.51.41.51.61.81.92.02.02.02.02.04.04.54.95.04.44.43.93.22.51.91.51.62.22.83.22.10.10.10.10.10.10.10.20.41.319.315.59.24.93.02.01.61.41.41.41.51.21.31.31.33.53.94.34.64.54.03.42.82.31.91.51.62.32.93.52.10.10.10.10.10.10.20.20.918.514.18.64.73.02.01.61.51.51.51.23.23.53.83.93.83.42.92.52.11.81.51.52.22.73.02.20.10.10.10.10.10.20.21.318.614.18.24.83.22.42.01.92.01.81.93.03.33.43.33.22.82.52.21.91.71.51.62.12.42.42.30.10.10.10.10.10.10.11.418.814.28.24.93.52.82.52.42.42.42.53.03.03.02.82.52.22.01.81.61.41.31.62.02.21.91.80.10.10.10.10.10.10.10.818.313.88.45.13.73.02.93.03.23.33.32.82.82.62.32.01.71.51.31.31.21.31.61.91.71.61.30.20.20.10.10.10.10.818.214.39.05.33.93.43.43.74.04.24.32.52.32.22.01.81.61.41.21.21.21.41.82.22.11.91.60.30.20.10.10.10.10.31.019.115.69.05.24.03.73.94.24.64.85.01.81.91.92.01.81.81.61.51.51.61.82.22.83.12.82.40.40.20.10.10.10.10.21.018.715.19.05.34.13.94.24.04.14.35.11.51.61.82.02.12.12.02.02.02.22.32.73.43.83.63.10.50.20.10.10.10.10.20.818.013.88.75.24.03.74.14.34.44.75.11.51.61.82.02.22.32.42.42.52.72.83.23.94.34.43.00.50.20.10.10.10.10.20.31.218.013.68.05.03.93.53.74.04.34.34.01.61.71.82.12.32.52.62.93.23.43.53.74.34.74.82.90.50.20.10.20.20.30.30.51.818.413.87.94.93.93.33.33.63.73.63.22.70.10.11.91.81.92.12.32.63.03.43.84.04.14.14.54.64.33.00.50.20.10.30.50.60.70.91.817.913.38.05.34.03.43.23.13.12.92.62.21.90.21.91.81.82.02.32.73.33.84.14.24.34.54.64.33.73.10.40.20.10.50.81.21.51.82.717.913.59.06.24.73.93.42.92.72.42.11.91.81.61.41.51.61.92.32.83.43.83.93.83.94.44.54.13.22.30.40.20.10.71.11.82.94.25.618.915.511.38.46.65.03.62.82.42.12.02.02.02.11.61.91.91.51.51.51.62.12.11.81.61.51.62.02.01.61.91.81.92.22.52.93.43.94.24.44.44.34.03.22.41.70.50.20.10.71.11.93.56.810.016.518.020.119.415.712.49.05.53.52.62.11.91.81.81.92.12.32.22.11.91.81.82.02.32.42.21.91.81.92.22.21.92.12.02.12.42.73.13.43.74.04.24.13.83.32.72.11.40.50.20.10.81.21.83.26.612.717.920.221.921.418.715.39.25.13.52.92.52.22.02.12.22.32.52.72.52.42.42.42.52.72.72.62.52.42.42.52.52.32.52.52.62.93.33.53.63.84.04.13.93.63.02.51.91.20.50.20.10.81.32.03.35.511.016.922.326.123.819.014.58.75.74.33.53.12.82.72.82.92.93.02.92.82.83.03.13.43.43.33.22.92.72.93.03.13.13.33.23.23.53.83.94.14.34.34.23.93.52.82.21.71.20.60.30.10.10.50.91.62.85.210.616.015.616.216.818.414.58.95.84.13.22.82.93.03.33.43.23.02.72.22.73.13.43.83.83.53.22.82.32.63.13.33.63.83.53.43.33.53.94.14.44.44.13.63.02.21.81.41.00.60.30.10.10.10.20.20.20.41.01.72.43.03.23.73.73.12.52.02.02.53.03.73.83.22.72.21.92.22.83.34.04.03.42.92.31.92.22.73.23.84.03.53.12.82.83.33.84.34.33.62.92.21.61.31.00.80.50.30.10.10.10.20.30.60.91.52.32.72.42.42.62.31.71.72.22.62.32.42.62.41.81.41.72.42.92.62.62.82.51.91.51.72.42.82.52.52.92.72.22.22.73.02.62.52.72.31.61.00.80.60.50.30.20.10.10.10.20.30.30.30.30.30.20.20.10.10.10.20.20.20.20.20.20.30.30.30.30.40.40.40.40.40.30.30.30.30.30.30.40.40.40.40.40.40.30.30.20.20.20.20.20.20.20.20.20.10.10.10.10.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.117.226.08.18.18.08.07.97.67.16.66.46.36.46.76.76.66.56.46.46.66.86.96.86.76.66.66.76.86.96.96.66.36.016.725.77.77.57.27.06.86.45.85.45.25.25.35.45.45.45.45.45.55.75.85.85.75.75.75.85.95.95.85.75.417.021.417.018.313.914.913.814.716.818.016.721.016.125.016.024.816.420.516.517.413.514.213.614.316.717.916.521.016.025.215.925.212.813.616.117.015.720.915.925.316.324.617.720.817.818.816.717.818.319.517.722.316.9 16.926.117.521.918.018.916.217.017.117.817.019.715.723.715.624.815.921.017.117.815.616.016.216.616.918.515.422.315.224.515.321.316.917.816.317.116.312.38.88.48.38.27.917.012.48.68.28.28.17.816.612.08.87.97.57.47.215.411.48.57.26.66.46.315.110.27.56.35.65.35.415.39.46.65.44.74.54.514.88.95.84.63.93.73.514.08.75.54.03.22.92.72.62.413.99.25.63.82.92.52.32.11.815.19.65.84.13.22.72.32.015.510.26.54.83.93.22.72.41.915.110.97.65.94.84.03.53.12.515.711.08.16.95.85.04.43.93.216.610.98.07.16.55.85.24.74.116.611.38.17.37.06.35.95.55.015.711.18.47.87.26.96.55.85.614.711.18.97.97.27.17.014.010.78.37.47.27.37.413.410.27.67.07.07.27.413.29.77.46.66.56.87.313.39.37.16.36.16.57.114.09.16.86.26.26.56.915.29.67.06.36.36.66.715.710.37.66.56.36.46.416.211.38.16.86.26.16.117.712.38.87.26.35.85.612.88.67.56.45.75.118.213.08.57.26.45.44.617.312.38.06.85.84.83.90.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.00.00.00.00.00.00.00.00.00.00.00.00.00.05.15.11.627.026.219.10.10.10.10.20.53.117.719.121.117.411.67.25.34.94.23.42.92.62.52.52.62.72.82.92.92.82.72.72.72.72.72.72.82.83.14.05.16.17.08.08.99.610.110.310.110.09.89.38.47.77.26.45.23.91.20.50.20.10.10.10.10.30.42.818.121.120.716.211.37.86.14.94.03.32.92.62.62.62.72.82.93.13.12.92.82.82.72.72.72.72.82.93.24.15.26.27.17.98.99.810.410.410.110.010.09.58.77.97.05.94.73.41.20.50.20.10.10.10.10.30.52.618.125.220.715.910.77.66.04.84.03.53.12.92.92.93.03.23.43.63.63.43.22.92.92.82.72.82.93.23.84.65.76.57.17.98.79.410.010.210.09.99.89.38.57.87.15.94.83.51.20.50.20.10.10.10.20.40.62.818.426.720.816.110.57.56.05.04.44.03.73.53.43.53.73.94.34.64.54.33.93.63.33.13.13.33.53.94.75.66.57.17.37.98.27.98.19.59.79.79.27.97.17.37.26.55.34.01.20.50.20.10.10.10.20.40.73.018.523.320.916.010.87.76.45.55.14.84.64.44.24.34.54.95.15.45.45.14.84.44.03.73.84.04.45.05.76.57.17.47.57.67.87.98.28.68.78.78.47.87.16.86.86.35.54.41.20.50.20.10.10.10.20.40.83.818.920.321.216.711.58.16.75.95.65.55.35.15.05.15.35.65.75.55.65.55.65.14.84.54.64.95.36.06.16.77.07.37.36.97.07.27.37.37.27.27.16.96.35.96.06.05.73.91.10.50.20.10.10.10.20.41.03.817.819.022.217.911.68.27.16.46.06.06.05.95.75.65.76.06.15.96.06.16.15.75.55.55.65.86.16.56.97.17.27.57.06.66.56.46.46.26.06.06.05.75.35.05.35.45.63.61.00.50.20.10.10.10.20.40.93.818.219.621.917.812.18.97.77.06.76.76.86.66.36.06.06.16.26.46.56.56.56.46.36.36.36.76.76.97.17.57.67.36.86.46.15.95.85.65.45.35.14.84.34.14.54.74.73.50.90.40.20.10.10.20.40.73.619.021.421.717.512.79.58.67.97.87.67.36.76.56.46.05.96.16.26.56.66.76.97.17.26.97.27.27.17.17.37.37.16.76.46.15.95.65.25.14.84.54.13.63.53.84.03.73.30.70.40.20.10.10.10.30.73.119.025.622.217.913.110.19.18.98.78.27.76.86.66.45.85.65.65.85.86.06.87.17.57.77.27.47.67.37.06.96.86.76.46.16.05.85.34.84.44.13.73.22.82.73.13.22.82.40.60.40.20.10.10.10.30.63.219.322.518.613.510.69.59.38.98.47.96.66.66.05.45.15.25.45.45.76.17.17.47.87.47.77.47.06.56.46.26.36.06.06.05.85.34.63.93.42.92.42.12.12.32.11.91.60.40.30.20.10.10.30.63.119.025.222.518.313.911.110.29.38.68.07.66.75.74.74.03.65.96.76.97.06.66.05.85.85.65.75.65.85.95.85.34.53.73.02.41.91.51.72.01.91.71.50.30.20.20.10.10.20.63.619.321.722.718.814.511.410.49.28.27.56.85.94.84.03.53.15.76.26.56.45.85.25.25.45.35.45.55.86.05.65.14.63.82.92.31.71.41.52.02.32.11.90.20.10.10.10.10.10.20.83.918.420.123.420.014.310.79.58.87.96.96.05.14.13.93.54.14.95.25.34.54.14.33.82.92.21.61.21.42.02.52.52.50.10.10.10.10.10.10.20.83.918.219.923.319.613.89.68.28.07.06.05.14.23.24.04.54.95.25.14.74.23.62.82.11.51.21.42.22.83.22.20.10.10.10.10.10.10.30.63.518.920.921.717.612.79.07.66.55.64.73.93.12.43.54.04.34.64.74.33.83.12.52.01.51.21.42.32.93.52.20.20.10.10.10.10.10.20.30.62.918.323.820.816.011.07.86.25.04.13.52.92.31.83.23.53.84.04.03.73.32.72.32.01.61.31.52.22.83.12.30.20.10.10.10.10.10.20.40.62.918.426.620.315.69.86.64.93.93.22.72.31.81.53.23.43.53.53.53.22.82.52.22.01.71.51.72.22.62.62.50.20.20.10.10.10.10.20.40.72.718.024.220.014.89.25.84.13.12.62.32.01.61.33.13.43.33.33.23.02.72.52.42.21.91.82.02.42.62.32.00.30.30.20.10.10.10.20.40.73.218.220.319.814.89.35.53.72.82.32.11.91.51.33.43.63.33.33.23.12.92.82.82.62.42.42.52.72.42.11.70.50.30.20.10.10.20.40.83.517.618.520.315.89.35.43.62.72.32.11.91.51.23.73.73.43.43.43.43.43.53.43.23.13.03.13.33.02.62.10.60.40.20.10.10.10.20.30.83.416.917.920.916.39.55.53.93.02.52.21.91.51.23.23.43.53.73.84.04.14.14.03.93.83.63.63.93.93.52.90.70.40.20.10.10.10.10.30.53.318.019.019.815.39.96.14.43.42.92.62.32.01.81.92.33.13.74.14.65.35.85.75.55.35.14.84.03.43.13.23.33.94.04.24.44.74.94.94.74.74.74.64.34.24.44.54.23.60.80.40.20.10.10.10.10.20.42.417.421.819.614.89.86.65.14.03.32.92.52.11.91.92.33.03.74.35.05.76.26.16.15.85.54.94.13.43.13.13.33.94.24.65.05.45.75.85.65.65.55.35.04.75.05.25.13.50.90.40.20.10.10.10.20.32.217.225.119.615.19.86.85.74.74.03.32.82.42.22.22.63.34.14.75.56.46.86.46.66.66.15.34.63.83.43.43.64.34.75.35.86.16.66.86.86.66.46.05.65.45.85.85.73.61.00.40.20.10.10.10.32.116.623.719.314.89.76.75.85.44.73.93.43.02.72.73.13.84.65.26.06.77.26.47.27.36.65.75.04.33.83.84.24.95.46.06.15.96.47.87.97.77.05.75.25.96.36.05.53.91.00.40.20.10.10.10.32.315.718.818.413.99.56.86.05.75.24.54.03.53.33.33.74.45.15.66.26.87.37.37.47.56.96.05.44.74.34.44.95.55.96.57.07.58.18.78.68.48.07.36.66.56.55.95.14.11.10.50.20.10.10.10.42.513.715.116.312.48.86.66.35.85.34.84.44.13.93.94.45.05.66.16.46.87.47.87.97.67.06.45.75.25.05.15.56.06.46.77.38.18.79.09.08.78.37.87.16.56.35.84.63.51.10.50.20.10.10.10.41.98.89.811.910.37.66.15.75.55.35.05.04.94.84.95.35.86.36.76.97.27.57.87.97.57.46.96.56.05.85.96.26.76.97.27.88.49.09.29.19.08.78.17.36.65.95.14.12.91.20.60.20.10.10.10.10.20.41.65.66.17.07.56.35.25.15.25.35.55.65.85.76.06.36.97.37.57.67.77.98.18.38.27.97.67.37.06.87.07.37.67.77.98.28.89.39.79.79.49.18.47.56.65.84.94.02.71.30.60.30.10.10.10.20.51.54.24.95.05.35.34.64.54.95.46.06.46.66.57.27.68.08.38.48.28.18.28.58.88.78.68.37.97.77.98.28.48.68.68.48.69.39.910.110.39.99.38.77.86.96.05.03.92.61.30.60.30.10.40.61.01.83.56.49.39.99.610.09.26.85.45.45.86.56.86.66.87.68.48.99.09.08.16.97.78.69.19.19.18.27.17.48.39.19.19.38.87.87.58.910.010.210.39.78.57.57.47.06.05.03.92.51.20.60.30.11.01.72.84.88.913.719.121.821.619.316.311.27.66.66.46.87.47.78.18.49.19.19.19.18.78.38.48.99.08.99.18.78.48.59.09.29.19.39.08.68.79.29.69.69.79.58.88.27.66.85.74.73.72.31.10.50.30.11.11.72.74.69.714.422.226.326.522.717.611.77.46.56.56.87.48.18.79.09.19.29.29.08.88.78.68.78.98.98.88.88.78.78.89.19.19.08.98.88.89.09.19.29.29.08.78.37.56.65.84.73.62.30.90.50.20.10.00.00.00.00.00.00.00.0 0.0 0.0 0.0 0.0 0.00.00.00.00.00.00.00.00.028.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.30.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.30.30.30.40.40.50.50.50.50.50.50.40.60.60.50.50.50.50.50.50.50.50.50.50.50.50.50.50.40.50.50.40.40.40.40.40.30.30.30.30.30.20.20.10.10.10.10.20.20.30.30.30.30.40.40.50.60.60.70.80.90.90.91.01.01.00.80.90.90.90.90.80.80.70.70.70.70.70.80.80.90.90.91.01.01.11.11.01.01.00.90.80.70.60.60.50.40.30.20.10.10.10.10.20.30.40.50.60.60.70.80.80.91.01.11.31.51.11.71.61.61.61.61.51.51.51.41.31.21.11.11.11.01.01.01.11.31.51.61.61.71.81.91.92.02.01.91.71.51.31.11.10.90.70.50.30.20.10.10.10.20.30.50.91.52.43.33.33.43.64.13.93.94.44.54.54.54.74.54.34.64.64.24.14.34.13.73.73.93.53.53.63.83.63.94.74.54.54.75.35.35.45.65.14.94.84.23.12.31.91.51.10.70.40.20.10.10.10.30.50.61.22.03.14.04.95.55.55.04.84.75.25.96.56.35.65.15.05.25.56.06.05.34.74.24.34.65.15.34.74.34.24.55.46.06.66.46.16.36.46.77.27.06.15.03.92.92.31.91.40.80.40.20.10.71.01.93.13.53.64.96.57.57.26.76.46.16.06.05.96.36.56.35.95.86.05.95.85.85.75.45.04.94.84.74.94.84.64.64.95.15.76.06.46.66.97.77.67.27.37.26.65.94.83.52.72.21.60.80.30.20.12.44.17.712.414.817.119.118.917.714.310.68.87.67.06.76.36.35.86.05.96.06.25.65.65.55.45.14.84.74.54.54.44.14.04.34.84.95.55.86.36.67.27.97.87.57.37.26.76.15.34.33.32.51.80.70.30.10.12.43.98.013.216.922.225.122.018.715.110.78.67.76.96.36.05.75.25.25.35.55.44.75.14.74.64.44.03.63.63.73.53.03.03.63.94.04.95.25.86.36.67.07.37.27.06.86.35.75.34.94.03.02.20.70.30.10.12.34.59.513.515.517.220.520.620.018.012.58.67.36.76.15.65.34.84.74.84.94.74.44.33.93.94.55.25.25.05.46.46.86.76.15.14.54.85.24.83.83.00.70.30.12.54.67.08.610.011.817.317.418.417.413.28.87.36.86.15.45.14.84.54.44.54.54.44.04.44.95.35.55.76.26.26.26.05.65.25.15.24.94.33.50.70.30.12.02.83.64.55.36.716.918.019.816.211.98.97.76.86.05.35.04.64.22.93.94.24.54.95.25.65.75.65.55.55.34.94.74.95.04.93.20.70.30.11.01.31.72.32.74.117.919.820.415.711.28.67.66.65.85.34.83.92.82.43.63.94.14.54.85.05.15.04.95.04.74.44.34.64.85.13.20.70.30.10.50.60.91.31.83.317.523.921.016.211.08.47.26.45.65.14.23.42.63.63.84.14.24.44.64.64.64.64.44.23.83.74.14.44.53.20.70.30.10.10.20.40.60.91.33.417.927.421.417.111.38.37.06.15.44.64.03.22.33.74.04.14.24.44.44.34.44.23.93.63.33.23.63.83.63.20.60.30.20.10.10.20.40.71.23.018.225.521.617.211.88.87.26.05.14.53.82.82.03.94.14.24.24.34.24.03.83.63.32.92.62.62.93.02.72.40.50.30.20.10.10.20.30.61.02.919.221.822.017.912.88.97.66.35.44.63.82.82.04.04.14.24.34.24.03.73.33.02.72.21.92.02.22.01.81.60.40.30.10.10.10.10.30.51.13.318.820.322.919.613.79.47.97.16.15.14.23.22.63.84.04.34.54.54.23.83.22.72.31.81.51.61.91.81.61.50.20.20.10.10.10.10.20.41.13.318.319.723.720.414.29.98.67.96.95.84.93.92.92.52.02.13.34.14.54.74.84.54.03.42.72.11.61.31.41.92.32.12.00.20.10.10.10.10.10.20.40.83.019.521.222.619.214.510.79.68.47.46.45.64.63.52.72.33.74.14.54.43.93.84.14.34.14.54.64.94.94.74.44.13.72.82.21.61.21.32.02.52.52.40.10.10.10.10.10.10.10.30.72.618.624.322.518.414.011.310.08.77.67.06.25.34.23.43.04.65.05.25.24.74.44.44.54.44.64.65.05.04.84.54.23.72.82.21.51.11.32.12.73.22.10.10.10.10.10.10.10.10.30.72.918.322.518.813.610.69.78.88.17.46.96.15.14.23.75.15.66.06.05.65.24.94.84.64.74.74.95.15.14.84.13.42.72.01.51.21.32.22.93.52.10.10.10.10.10.10.10.10.30.52.718.326.722.318.413.210.19.08.78.37.97.66.76.35.75.25.05.14.84.44.85.25.46.56.87.16.86.66.15.75.45.15.04.84.84.94.84.33.73.02.42.01.51.21.42.12.73.02.20.20.10.10.10.10.10.20.30.72.518.722.321.817.813.19.58.58.28.07.77.56.06.76.45.95.65.65.35.05.35.76.36.77.17.06.37.06.76.25.85.65.34.94.74.54.33.73.22.62.21.91.61.41.52.12.52.52.40.20.10.10.10.10.10.20.30.82.818.419.721.618.012.59.08.07.37.27.27.15.76.86.56.26.05.95.75.55.66.16.26.66.96.86.27.06.86.56.36.05.65.04.54.23.83.32.82.52.22.01.71.61.72.22.42.12.00.30.20.20.10.10.10.20.40.92.917.318.321.918.111.88.27.06.56.36.46.76.36.66.46.26.16.26.16.06.06.06.06.26.36.56.66.76.76.86.76.55.95.14.54.13.63.12.72.52.42.32.01.92.12.42.11.91.60.40.30.20.10.10.10.20.40.82.718.519.620.816.811.37.76.45.85.75.86.16.26.16.06.06.16.26.26.16.05.95.65.55.55.86.16.36.56.87.06.86.25.44.74.13.73.33.02.92.92.82.62.52.72.92.72.32.00.60.40.20.10.10.10.20.40.72.318.222.220.615.910.77.56.25.55.35.35.35.45.45.55.65.95.75.65.45.55.75.24.94.84.95.35.66.26.46.66.66.35.85.04.54.13.83.63.63.63.53.43.23.33.63.83.32.90.70.40.20.10.10.10.20.40.72.617.726.120.616.110.37.35.95.24.94.84.74.64.64.85.05.55.75.45.35.55.24.64.34.04.14.54.95.66.06.36.46.46.05.34.94.74.54.44.34.34.34.23.93.94.34.44.23.60.80.40.20.10.10.10.20.30.62.517.526.120.516.110.37.15.74.84.44.03.93.83.83.94.24.64.95.15.04.74.44.03.63.33.43.64.14.75.46.06.46.46.05.75.75.85.75.75.45.45.55.34.94.75.05.25.23.61.00.50.20.10.10.10.10.30.52.117.822.120.415.910.87.45.84.73.93.53.23.03.03.23.43.74.14.34.23.93.53.33.02.82.83.03.33.74.45.25.86.26.26.36.67.07.17.07.06.96.86.66.15.75.96.06.03.81.10.50.20.10.10.10.10.20.52.418.119.320.816.911.67.86.04.83.93.32.92.62.62.72.83.03.23.43.43.23.02.82.72.62.62.72.83.13.64.45.36.06.67.17.68.08.38.68.78.58.37.66.96.76.76.45.94.21.20.50.20.10.10.10.10.20.62.716.717.921.818.211.87.76.05.04.13.32.82.62.52.52.72.72.83.03.02.82.82.72.72.72.72.72.72.83.24.05.16.16.97.88.38.08.59.89.89.69.27.76.97.47.16.65.74.51.20.50.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.0 0.0 0.0 0.027.90.10.10.20.20.20.20.20.20.20.20.20.20.30.30.30.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.50.50.50.30.50.50.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.20.30.30.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.72.02.82.92.82.82.93.02.92.31.71.10.80.50.40.30.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.71.72.32.42.32.22.22.32.42.31.91.41.00.70.50.30.20.20.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.40.50.81.11.41.71.81.81.81.81.92.02.01.70.90.20.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.40.50.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.20.20.20.20.20.20.20.20.20.20.20.30.30.30.40.40.40.40.50.50.50.50.50.40.40.40.40.40.30.30.30.30.30.30.30.40.40.40.40.40.40.40.40.40.40.40.40.40.40.30.30.30.30.30.30.30.30.20.30.30.30.30.30.20.20.20.20.20.10.10.10.10.10.10.10.10.10.10.20.20.20.20.30.30.30.30.30.30.30.40.30.40.40.40.40.30.30.30.30.30.30.30.30.30.40.40.40.30.30.30.30.30.30.30.30.30.30.20.20.20.20.10.10.10.10.10.10.10.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.30.30.30.20.20.20.20.20.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.03.1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-4EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-4EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5 EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-5EXL-5EXL-5EXL-5 EXL-5EXL-5EXL-5EXL-5EXL-5EXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1AEXL-1A EXL-1A EXL-1A EXL-1AEXL-1A EXL-1A EXL-1AEXL-1AEXL-1EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1EXL-2EXL-2EXL-2EXL-2EXL-2EXL-2EXL-1B EXL-1B EXL-1BEXL-1BEXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1BEXL-1B EXL-1B EXL-1BEXL-1BEXL-1AEXL-1AEXL-1APlan ViewScale - 1" = 40ftDescription Symbol Avg Max Min Max/Min Avg/MinCalc Zone Bldg 2 & 4 CustomerParking7.8 fc 19.1 fc 1.6 fc 11.9:1 4.9:1Calc Zone Bldg 2 & 4 Front Row 13.5 fc 26.2 fc 5.1 fc 5.1:1 2.6:1Calc Zone Bldg #1 Entire Site 4.0 fc 27.9 fc 0.0 fc N/A N/ACalc Zone Bldg #3 Entire Site 5.7 fc 28.1 fc 0.0 fc N/A N/AProperty Line 0.3 fc 3.1 fc 0.0 fc N/A N/ACalc Zone Bldg 2 & 4 Entire Site 4.6 fc 27.0 fc 0.0 fc N/A N/ANOTES:1. CALCULATION POINT WORK PLANE: Ground Level2. FIXTURE MOUNTING HEIGHT: 22'6" AFFGUARANTEE OF PERFORMANCE. ACTUAL LIGHT LEVELS MAYVARY.**Light Loss FactorSymbol Label Quantity Manufacturer Catalog Number Number Lamps DescriptionLumensPerLampWattageEXL-13 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 134.5EXL-1A17 Lithonia Lighting [...] 1 [...] 33580.49830.94Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 L901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left33580 415.47Lithonia Lighting DSX2 LED P14 50K80CRI BLC3 R901 D-Series Size 2 Area Luminaire P14Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right33580 415.47EXL-1B23 Lithonia Lighting [...] 1 [...] 4846.149101.8Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 L901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Left4846 50.9Lithonia Lighting DSX0 LED P10 50K80CRI BLC3 R901 D-Series Size 0 Area Luminaire P10Performance Package 5000K CCT 80CRI Type 3 Extreme Backlight ControlOptics Rotated 90 Degrees to Right4846 50.9EXL-250 Lithonia Lighting DSX2 LED P1 50K80CRI T5M1 D-Series Size 2 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 5 Medium18755 269EXL-42 Lithonia Lighting DSX1 LED P6 50K80CRI T3M1 D-Series Size 1 Area Luminaire P6Performance Package 5000K CCT 80CRI Type 3 Medium18938 165.25EXL-538 Lithonia Lighting DSX1 LED P1 50K80CRI T4M1 D-Series Size 1 Area Luminaire P1Performance Package 5000K CCT 80CRI Type 4 Medium7106 50.9**This document contains confidential and proprietary information of KSA Lighting & Controls. This document may only be used by or for the benefit of KSA Lighting & Controls representatives and customers. This lighting layout is not a professional engineering drawing and is provided for informational purposes only, without warranty as to accuracy, completeness, reliability or otherwise. KSA Lighting & Controlsis not responsible for specifying the light fixtures or illumination requirements for any specific project, nor is it responsible for meeting municipal or building code requirements. It is the obligation of the end-user to consult with a professional engineering advisor to determine whether this lighting layout meets the applicable project requirements for lighting system performance, safety, suitability and effectivenessfor use in a particular application. Field verification is recommended when calculations are based on end-user or customer-provided information. End-user environment and application (including, but not limited to, voltage variation and dirt accumulation) can cause actual field performance to differ from the calculated photometric performance represented in this lighting layout. In no event will KSA Lighting &Controls be responsible for any loss resulting from any use of this drawing.PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINENORTH002DRAWING SCALE3. TOP-OF-POLE BASE, 2'-6", TYP.ZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTZERO-DEGREETILTAS NOTED102 All-New D-Series Area Luminaires Customer Presentation January 2023 103 Confidentiality Statement The information in this presentation is confidential and proprietary, and may not be used, reproduced or distributed without the express written permission of Acuity Brands Lighting, Inc. 104 Area Portfolio Positioning Best in Class Specification Performance Renovation Discretionary Stock Specialty / Visual Comfort Specialty Pedestrian / Visual Comfort RSX Area Renovation Workhorse NEW D-Series Area Flagship Specification Best for New ConstructionESX1 Area Lowest Cost of Light Customer / Application TypePrice Eurotique Radean 105 D-Series Refresh •Flawless Aesthetic •Enhanced Features •Immaculate Photometry Fully Re-Engineered –Inside and Out! 106 •Maintains Family Appearance •Contoured Monolithic Housing •Clean Lines & Smooth Curves •Integrated Motion Sensor Flawless Aesthetics 107 108 NEW DSX1 with nLight AIR Legacy DSX1 with nLight AIR 109 •More Lumens & Improved Efficacy •More CCT and CRI choices •And much more…! Other Enhanced Features 110 D-Series Size 0 •4,400 –21,600 lumens •33W to 171W D-Series Size 1 •7,200 -35,000 lumens •51W to 277W D-Series Size 2 •18,400 -60,000 lumens •135W to 462W Lumen Range by Size 111 Power Package P1 P2 P3 P4 P5 P6 P7 Lumens (4000K, T3M)4,791 6,180 8,795 11,130 12,091 17,135 20,319 Watts 33W 45W 69W 93W 90W 137W 171W LPW 144 137 128 120 134 125 119 DLC v5.1 Premium DSX0 Performance •MORE LUMENS -New P7 package will provide 10% increase in max lumens vs. legacy DSX0 •LESS ENERGY -Or move down to new P6 package and save 29W vs. legacy DSX0 •DLC v5.1 premium (varies by CCT, CRI and optic type) 112 Power Package P1 P2 P3 P4 P5 P6 P7 P8 P9 Lumens (4000K, T3M)7,594 9,763 13,763 16,032 17,630 20,539 22,210 28,030 34,006 Watts 51W 68W 102W 124W 138W 165W 184W 216W 277W LPW 149 144 135 129 128 124 120 130 123 DLC v5.1 Premium DSX1 Performance •MORE LUMENS -New P9 package will provide 23% increase in max lumens vs. legacy DSX1 •LESS ENGERGY –Choose new P8 package and save 25W vs. legacy DSX1 at same light output •DLC v5.1 premium (varies by CCT, CRI and optic type) 113 Power Package P1 P2 P3 P4 P5 P6 P7 P8 Lumens (4000K, T3M)19,480 24,924 29,423 35,040 40,187 44,894 51,461 56,314 Watts 135W 179W 219W 273W 327W 342W 409W 462W LPW 145 139 134 129 123 131 126 122 DLC v5.1 Premium DSX2 Performance •MORE LUMENS -New P8 package will provide 14% increase in max lumens vs. legacy DSX2 •LESS ENERGY -Or move down to new P7 package and save 39W vs. legacy DSX2 •DLC v5.1 premium (varies by CCT, CRI and optic type) 114 Optics (15) New optics •Standard optics •Low G optics •Corner & backlight control optics New Silicone lens material •Not affected by temperature •Durable –will not crack •Stable –will not yellow Engineering Excellence •Specialized designs (undercuts) •More precise beam shaping •IP66 rated Features and Benefits 115 (8) Standard Optics •Improved forward and lateral distributions •Wider distributions allow greater pole spacing Optical Distributions T2M AFRT1ST3M T4M TFTM T5M T5W 116 CompetitorNew Lithonia D-Series DSX T3M 25ft MH Calc Grid: 180ft X 60ftCompetitive Comparison New Lithonia DSX T3M Competitor T3 25,000 Lumens 25,000 1.7 Avg fc 1.7 4.1 Max fc 5.7 0.5 Min fc 0.3 8.2 Max/Min 19 3.4 Avg/Min 5.7 Identical lumen output and Avg. fc 66% higher minimum fc Wasteful hot spot Dangerously low footcandle levels Poor uniformity Superior uniformity 117 To maintain 0.5 fc, the Competitor can only be spaced at 140’ while the new DSX T3M can reach 180’ spacing BENEFITS OF USING THE NEW DSX:•One pole/fixture combo eliminated every 720ft•Less trenching, wiring and concrete bases = huge cost savings•Energy reduced by ~20% Competitor 5 poles –only 140ft spacing on center New DSX T3M 4 poles -180ft spacing on center Scaled to 25,000 lumens 25ft MH Wider Pole Spacing = Fewer Poles Required 140’ 180’ 118 (3) Low-G Optics •Reduces high angle light minimizing BUG –“G rating” •Increased light levels within distribution •1 –2 G ratings below the similar distribution type from competitors T4LGT3LG T5LG Optical Distributions 119 (2) Backlight Control Optics •New BLC optics provide only 0.5% of total light behind pole •Maintain B0 up to 43,000 lumens •Shortest distance to zero foot-candles behind pole •Additional forward and lateral throw •Absolute BEST backlight control in the business! (2) Corner Control Optics •New corner optics help supplement hard to light areas with improved cutoff control and further corner reach towards center Optical Distributions BLC4BLC3 LCCO RCCO 120 New BLC3 / BLC4 Optics Close Up As viewed from front As viewed from rear 121 New BLC3 / BLC4 Optics “Black-out” technology•Reduces aperture brightness•Redirects light forward and lateral•Complete back light control Close Up As viewed from front As viewed from rear 122 With BLC BLC4 Standard T3M T3M Precise cutoff under pole and at boundary line Shortest distance to ZERO foot-candles behind pole Complete zonal backlight control BLC in Application 123 Qty (2) DSX with new BLC4 State-of-the-Art Backlight Control…In Application! Drone Shot from Above BLC4 BLC4 Optics with Industry-Leading Backlight Control Superior backlight control Optimized forward and lateral throw 124 Proprietary & Confidential New DSX with BLC4 Competitor DCompetitor B Competitor CCompetitor A Scaled to 20,000 lumens 20ft MH New DSX with BLC4 Competitor A Competitor B Competitor C Competitor D 125 More Shielding Solutions •For optimal results, choose the best optic specific to application •House side shield (HS) –factory or field installed •External glare shield (EGS) –field installed and reversable to face front or back Field Accessories to Address Glare and Other Light Trespass Challenges 126 More Mountings •Square and Round Pole Mounting •Wall Bracket •Mast Arm Adapter 127 Mountings –Standard Arm SPA & RPA Mounting Details for Standard Pole Mount SPA -Standard integral arm Fits min. 3.5” square poles SPA8N (adapter) For narrow square poles (min. 3”) RPA (adapter) Fits min. 3” round poles DSX Standard #8 Pole Drilling Fits pole drillings 2.41” to 3.16” on center Ships standard with sliding nut bracket New DSX use #8 drilling (standard template) 128 Ordering Information New Features: •New DSX requires CRI in the description •Expanded CCT’s and CRI’s 129 Ordering Information New Features: •Option PIR sensor has improved detection pattern and mounting height range •Bi-level dimming device is UVOLT and allows secondary control circuit to dim light engines •New coastal construction option for added corrosion protection •External glare shield is now reversible in the field (can be forward or backward facing) 130 •Site-wide controls solution •Motion sensing with dusk-to-dawn photocontrol •Ready at install with out-of-box default settings or •Commission with smartphone for grouping the site •nLight Eclypse is not needed unless scheduled dimming required nLight AIR™Controls 131 Access and Maintenance Access to mounting compartment is via splice cover door using a single screw It is not necessary to open the driver compartment when installing the new D- Series All doors are tethered All screws are captive 132 NEW DSX Refresh The Legacy Version Will Continue to be Available! Website –Different Product Pages for Each Series Legacy DSX LEGACY D-SERIES AREA SIZE 1 Legacy DSX1 LED Area Luminaire Legacy DSX (G1) •Available for coming six plus months •Availability for limited time during ramp down New DSX Refresh •Available now! 133 Product Information Available on D-Series Product Pages Proprietary & Confidential Imagery Standard Product Renderings 360°Product Renderings Application Images Collateral Brochure Product Web Pages Product Family Page Videos Feature & Benefit Installation Technical Data Specification Sheets Installation Instructions Presentations Customer Presentation 134 Video Links Reveal Video Installation Video Feature/Benefit Video Initial Reveal, Feature/Benefit and Installation Videos 135 Thank You 136 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 1 of 10 COMMERCIAL OUTDOOR Ordering Information EXAMPLE: DSX1 LED P7 40K 70CRI T3M MVOLT SPA NLTAIR2 PIRHN DDBXD DSX1 LED Series LEDs Color temperature 2 Color Rendering Index 2 Distribution Voltage Mounting DSX1 LED Forward optics P1 P6 P2 P7 P3 P8 P4 P9 P5 Rotated optics P10 1 P12 1 P11 1 P13 1 (this section 70CRI only) 30K 3000K 40K 4000K 50K 5000K (this section 80CRI only, extended lead times apply) 27K 2700K 30K 3000K 35K 3500K 40K 4000K 50K 5000K 70CRI 70CRI 70CRI 80CRI 80CRI 80CRI 80CRI 80CRI AFR Automotive front row T1S Type I short T2M Type II medium T3M Type III medium T3LG Type III low glare 3 T4M Type IV medium T4LG Type IV low glare 3 TFTM Forward throw medium T5M Type V medium T5LG Type V low glare T5W Type V wide BLC3 Type III backlight control 3 BLC4 Type IV backlight control 3 LCCO Left corner cutoff 3 RCCO Right corner cutoff 3 MVOLT (120V-277V) 4 HVOLT (347V-480V) 5,6 XVOLT (277V - 480V) 7,8 120 16, 26 208 16, 26 240 16, 26 277 16, 26 347 16, 26 480 16, 26 Shipped included SPA Square pole mounting (#8 drilling) RPA Round pole mounting (#8 drilling) SPA5 Square pole mounting #5 drilling 9 RPA5 Round pole mounting #5 drilling 9 SPA8N Square narrow pole mounting #8 drilling WBA Wall bracket 10 MA Mast arm adapter (mounts on 2 3/8" OD horizontal tenon) Control options Other options Finish (required) Shipped installed NLTAIR2 PIRHN nLight AIR gen 2 enabled with bi-level motion / ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc. 11, 12, 20, 21 PIR High/low, motion/ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc 13, 20, 21 PER NEMA twist-lock receptacle only (controls ordered separate) 14 PER5 Five-pin receptacle only (controls ordered separate)14, 21 PER7 Seven-pin receptacle only (controls ordered separate) 14, 21 FAO Field adjustable output 15, 21 BL30 Bi-level switched dimming, 30% 16, 21 BL50 Bi-level switched dimming, 50% 16, 21 DMG 0-10v dimming wires pulled outside fixture (for use with an external control, ordered separately) 17 DS Dual switching 18, 19, 21 Shipped installed SPD20KV 20KV surge protection HS Houseside shield (black finish standard) 22 L90 Left rotated optics 1 R90 Right rotated optics 1 CCE Coastal Construction 23 HA 50°C ambient operation 24 BAA Buy America(n) Act Compliant SF Single fuse (120, 277, 347V) 26 DF Double fuse (208, 240, 480V) 26 Shipped separately EGSR External Glare Shield (reversible, field install required, matches housing finish) BSDB Bird Spikes (field install required) DDBXD Dark Bronze DBLXD Black DNAXD Natural Aluminum DWHXD White DDBTXD Textured dark bronze DBLBXD Textured black DNATXD Textured natural aluminum DWHGXD Textured white D-Series Size 1LED Area Luminaire Catalog Number Notes Type Introduction The modern styling of the D-Series features a highly refined aesthetic that blends seamlessly with its environment. The D-Series offers the benefits of the latest in LED technology into a high performance, high efficacy, long-life luminaire. The photometric performance results in sites with excellent uniformity, greater pole spacing and lower power density. D-Series outstand- ing photometry aids in reducing the number of poles required in area lighting applications with typical energy savings of 65% and expected service life of over 100,000 hours. Hit the Tab key or mouse over the page to see all interactive elements. H2 L W H1 Specifications EPA:0.69 ft2 (0.06 m2) Length:32.71" (83.1 cm) Width:14.26"(36.2 cm) Height H1:7.88"(20.0 cm) Height H2:2.73"(6.9 cm) Weight:34 lbs(15.4 kg) 137 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 2 of 10 COMMERCIAL OUTDOOR Accessories Ordered and shipped separately. DLL127F 1.5 JU Photocell - SSL twist-lock (120-277V) 25 DLL347F 1.5 CUL JU Photocell - SSL twist-lock (347V) 25 DLL480F 1.5 CUL JU Photocell - SSL twist-lock (480V) 25 DSHORT SBK Shorting cap 25 DSX1HS P# House-side shield (enter package number 1-13 in place of #) DSXRPA (FINISH) Round pole adapter (#8 drilling, specify finish) DSXSPA5 (FINISH) Square pole adapter #5 drilling (specify finish) DSXRPA5 (FINISH) Round pole adapter #5 drilling (specify finish) DSX1EGSR (FINISH) External glare shield (specify finish) DSX1BSDB (FINISH) Bird spike deterrent bracket (specify finish) Shield Accessories External Glare Shield (EGSR) Tenon O.D. Mounting Single Unit 2 @ 180 2 @ 90 3 @ 90 3 @120 4 @ 90 2-3/8"RPA AS3-5 190 AS3-5 280 AS3-5 290 AS3-5 390 AS3-5 320 AS3-5 490 2-7/8"RPA AST25-190 AST25-280 AST25-290 AST25-390 AST25-320 AST25-490 4"RPA AST35-190 AST35-280 AST35-290 AST35-390 AST35-320 AST35-490 Tenon Mounting SlipfitterDrilling Top of Pole 0.563" 2.650" 1.325"0.400"(2 PLCS) Template #8 Ordering Information NOTES 1 Rotated optics available with packages P10, P11, P12 and P13. Must be combined with option L90 or R90.2 30K, 40K, and 50K available in 70CRI and 80CRI. 27K and 35K only available with 80CRI. Contact Technical Support for other possible combinations. 3 T3LG, T4LG, BLC3, BLC4, LCCO, RCCO not available with option HS.4 MVOLT driver operates on any line voltage from 120-277V (50/60 Hz). 5 HVOLT driver operates on any line voltage from 347-480V (50/60 Hz).6 HVOLT not available with package P1 and P10 when combined with option NLTAIR2 PIRHN or option PIR. 7 XVOLT operates with any voltage between 277V and 480V (50/60 Hz).8 XVOLT not available in packages P1 or P10. XVOLT not available with fusing (SF or DF). 9 SPA5 and RPA5 for use with #5 drilling only (Not for use with #8 drilling).10 WBA cannot be combined with Type 5 distributions plus photocell (PER). 11 NLTAIR2 and PIRHN must be ordered together. For more information on nLight AIR2 visit this link12 NLTAIR2 PIRHN not available with other controls including PIR, PER, PER5, PER7, FAO, BL30, BL50, DMG and DS. NLTAIR2 PIRHN not available with P1 and P10 using HVOLT. NLTAIR2 PIRHN not available with P1 and P10 using XVOLT. 13 PIR not available with NLTAIR2 PIRHN, PER, PER5, PER7, FAO BL30, BL50, DMG and DS. PIR not available with P1 and P10 using HVOLT. PIR not avail-able with P1 and P10 using XVOLT.14 PER/PER5/PER7 not available with NLTAIR2 PIRHN, PIR, BL30, BL50, FAO, DMG and DS. Photocell ordered and shipped as a separate line item from Acuity Brands Controls. See accessories. Shorting Cap included.15 FAO not available with other dimming control options NLTAIR2 PIRHN, PIR, PER5, PER7, BL30, BL50, DMG and DS. 16 BL30 and BL50 are not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, FAO, DMG and DS. BL30 or BL50 must specify 120, 277 or 347V. Consult tech support for 208, 240 or 480V. 17 DMG not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DS.18 DS not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DMG. 19 DS requires (2) separately switched circuits. DS provides 50/50 fixture operation via (2) different sets of leads using (2) drivers. DS only available with packages P8, P9, P10, P11, P12 and P13. 20 Reference Motion Sensor Default Settings table on page 4 to see functionality.21 Reference Controls Options table on page 4. 22 HS not available with T3LG, T4LG, BLC3, BLC4, LCCO and RCCO distribution. Also available as a separate accessory; see Accessories information.23 CCE option not available with option BS and EGSR. Contact Technical Support for availability. 24 Option HA not available with performance packages P4, P5, P7, P8, P9 and P13.25 Requires luminaire to be specified with PER, PER5 or PER7 option. See Controls Table on page 4. 26 Single fuse (SF) requires 120V, 277V, or 347V. Double fuse (DF) requires 208V, 240V or 480V. XVOLT not available with fusing (SF or DF). HANDHOLE ORIENTATION AHandhole B C D 1.75" for aluminum poles2.75" for other pole types Fixture Quantity & Mounting Configuration Single DM19 2 @ 180 DM28 2 @ 90 DM29 3 @ 90 DM39 3 @ 120 DM32 4 @ 90 DM49 Mounting Type DSX1 with SPA 0.69 1.38 1.23 1.54 ---1.58 DSX1 with SPA5, SPA8N 0.70 1.40 1.30 1.66 ---1.68 DSX1 with RPA, RPA5 0.70 1.40 1.30 1.66 1.60 1.68 DSX1 with MA 0.83 1.66 1.50 2.09 2.09 2.09 DSX1 Area Luminaire - EPA *Includes luminaire and integral mounting arm. Other tenons, arms, brackets or other accessories are not included in this EPA data. House Side Shield (HS) Minimum Acceptable Outside Pole Dimension SPA #8 3.5"3.5"3.5"3.5"3.5" RPA #8 3" 3" 3"3"3" 3" SPA5 #5 3" 3" 3"3"3" RPA5 #5 3" 3"3"3"3"3" SPA8N #8 3"3"3"3"3" Mounting Option Drilling Template Single 2 @ 180 2 @ 90 3 @ 90 3 @ 120 4 @ 90 Head Location Side B Side B & D Side B & C Side B, C & D Round Pole Only Side A, B, C & D Drill Nomenclature #8 DM19AS DM28AS DM29AS DM39AS DM32AS DM49AS 138 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 3 of 10 COMMERCIAL OUTDOOR To see complete photometric reports or download .ies files for this product, visit Lithonia Lighting’s homepage. Photometric Diagrams Isofootcandle plots for the DSX1 LED P9 40K 70CRI. Distances are in units of mounting height (25’). LEGEND 0.1 fc 0.5 fc 1.0 fc T1S T2M T3M 4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T3LG T4M TFTM T4LG T5M T5W T5LG AFR BLC3 BLC4 LCCO RCCO 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 139 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 4 of 10 COMMERCIAL OUTDOOR Performance Data Current (A) Performance Package LED Count Drive Current (mA)Wattage 120V 208V 240V 277V 347V 480V Forward Optics (Non-Rotated) P1 30 530 51 0.42 0.24 0.21 0.18 0.15 0.11 P2 30 700 68 0.56 0.33 0.28 0.24 0.20 0.14 P3 30 1050 104 0.85 0.49 0.43 0.37 0.29 0.21 P4 30 1250 125 1.03 0.60 0.52 0.45 0.36 0.26 P5 30 1400 142 1.15 0.66 0.58 0.50 0.40 0.29 P6 40 1250 167 1.38 0.79 0.69 0.60 0.48 0.34 P7 40 1400 188 1.54 0.89 0.77 0.67 0.53 0.38 P8 60 1100 216 1.80 1.04 0.90 0.78 0.62 0.45 P9 60 1400 279 2.31 1.33 1.15 1.00 0.80 0.58 Rotated Optics (Requires L90 or R90) P10 60 530 101 0.84 0.49 0.42 0.37 0.29 0.21 P11 60 700 135 1.12 0.65 0.56 0.49 0.39 0.28 P12 60 1050 206 1.72 0.99 0.86 0.74 0.59 0.43 P13 60 1400 279 2.30 1.33 1.15 1.00 0.79 0.57 Electrical Load Motion Sensor Default Settings Option Unoccupied Dimmed Level High Level (when occupied)Phototcell Operation Dwell Time Ramp-up Time Dimming Fade Rate PIR 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min NLTAIR2 PIRHN 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min Lumen Ambient Temperature (LAT) Multipliers Use these factors to determine relative lumen output for average ambient temperatures from 0-40°C (32-104°F). Ambient Lumen Multiplier 0°C 32°F 1.04 5°C 41°F 1.04 10°C 50°F 1.03 15°C 50°F 1.02 20°C 68°F 1.01 25°C 77°C 1.00 30°C 86°F 0.99 35°C 95°F 0.98 40°C 104°F 0.97 Projected LED Lumen Maintenance Data references the extrapolated performance projections for the platforms noted in a 25°C ambient, based on 10,000 hours of LED testing (tested per IESNA LM-80-08 and projected per IESNA TM-21-11). To calculate LLF, use the lumen maintenance factor that corresponds to the desired number of operating hours below. For other lumen maintenance values, contact factory. Operating Hours Lumen Maintenance Factor 0 1.00 25,000 0.95 50,000 0.90 100,000 0.81 Controls Options Nomenclature Description Functionality Primary control device Notes FAO Field adjustable output device installed inside the luminaire; wired to the driver dimming leads.Allows the luminaire to be manually dimmed, effectively trimming the light output.FAO device Cannot be used with other controls options that need the 0-10V leads DS (not available on DSX0)Drivers wired independently for 50/50 luminaire operation The luminaire is wired to two separate circuits, allowing for 50/50 operation.Independently wired drivers Requires two separately switched circuits. Consider nLight AIR as a more cost effective alternative. PER5 or PER7 Twist-lock photocell receptacle Compatible with standard twist-lock photocells for dusk to dawn operation, or advanced control nodes that provide 0-10V dimming signals. Twist-lock photocells such as DLL Elite or advanced control nodes such as ROAM.Pins 4 & 5 to dimming leads on driver, Pins 6 & 7 are capped inside luminaire. Cannot be used with other controls options that need the 0-10V leads. PIR Motion sensor with integral photocell. Sensor suitable for 8' to 40' mounting height.Luminaires dim when no occupancy is detected.Acuity Controls rSBG Cannot be used with other controls options that need the 0-10V leads. NLTAIR2 PIRHN nLight AIR enabled luminaire for motion sensing, photocell and wireless communication.Motion and ambient light sensing with group response. Scheduled dimming with motion sensor over-ride when wirelessly connected to the nLight Eclypse. nLight Air rSBG nLight AIR sensors can be programmed and commissioned from the ground using the ClAIRity Pro app. Cannot be used with other controls options that need the 0-10V leads. BL30 or BL50 Integrated bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output BLC device provides input to 0-10V dimming leads on all drivers providing either 100% or dimmed (30% or 50%) control by a secondary circuit BLC UVOLT1 BLC device is powered off the 0-10V dimming leads, thus can be used with any input voltage from 120 to 480V 70 CRI 80CRI 90CRI Lumen Multiplier Availability Lumen Multiplier Availability Lumen Multiplier Availability 5000K 102%Standard 92%Extended lead-time 71%(see note) 4000K 100%Standard 92%Extended lead-time 67%(see note) 3500K 100%(see note)90%Extended lead-time 63%(see note) 3000K 96%Standard 87%Extended lead-time 61%(see note) 2700K 94%(see note)85%Extended lead-time 57%(see note) LED Color Temperature / Color Rendering Multipliers Note: Some LED types are available as per special request. Contact Technical Support for more information.*Note: Calculated values are based on original performance package data. When calculating new values for given FAO position, use maximum published values by package listed on specification sheet (input watts and lumens by optic type). FAO Position % Wattage % Lumen Output 8 100%100% 7 93%95% 6 80%85% 5 66%73% 4 54%61% 3 41%49% 2 29%36% 1 15%20% FAO Dimming Settings 140 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 5 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P1 51W 30 530 T1S 7,776 1 0 2 153 8,104 1 0 2 159 8,262 1 0 2 162 T2M 7,203 1 0 3 142 7,507 2 0 3 147 7,653 2 0 3 150 T3M 7,287 1 0 3 143 7,594 1 0 3 149 7,742 1 0 3 152 T3LG 6,509 1 0 1 128 6,783 1 0 1 133 6,916 1 0 1 136 T4M 7,395 1 0 3 145 7,707 1 0 3 151 7,857 1 0 3 154 T4LG 6,726 1 0 1 132 7,010 1 0 1 138 7,146 1 0 1 140 TFTM 7,446 1 0 3 146 7,760 1 0 3 152 7,912 1 0 3 155 T5M 7,609 3 0 2 149 7,930 3 0 2 156 8,084 3 0 2 159 T5W 7,732 3 0 2 152 8,058 4 0 2 158 8,215 4 0 2 161 T5LG 7,631 3 0 1 150 7,953 3 0 1 156 8,108 3 0 1 159 BLC3 5,300 0 0 2 104 5,524 0 0 2 109 5,631 0 0 2 111 BLC4 5,474 0 0 3 108 5,705 0 0 3 112 5,816 0 0 3 114 RCCO 5,348 0 0 2 105 5,573 0 0 2 109 5,682 0 0 2 112 LCCO 5,348 0 0 2 105 5,573 0 0 2 109 5,682 0 0 2 112 AFR 7,776 1 0 2 153 8,104 1 0 2 159 8,262 1 0 2 162 P2 68W 30 700 T1S 9,997 1 0 2 147 10,418 1 0 2 154 10,621 1 0 2 157 T2M 9,260 2 0 3 137 9,651 2 0 3 142 9,839 2 0 3 145 T3M 9,368 2 0 3 138 9,763 2 0 3 144 9,953 2 0 3 147 T3LG 8,368 1 0 2 123 8,721 1 0 2 129 8,891 1 0 2 131 T4M 9,507 2 0 3 140 9,909 2 0 3 146 10,102 2 0 3 149 T4LG 8,647 1 0 2 128 9,012 1 0 2 133 9,187 1 0 2 136 TFTM 9,573 2 0 3 141 9,977 2 0 3 147 10,172 2 0 3 150 T5M 9,782 4 0 2 144 10,195 4 0 2 150 10,393 4 0 2 153 T5W 9,940 4 0 2 147 10,360 4 0 2 153 10,562 4 0 2 156 T5LG 9,810 3 0 1 145 10,224 3 0 1 151 10,423 3 0 1 154 BLC3 6,814 0 0 2 101 7,101 0 0 2 105 7,240 0 0 2 107 BLC4 7,038 0 0 3 104 7,334 0 0 3 108 7,477 0 0 3 110 RCCO 6,875 1 0 2 101 7,165 1 0 2 106 7,305 1 0 2 108 LCCO 6,875 1 0 2 101 7,165 1 0 2 106 7,305 1 0 2 108 AFR 9,997 1 0 2 147 10,418 1 0 2 154 10,621 1 0 2 157 P3 102W 30 1050 T1S 14,093 2 0 2 138 14,687 2 0 2 144 14,973 2 0 2 147 T2M 13,055 2 0 3 128 13,605 2 0 3 133 13,871 2 0 3 136 T3M 13,206 2 0 4 129 13,763 2 0 4 135 14,031 2 0 4 137 T3LG 11,797 2 0 2 115 12,294 2 0 2 120 12,534 2 0 2 123 T4M 13,403 2 0 4 131 13,968 2 0 4 137 14,241 2 0 4 139 T4LG 12,190 2 0 2 119 12,704 2 0 2 124 12,952 2 0 2 127 TFTM 13,496 2 0 4 132 14,065 2 0 4 138 14,339 2 0 4 140 T5M 13,790 4 0 2 135 14,371 4 0 2 141 14,652 4 0 2 143 T5W 14,013 4 0 3 137 14,605 4 0 3 143 14,889 4 0 3 146 T5LG 13,830 3 0 2 135 14,413 3 0 2 141 14,694 3 0 2 144 BLC3 9,606 0 0 2 94 10,011 0 0 2 98 10,206 0 0 2 100 BLC4 9,921 0 0 3 97 10,340 0 0 3 101 10,541 0 0 3 103 RCCO 9,692 1 0 2 95 10,101 1 0 2 99 10,298 1 0 2 101 LCCO 9,692 1 0 2 95 10,101 1 0 2 99 10,298 1 0 2 101 AFR 14,093 2 0 2 138 14,687 2 0 2 144 14,973 2 0 2 147 Lumen Output 141 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 6 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P4 124W 30 1250 T1S 16,416 2 0 3 132 17,109 2 0 3 138 17,442 2 0 3 141 T2M 15,207 3 0 4 123 15,849 3 0 4 128 16,158 3 0 4 130 T3M 15,383 2 0 4 124 16,032 2 0 4 129 16,345 2 0 4 132 T3LG 13,742 2 0 2 111 14,321 2 0 2 116 14,600 2 0 2 118 T4M 15,613 2 0 4 126 16,272 2 0 4 131 16,589 2 0 4 134 T4LG 14,200 2 0 2 115 14,799 2 0 2 119 15,087 2 0 2 122 TFTM 15,721 2 0 4 127 16,384 2 0 4 132 16,703 2 0 4 135 T5M 16,063 4 0 2 130 16,741 4 0 2 135 17,067 4 0 2 138 T5W 16,324 5 0 3 132 17,013 5 0 3 137 17,344 5 0 3 140 T5LG 16,110 3 0 2 130 16,790 4 0 2 135 17,117 4 0 2 138 BLC3 11,190 0 0 3 90 11,662 0 0 3 94 11,889 0 0 3 96 BLC4 11,557 0 0 3 93 12,044 0 0 3 97 12,279 0 0 4 99 RCCO 11,291 1 0 3 91 11,767 1 0 3 95 11,996 1 0 3 97 LCCO 11,291 1 0 3 91 11,767 1 0 3 95 11,996 1 0 3 97 AFR 16,416 2 0 3 132 17,109 2 0 3 138 17,442 2 0 3 141 P5 138W 30 1400 T1S 18,052 2 0 3 131 18,814 2 0 3 136 19,180 2 0 3 139 T2M 16,723 3 0 4 121 17,428 3 0 4 126 17,768 3 0 4 129 T3M 16,917 3 0 4 122 17,630 3 0 4 128 17,974 3 0 4 130 T3LG 15,111 2 0 2 109 15,749 2 0 2 114 16,055 2 0 2 116 T4M 17,169 3 0 5 124 17,893 3 0 5 130 18,242 3 0 5 132 T4LG 15,615 2 0 2 113 16,274 2 0 2 118 16,591 2 0 2 120 TFTM 17,288 2 0 4 125 18,017 2 0 5 130 18,368 3 0 5 133 T5M 17,664 5 0 3 128 18,410 5 0 3 133 18,768 5 0 3 136 T5W 17,951 5 0 3 130 18,708 5 0 3 135 19,073 5 0 3 138 T5LG 17,716 4 0 2 128 18,463 4 0 2 134 18,823 4 0 2 136 BLC3 12,305 0 0 3 89 12,824 0 0 3 93 13,074 0 0 3 95 BLC4 12,709 0 0 4 92 13,245 0 0 4 96 13,503 0 0 4 98 RCCO 12,416 1 0 3 90 12,940 1 0 3 94 13,192 1 0 3 95 LCCO 12,416 1 0 3 90 12,940 1 0 3 94 13,192 1 0 3 95 AFR 18,052 2 0 3 131 18,814 2 0 3 136 19,180 2 0 3 139 P6 165W 40 1250 T1S 21,031 2 0 3 127 21,918 2 0 3 133 22,345 2 0 3 135 T2M 19,482 3 0 4 118 20,303 3 0 4 123 20,699 3 0 4 125 T3M 19,708 3 0 5 119 20,539 3 0 5 124 20,939 3 0 5 127 T3LG 17,604 2 0 2 107 18,347 2 0 2 111 18,704 2 0 2 113 T4M 20,001 3 0 5 121 20,845 3 0 5 126 21,251 3 0 5 129 T4LG 18,191 2 0 2 110 18,959 2 0 2 115 19,328 2 0 2 117 TFTM 20,140 3 0 5 122 20,989 3 0 5 127 21,398 3 0 5 129 T5M 20,579 5 0 3 125 21,447 5 0 3 130 21,865 5 0 3 132 T5W 20,912 5 0 3 127 21,795 5 0 3 132 22,219 5 0 3 134 T5LG 20,638 4 0 2 125 21,509 4 0 2 130 21,928 4 0 2 133 BLC3 14,335 0 0 3 87 14,940 0 0 3 90 15,231 0 0 3 92 BLC4 14,805 0 0 4 90 15,430 0 0 4 93 15,731 0 0 4 95 RCCO 14,464 1 0 3 88 15,074 1 0 3 91 15,368 1 0 3 93 LCCO 14,464 1 0 3 88 15,074 1 0 3 91 15,368 1 0 3 93 AFR 21,031 2 0 3 127 21,918 2 0 3 133 22,345 2 0 3 135 Lumen Output 142 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 7 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P7 184W 40 1400 T1S 22,741 2 0 3 123 23,700 2 0 3 129 24,162 3 0 3 131 T2M 21,066 3 0 4 114 21,955 3 0 4 119 22,383 3 0 4 121 T3M 21,311 3 0 5 116 22,210 3 0 5 120 22,642 3 0 5 123 T3LG 19,036 2 0 2 103 19,839 2 0 3 108 20,226 2 0 3 110 T4M 21,628 3 0 5 117 22,541 3 0 5 122 22,980 3 0 5 125 T4LG 19,671 2 0 2 107 20,501 2 0 3 111 20,900 2 0 3 113 TFTM 21,778 3 0 5 118 22,697 3 0 5 123 23,139 3 0 5 125 T5M 22,252 5 0 3 121 23,191 5 0 3 126 23,643 5 0 3 128 T5W 22,613 5 0 3 123 23,567 5 0 4 128 24,027 5 0 4 130 T5LG 22,317 4 0 2 121 23,258 4 0 2 126 23,712 4 0 2 129 BLC3 15,501 0 0 3 84 16,155 0 0 4 88 16,470 0 0 4 89 BLC4 16,010 0 0 4 87 16,685 0 0 4 90 17,010 0 0 4 92 RCCO 15,641 1 0 3 85 16,301 1 0 3 89 16,619 1 0 3 90 LCCO 15,641 1 0 3 85 16,301 1 0 3 89 16,619 1 0 3 90 AFR 22,741 2 0 3 123 23,700 2 0 3 129 24,162 3 0 3 131 P8 216W 60 1100 T1S 28,701 3 0 3 133 29,912 3 0 4 139 30,495 3 0 4 141 T2M 26,587 3 0 5 123 27,709 3 0 5 128 28,249 3 0 5 131 T3M 26,895 3 0 5 125 28,030 3 0 5 130 28,576 3 0 5 132 T3LG 24,025 3 0 3 111 25,038 3 0 3 116 25,526 3 0 3 118 T4M 27,296 3 0 5 127 28,448 3 0 5 132 29,002 3 0 5 134 T4LG 24,826 3 0 3 115 25,873 3 0 3 120 26,378 3 0 3 122 TFTM 27,485 3 0 5 127 28,645 3 0 5 133 29,203 3 0 5 135 T5M 28,084 5 0 4 130 29,269 5 0 4 136 29,839 5 0 4 138 T5W 28,539 5 0 4 132 29,743 5 0 4 138 30,323 5 0 4 141 T5LG 28,165 4 0 2 131 29,354 4 0 2 136 29,926 4 0 2 139 BLC3 19,563 0 0 4 91 20,388 0 0 4 94 20,786 0 0 4 96 BLC4 20,205 0 0 5 94 21,057 0 0 5 98 21,468 0 0 5 99 RCCO 19,740 1 0 4 91 20,572 1 0 4 95 20,973 1 0 4 97 LCCO 19,740 1 0 4 91 20,572 1 0 4 95 20,973 1 0 4 97 AFR 28,701 3 0 3 133 29,912 3 0 4 139 30,495 3 0 4 141 P9 277W 60 1400 T1S 34,819 3 0 4 126 36,288 3 0 4 131 36,996 3 0 4 134 T2M 32,255 3 0 5 116 33,616 3 0 5 121 34,271 3 0 5 124 T3M 32,629 3 0 5 118 34,006 3 0 5 123 34,668 3 0 5 125 T3LG 29,146 3 0 3 105 30,376 3 0 4 110 30,968 3 0 4 112 T4M 33,116 3 0 5 120 34,513 3 0 5 125 35,185 3 0 5 127 T4LG 30,119 3 0 3 109 31,389 3 0 4 113 32,001 3 0 4 116 TFTM 33,345 3 0 5 120 34,751 3 0 5 125 35,429 3 0 5 128 T5M 34,071 5 0 4 123 35,509 5 0 4 128 36,201 5 0 4 131 T5W 34,624 5 0 4 125 36,084 5 0 4 130 36,788 5 0 4 133 T5LG 34,170 5 0 3 123 35,612 5 0 3 129 36,306 5 0 3 131 BLC3 23,734 0 0 4 86 24,735 0 0 4 89 25,217 0 0 4 91 BLC4 24,513 0 0 5 88 25,547 0 0 5 92 26,045 0 0 5 94 RCCO 23,948 1 0 4 86 24,958 1 0 4 90 25,445 1 0 4 92 LCCO 23,948 1 0 4 86 24,958 1 0 4 90 25,445 1 0 4 92 AFR 34,819 3 0 4 126 36,288 3 0 4 131 36,996 3 0 4 134 Lumen Output 143 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 8 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P10 101W 60 530 T1S 15,164 3 0 3 150 15,803 3 0 3 156 16,112 3 0 3 159 T2M 14,047 4 0 4 139 14,640 4 0 4 145 14,925 4 0 4 147 T3M 14,208 4 0 4 140 14,807 4 0 4 146 15,096 4 0 4 149 T3LG 12,693 3 0 3 125 13,229 3 0 3 131 13,487 3 0 3 133 T4M 14,420 4 0 4 142 15,028 4 0 4 148 15,321 4 0 4 151 T4LG 13,115 3 0 3 129 13,668 3 0 3 135 13,934 3 0 3 138 TFTM 14,522 4 0 4 143 15,134 4 0 4 149 15,429 4 0 4 152 T5M 14,836 4 0 2 146 15,462 4 0 2 153 15,763 4 0 2 156 T5W 15,076 4 0 3 149 15,712 5 0 3 155 16,019 5 0 3 158 T5LG 14,879 3 0 2 147 15,507 3 0 2 153 15,809 3 0 2 156 BLC3 10,335 3 0 3 102 10,771 4 0 4 106 10,981 4 0 4 108 BLC4 10,674 4 0 4 105 11,124 4 0 4 110 11,341 4 0 4 112 RCCO 10,429 1 0 2 103 10,869 1 0 2 107 11,080 1 0 2 109 LCCO 10,429 1 0 2 103 10,869 1 0 2 107 11,080 1 0 2 109 AFR 15,164 3 0 3 150 15,803 3 0 3 156 16,112 3 0 3 159 P11 135W 60 700 T1S 19,437 4 0 4 144 20,257 4 0 4 150 20,651 4 0 4 153 T2M 18,005 4 0 4 133 18,765 4 0 4 139 19,131 4 0 4 142 T3M 18,211 4 0 4 135 18,980 4 0 4 141 19,350 4 0 4 143 T3LG 16,270 3 0 3 121 16,957 3 0 3 126 17,287 4 0 4 128 T4M 18,483 4 0 4 137 19,263 5 0 5 143 19,638 5 0 5 146 T4LG 16,810 3 0 3 125 17,519 3 0 3 130 17,861 3 0 3 132 TFTM 18,614 4 0 4 138 19,399 4 0 4 144 19,777 5 0 5 147 T5M 19,017 5 0 3 141 19,819 5 0 3 147 20,205 5 0 3 150 T5W 19,325 5 0 3 143 20,140 5 0 3 149 20,533 5 0 3 152 T5LG 19,072 4 0 2 141 19,876 4 0 2 147 20,264 4 0 2 150 BLC3 13,247 4 0 4 98 13,806 4 0 4 102 14,075 4 0 4 104 BLC4 13,682 4 0 4 101 14,259 4 0 4 106 14,537 4 0 4 108 RCCO 13,367 1 0 3 99 13,931 1 0 3 103 14,203 1 0 3 105 LCCO 13,367 1 0 3 99 13,931 1 0 3 103 14,203 1 0 3 105 AFR 19,437 4 0 4 144 20,257 4 0 4 150 20,651 4 0 4 153 P12 206W 60 1050 T1S 27,457 4 0 4 133 28,616 4 0 4 139 29,174 4 0 4 142 T2M 25,436 5 0 5 124 26,509 5 0 5 129 27,025 5 0 5 131 T3M 25,727 5 0 5 125 26,812 5 0 5 130 27,335 5 0 5 133 T3LG 22,984 4 0 4 112 23,954 4 0 4 116 24,421 4 0 4 119 T4M 26,110 5 0 5 127 27,212 5 0 5 132 27,742 5 0 5 135 T4LG 23,747 4 0 4 115 24,749 4 0 4 120 25,231 4 0 4 123 TFTM 26,295 5 0 5 128 27,404 5 0 5 133 27,938 5 0 5 136 T5M 26,864 5 0 4 130 27,997 5 0 4 136 28,543 5 0 4 139 T5W 27,299 5 0 4 133 28,451 5 0 4 138 29,006 5 0 4 141 T5LG 26,942 4 0 2 131 28,078 4 0 2 136 28,626 4 0 2 139 BLC3 18,714 4 0 4 91 19,504 4 0 4 95 19,884 4 0 4 97 BLC4 19,327 5 0 5 94 20,143 5 0 5 98 20,535 5 0 5 100 RCCO 18,883 1 0 4 92 19,680 1 0 4 96 20,064 1 0 4 97 LCCO 18,883 1 0 4 92 19,680 1 0 4 96 20,064 1 0 4 97 AFR 27,457 4 0 4 133 28,616 4 0 4 139 29,174 4 0 4 142 P13 276W 60 1400 T1S 34,436 5 0 5 125 35,889 5 0 5 130 36,588 5 0 5 133 T2M 31,900 5 0 5 116 33,246 5 0 5 121 33,894 5 0 5 123 T3M 32,265 5 0 5 117 33,626 5 0 5 122 34,282 5 0 5 124 T3LG 28,826 4 0 4 105 30,042 4 0 4 109 30,628 4 0 4 111 T4M 32,746 5 0 5 119 34,128 5 0 5 124 34,793 5 0 5 126 T4LG 29,782 4 0 4 108 31,039 4 0 4 113 31,644 5 0 4 115 TFTM 32,978 5 0 5 120 34,369 5 0 5 125 35,039 5 0 5 127 T5M 33,692 5 0 4 122 35,113 5 0 4 127 35,797 5 0 4 130 T5W 34,238 5 0 4 124 35,682 5 0 4 129 36,378 5 0 4 132 T5LG 33,789 5 0 3 122 35,215 5 0 3 128 35,901 5 0 3 130 BLC3 23,471 5 0 5 85 24,461 5 0 5 89 24,937 5 0 5 90 BLC4 24,240 5 0 5 88 25,262 5 0 5 92 25,755 5 0 5 93 RCCO 23,683 1 0 4 86 24,682 1 0 4 89 25,163 1 0 4 91 LCCO 23,683 1 0 4 86 24,682 1 0 4 89 25,163 1 0 4 91 AFR 34,436 5 0 5 125 35,889 5 0 5 130 36,588 5 0 5 133 Lumen Output 144 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 9 of 10 COMMERCIAL OUTDOOR 2.73" 34.23" 14.26" 8.21" 2.73" 34.53" 14.26" 8.90" 2.73" 38.71" 14.26" 7.88" Dimensions DSX1 with RPA, RPA5, SPA5, SPA8N mount Weight: 36 lbs DSX1 with WBA mount Weight: 38 lbs DSX1 with MA mount Weight: 39 lbs 2.41" 3.16" SPA (STANDARD ARM) 2.41"3.16" RPA 2.41" 3.16" SPA8N 4.25" RPA5 4.25" SPA5 145 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX1-LED Rev. 09/05/23 Page 10 of 10 COMMERCIAL OUTDOOR nLight Control - Sensor Coverage and Settings nLight Sensor Coverage Pattern NLTAIR2 PIRHN Top Side FEATURES & SPECIFICATIONS INTENDED USE The sleek design of the D-Series Size 1 reflects the embedded high performance LED technology. It is ideal for many commercial and municipal applications, such as parking lots, plazas, campuses, and streetscapes. CONSTRUCTION Single-piece die-cast aluminum housing has integral heat sink fins to optimize thermal management through conductive and convective cooling. Modular design allows for ease of maintenance and future light engine upgrades. The LED drivers are mounted in direct contact with the casting to promote low operating temperature and long life. Housing driver compartment is completely sealed against moisture and environmental contaminants (IP66). Vibration rated per ANSI C136.31 for 3G for SPA and MA. 1.5G for mountings RPA, RPA5, SPA5 and SPA8N. Low EPA (0.69 ft2) for optimized pole wind loading. FINISH Exterior parts are protected by a zinc-infused Super Durable TGIC thermoset powder coat finish that provides superior resistance to corrosion and weather- ing. A tightly controlled multi-stage process ensures a minimum 3 mils thickness for a finish that can withstand extreme climate changes without cracking or peel- ing. Available in both textured and non-textured finishes. Coastal Construction (CCE) Optional corrosion resistant construction is engineered with added corrosion protection in materials and/or pre-treatment of base material under super durable paint. Provides additional corrosion protection for applications near coastal areas. Finish is salt spray tested to over 5,000 hours per ASTM B117 with scribe rating of 10. Additional lead-times may apply. OPTICS Precision-molded proprietary silicone lenses are engineered for superior area lighting distribution, uniformity, and pole spacing. Light engines are available in standard 3000 K, 4000 K and 5000 K (70 CRI) configurations. 80CRI configura- tions are also available. The D-Series Size 1 has zero uplight and qualifies as a Nighttime Friendly™ product, meaning it is consistent with the LEED® and Green Globes™ criteria for eliminating wasteful uplight. ELECTRICAL Light engine configurations consist of high-efficacy LEDs mounted to metal- core circuit boards to maximize heat dissipation and promote long life (up to L81/100,000 hours at 25°C). Class 1 electronic drivers are designed to have a power factor >90%, THD <20%, and an expected life of 100,000 hours with <1% failure rate. Easily serviceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). STANDARD CONTROLS The DSX1 LED area luminaire has a number of control options. DSX Size 1, comes standard with 0-10V dimming drivers. Dusk to dawn controls can be utilized via optional NEMA twist-lock photocell receptacles. Integrated motion sensor with on-board photocells feature field-adjustable programing and are suitable for mounting heights up to 40 feet. Control option BL features a bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output. nLIGHT AIR CONTROLS The DSX1 LED area luminaire is also available with nLight® AIR for the ultimate in wireless control. This powerful controls platform provides out-of-the-box basic motion sensing and photocontrol functionality and is suitable for mounting heights up to 40 feet. Once commissioned using a smartphone and the easy-to- use CLAIRITY app, nLight AIR equipped luminaries can be grouped, resulting in motion sensor and photocell group response without the need for additional equipment. Scheduled dimming with motion sensor over-ride can be achieved when used with the nLight Eclypse. Additional information about nLight Air can be found here. INSTALLATION Integral mounting arm allows for fast mounting using Lithonia standard #8 drill- ing and accommodates pole drilling's from 2.41 to 3.12" on center. The standard “SPA” option for square poles and the “RPA” option for round poles use the #8 drilling. For #5 pole drillings, use SPA5 or RPA5. Additional mountings are available including a wall bracket (WBA) and mast arm (MA) option that allows luminaire attachment to a 2 3/8” horizontal mast arm. LISTINGS UL listed to meet U.S. and Canadian standards. UL Listed for wet locations. Light engines are IP66 rated; luminaire is IP66 rated. Rated for -40°C minimum ambient. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/ QPL to confirm which versions are qualified. International Dark-Sky Association (IDA) Fixture Seal of Approval (FSA) is available for all products on this page utilizing 3000K color temperature only. BUY AMERICAN ACT Product with the BAA option is assembled in the USA and meets the Buy America(n) government procurement requirements under FAR, DFARS and DOT regulations. Please refer to www.acuitybrands.com/buy-american for additional information. WARRANTY 5-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. 146 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 1 of 10 COMMERCIAL OUTDOOR D-Series Size 2 LED Area Luminaire Specifications Catalog Number Notes Type Introduction The modern styling of the D-Series features a highly refined aesthetic that blends seamlessly with its environment. The D-Series offers the benefits of the latest in LED technology into a high performance, high efficacy, long-life luminaire. The outstanding photometric performance results in sites with excellent uniformity, greater pole spacing and lower power density. D-Series outstanding photometry aids in reducing the number of poles required in area lighting applications with typical energy savings of up to 80% vs. 1000W HID and expected service life of over 100,000 hours. EPA:1.06 ft2 (0.10 m2) Length:40.59"(103.1 cm) Width:16.76"(42.6 cm) Height H1:8.11"(20.6 cm) Height H2:3.96"(10.1 cm) Weight: 46 lbs (20.9 kg) Hit the Tab key or mouse over the page to see all interactive elements. Ordering Information EXAMPLE: DSX2 LED P7 40K 70CRI T3M MVOLT SPA NLTAIR2 PIRHN DDBXD DSX2 LED Series LEDs Color temperature 2 Color Rendering Index 2 Distribution Voltage Mounting DSX2 LED Forward optics P1 P5 P2 P6 P3 P7 P4 P8 Rotated optics P10 1 P13 1 P11 1 P14 1 P12 1 (this section 70CRI only) 30K 3000K 40K 4000K 50K 5000K (this section 80CRI only, extended lead times apply) 27K 2700K 30K 3000K 35K 3500K 40K 4000K 50K 5000K 70CRI 70CRI 70CRI 80CRI 80CRI 80CRI 80CRI 80CRI AFR Automotive front row T1S Type I short T2M Type II medium T3M Type III medium T3LG Type III low glare 3 T4M Type IV medium T4LG Type IV low glare 3 TFTM Forward throw medium T5M Type V medium T5LG Type V low glare T5W Type V wide BLC3 Type III backlight control 3 BLC4 Type IV backlight control 3 LCCO Left corner cutoff 3 RCCO Right corner cutoff 3 MVOLT (120V-277V) 4 HVOLT (347V-480V) 5,6 XVOLT (277V - 480V) 7,8 120 16, 26 208 16, 26 240 16, 26 277 16, 26 347 16, 26 480 16, 26 Shipped included SPA Square pole mounting (#8 drilling) RPA Round pole mounting (#8 drilling) SPA5 Square pole mounting #5 drilling 9 RPA5 Round pole mounting #5 drilling 9 SPA8N Square narrow pole mounting #8 drilling WBA Wall bracket 10 MA Mast arm adapter (mounts on 2 3/8" OD horizontal tenon) Control options Other options Finish (required) Shipped installed NLTAIR2 PIRHN nLight AIR gen 2 enabled with bi-level motion / ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc. 11, 12, 20, 21 PIR High/low, motion/ambient sensor, 8-40’ mounting height, ambient sensor enabled at 2fc 13, 20, 21 PER NEMA twist-lock receptacle only (controls ordered separate) 14 PER5 Five-pin receptacle only (controls ordered separate) 14, 21 PER7 Seven-pin receptacle only (controls ordered separate) 14, 21 FAO Field adjustable output 15, 21 BL30 Bi-level switched dimming, 30% 16, 21 BL50 Bi-level switched dimming, 50% 16, 21 DMG 0-10v dimming wires pulled outside fixture (for use with an external control, ordered separately) 17 DS Dual switching 18, 19, 21 Shipped installed SPD20KV 20KV surge protection HS Houseside shield (black finish standard) 22 L90 Left rotated optics 1 R90 Right rotated optics 1 CCE Coastal Construction 23 HA 50°C ambient operation 24 BAA Buy America(n) Act Compliant SF Single fuse (120, 277, 347V) 26 DF Double fuse (208, 240, 480V) 26 3G Vibration rated for 3G 27 Shipped separately EGSR External Glare Shield (reversible, field install required, matches housing finish) BSDB Bird Spikes (field install required) DDBXD Dark Bronze DBLXD Black DNAXD Natural Aluminum DWHXD White DDBTXD Textured dark bronze DBLBXD Textured black DNATXD Textured natural aluminum DWHGXD Textured white L H2 H1 W Items marked by a shaded background qualify for the Design Select program and ship in 15 days or less. To learn more about Design Select, visit www.acuitybrands.com/designselect. *See ordering tree for detailsDesign Select options indicated by this color background. L H2 H1 W 147 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 2 of 10 COMMERCIAL OUTDOOR Drilling Top of Pole 0.563" 2.650" 1.325"0.400"(2 PLCS) Template #8 Tenon O.D. Mounting Single Unit 2 @ 180 2 @ 90 3 @ 90 3 @120 4 @ 90 2-3/8"RPA AS3-5 190 AS3-5 280 AS3-5 290 AS3-5 390 AS3-5 320 AS3-5 490 2-7/8"RPA AST25-190 AST25-280 AST25-290 AST25-390 AST25-320 AST25-490 4"RPA AST35-190 AST35-280 AST35-290 AST35-390 AST35-320 AST35-490 Tenon Mounting Slipfitter Ordering Information NOTES 1 Rotated optics available with packages P10, P11, P12, P13 and P14. Must be combined with option L90 or R90. 2 30K, 40K, and 50K available in 70CRI and 80CRI. 27K and 35K only available with 80CRI. Contact Technical Support for other possible combinations. 3 T3LG, T4LG, BLC3, BLC4, LCCO, RCCO not available with option HS. 4 MVOLT driver operates on any line voltage from 120-277V (50/60 Hz). 5 HVOLT driver operates on any line voltage from 347-480V (50/60 Hz). 6 HVOLT not available with package P10 when combined with option NLTAIR2 PIRHN or option PIR. 7 XVOLT operates with any voltage between 277V and 480V (50/60 Hz). 8 XVOLT not available in package P10. XVOLT not available with fusing (SF or DF). 9 SPA5 and RPA5 for use with #5 drilling only (Not for use with #8 drilling). 10 WBA cannot be combined with Type 5 distributions plus photocell (PER). 11 NLTAIR2 and PIRHN must be ordered together. For more information on nLight AIR2 visit this link 12 NLTAIR2 PIRHN not available with other controls including PIR, PER, PER5, PER7, FAO, BL30, BL50, DMG and DS. NLTAIR2 PIRHN not available with P10 using HVOLT. NLTAIR2 PIRHN not available with P10 using XVOLT. 13 PIR not available with NLTAIR2 PIRHN, PER, PER5, PER7, FAO BL30, BL50, DMG and DS. PIR not available with P10 using HVOLT. PIR not available with P10 using XVOLT. 14 14) PER/PER5/PER7 not available with NLTAIR2 PIRHN, PIR, BL30, BL50, FAO, DMG and DS. Photocell ordered and shipped as a separate line item from Acuity Brands Controls. See accessories. Shorting Cap included. 15 FAO not available with other dimming control options NLTAIR2 PIRHN, PIR, PER5, PER7, BL30, BL50, DMG and DS. 16 BL30 and BL50 are not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, FAO, DMG and DS. BL30 or BL50 must specify 120, 277 or 347V. Consult tech support for 208, 240 or 480V. 17 DMG not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DS. 18 DS not available with NLTAIR2 PIRHN, PIR, PER, PER5, PER7, BL30, BL50, FAO and DMG. 19 DS requires (2) separately switched circuits. DS provides 50/50 fixture operation via (2) different sets of leads on P1, P2, P3, P4, P5 (2 drivers). Note: Provides 60/40 operation using (2) different sets of leads on P6, P7, P8, P9, P10, P11, P12, P13, P14 (3 drivers). 20 Reference Motion Sensor Default Settings table on page 4 to see functionality. 21 Reference Controls Options table on page 4. 22 HS not available with T3LG, T4LG, BLC3, BLC4, LCCO and RCCO distribution. Also available as a separate accessory; see Accessories information. 23 CCE option not available with option BS and EGSR. Contact Technical Support for availability. 24 Option HA not available with performance packages P5, P6, P7, P8, P13 and P14. 25 Requires luminaire to be specified with PER, PER5 or PER7 option. See Controls Table on page 4. 26 Single fuse (SF) requires 120V, 277V, or 347V. Double fuse (DF) requires 208V, 240V or 480V. XVOLT not available with fusing (SF or DF). 27 Option 3G for use with (MA) mast arm mount only when 3G vibration is required. HANDHOLE ORIENTATION AHandhole B C D Fixture Quantity & Mounting Configuration Single DM19 2 @ 180 DM28 2 @ 90 DM29 3 @ 90 DM39 3 @ 120 DM32 4 @ 90 DM49 Mounting Type DSX2 with SPA 1.06 2.12 1.84 2.32 ---2.33 DSX2 with SPA5, SPA8N 1.07 2.14 1.90 2.43 ---2.44 DSX2 with RPA, RPA5 1.07 2.14 1.90 2.43 2.31 2.44 DSX2 with MA 1.20 2.40 2.12 3.00 2.92 3.00 DSX2 Area Luminaire - EPA *Includes luminaire and integral mounting arm. Other tenons, arms, brackets or other accessories are not included in this EPA data. Accessories Ordered and shipped separately. DLL127F 1.5 JU Photocell - SSL twist-lock (120-277V) 25 DLL347F 1.5 CUL JU Photocell - SSL twist-lock (347V) 25 DLL480F 1.5 CUL JU Photocell - SSL twist-lock (480V) 25 DSHORT SBK Shorting cap 25 DSX2HS P# House-side shield (enter package number 1-13 in place of #) DSXRPA (FINISH) Round pole adapter (#8 drilling, specify finish) DSXSPA5 (FINISH) Square pole adapter #5 drilling (specify finish) DSXRPA5 (FINISH) Round pole adapter #5 drilling (specify finish) DSX1EGSR (FINISH) External glare shield (specify finish) DSX2BSDB (FINISH) Bird spike deterrent bracket (specify finish) Shield Accessories External Glare Shield (EGSR)House Side Shield (HS) Minimum Acceptable Outside Pole Dimension SPA #8 3.5"3.5"3.5"3.5"3.5" RPA #8 3" 3" 3"3"3" 3" SPA5 #5 3" 3" 3"3"3" RPA5 #5 3" 3"3"3"3"3" SPA8N #8 3"3"3"3"3" Mounting Option Drilling Template Single 2 @ 180 2 @ 90 3 @ 90 3 @ 120 4 @ 90 Head Location Side B Side B & D Side B & C Side B, C & D Round Pole Only Side A, B, C & D Drill Nomenclature #8 DM19AS DM28AS DM29AS DM39AS DM32AS DM49AS 148 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 3 of 10 COMMERCIAL OUTDOOR To see complete photometric reports or download .ies files for this product, visit Lithonia Lighting’s homepage. Photometric Diagrams Isofootcandle plots for the DSX2 LED P8 40K 70CRI. Distances are in units of mounting height (40’). LEGEND 0.1 fc 0.5 fc 1.0 fc T1S T2M T3M 4 3 2 1 0 -4 -3 -2 -1 4 3 2 1 0 4321 T3LG T4M TFTM T4LG T5M T5W T5LG AFR BLC3 BLC4 LCCO RCCO 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 4 3 2 1 0 432165 65 4 3 2 1 0 -4 -3 -2 -1 5 6 -5 -6 149 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 4 of 10 COMMERCIAL OUTDOOR Performance Data Use these factors to determine relative lumen output for average ambient temperatures from 0-40°C (32-104°F). Lumen Ambient Temperature (LAT) Multipliers Ambient Lumen Multiplier 0°C 32°F 1.04 5°C 41°F 1.03 10°C 50°F 1.03 15°C 50°F 1.02 20°C 68°F 1.01 25°C 77°F 1.00 30°C 86°F 0.99 35°C 95°F 0.98 40°C 104°F 0.97 Current (A) Performance Package LED Count Drive Current (mA)Wattage 120V 208V 240V 277V 347V 480V Forward Optics (Non-Rotated) P1 80 530 135 1.12 0.65 0.56 0.49 0.39 0.28 P2 80 700 181 1.49 0.86 0.75 0.65 0.52 0.37 P3 80 850 222 1.83 1.05 0.91 0.79 0.63 0.46 P4 80 1050 277 2.27 1.31 1.14 0.98 0.79 0.57 P5 80 1250 333 2.72 1.57 1.36 1.18 0.94 0.68 P6 100 1050 345 2.85 1.64 1.42 1.23 0.98 0.71 P7 100 1250 414 3.41 1.97 1.70 1.48 1.18 0.85 P8 100 1400 466 3.85 2.22 1.93 1.67 1.33 0.96 Rotated Optics (Requires L90 or R90) P10 90 530 152 1.27 0.73 0.63 0.55 0.44 0.32 P11 90 700 203 1.69 0.97 0.84 0.73 0.58 0.42 P12 90 850 249 2.06 1.19 1.03 0.89 0.71 0.52 P13 90 1200 358 2.95 1.70 1.47 1.28 1.02 0.74 P14 90 1400 421 3.46 2.00 1.73 1.50 1.20 0.87 Electrical Load Motion Sensor Default Settings Option Unoccupied Dimmed Level High Level (when occupied)Phototcell Operation Dwell Time Ramp-up Time Dimming Fade Rate PIR 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min PIRHN 30%100%Enabled @ 2FC 7.5 min 3 sec 5 min Controls Options Nomenclature Description Functionality Primary control device Notes FAO Field adjustable output device installed inside the luminaire; wired to the driver dimming leads.Allows the luminaire to be manually dimmed, effectively trimming the light output.FAO device Cannot be used with other controls options that need the 0-10V leads DS (not available on DSX0)Drivers wired independently for 50/50 luminaire operation The luminaire is wired to two separate circuits, allowing for 50/50 operation.Independently wired drivers Requires two separately switched circuits. Consider nLight AIR as a more cost effective alternative. PER5 or PER7 Twist-lock photocell receptacle Compatible with standard twist-lock photocells for dusk to dawn operation, or advanced control nodes that provide 0-10V dimming signals. Twist-lock photocells such as DLL Elite or advanced control nodes such as ROAM.Pins 4 & 5 to dimming leads on driver, Pins 6 & 7 are capped inside luminaire. Cannot be used with other controls options that need the 0-10V leads. PIR Motion sensor with integral photocell. Sensor suitable for 8’ to 40’ mounting height.Luminaires dim when no occupancy is detected.Acuity Controls rSBG Cannot be used with other controls options that need the 0-10V leads. NLTAIR2 PIRHN nLight AIR enabled luminaire for motion sensing, photocell and wireless communication.Motion and ambient light sensing with group response. Scheduled dimming with motion sensor over-ride when wirelessly connected to the nLight Eclypse. nLight Air rSBG nLight AIR sensors can be programmed and commissioned from the ground using the ClAIRity Pro app. Cannot be used with other controls options that need the 0-10V leads. BL30 or BL50 Integrated bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output BLC device provides input to 0-10V dimming leads on all drivers providing either 100% or dimmed (30% or 50%) control by a secondary circuit BLC UVOLT1 BLC device is powered off the 0-10V dimming leads, thus can be used with any input voltage from 120 to 480V 70 CRI 80CRI 90CRI Lumen Multiplier Availability Lumen Multiplier Availability Lumen Multiplier Availability 5000K 102%Standard 92%Extended lead-time 71%(see note) 4000K 100%Standard 92%Extended lead-time 67%(see note) 3500K 100%(see note)90%Extended lead-time 63%(see note) 3000K 96%Standard 87%Extended lead-time 61%(see note) 2700K 94%(see note)85%Extended lead-time 57%(see note) LED Color Temperature / Color Rendering Multipliers Note: Some LED types are available as per special request. Contact Technical Support for more information. Projected LED Lumen Maintenance Data references the extrapolated performance projections for the platforms noted in a 25°C ambient, based on 10,000 hours of LED testing (tested per IESNA LM-80-08 and projected per IESNA TM-21-11). To calculate LLF, use the lumen maintenance factor that corresponds to the desired number of operating hours below. For other lumen maintenance values, contact factory. Operating Hours Lumen Maintenance Factor 0 1.0025,000 0.95 50,000 0.90 100,000 0.82 *Note: Calculated values are based on original performance package data. When calculating new values for given FAO position, use published values for each package based on input watts and lumens by optic type. FAO Position % Wattage % Lumen Output 8 100%100% 7 93%95% 6 80%85% 5 66%73% 4 54%61% 3 41%49% 2 29%36% 1 15%20% FAO Dimming Settings 150 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 5 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P1 135W 80 530 T1S 19,946 2 0 3 148 20,787 2 0 3 155 21,192 2 0 3 158 T2M 18,477 3 0 4 137 19,256 3 0 4 143 19,632 3 0 4 146 T3M 18,691 3 0 5 139 19,480 3 0 5 145 19,859 3 0 5 148 T3LG 16,696 2 0 2 124 17,400 2 0 2 129 17,740 2 0 2 132 T4M 18,970 3 0 5 141 19,770 3 0 5 147 20,155 3 0 5 150 T4LG 17,253 2 0 2 128 17,981 2 0 2 134 18,331 2 0 2 136 TFTM 19,101 3 0 5 142 19,907 3 0 5 148 20,295 3 0 5 151 T5M 19,517 5 0 3 145 20,341 5 0 3 151 20,737 5 0 3 154 T5W 19,834 5 0 3 147 20,670 5 0 3 154 21,073 5 0 3 157 T5LG 19,574 4 0 2 146 20,400 4 0 2 152 20,797 4 0 2 155 BLC3 13,595 0 0 3 101 14,169 0 0 3 105 14,445 0 0 3 107 BLC4 14,042 0 0 4 104 14,634 0 0 4 109 14,919 0 0 4 111 RCCO 13,718 1 0 3 102 14,297 1 0 3 106 14,576 1 0 3 108 LCCO 13,718 1 0 3 102 14,297 1 0 3 106 14,576 1 0 3 108 AFR 19,946 2 0 3 148 20,787 2 0 3 155 21,192 2 0 3 158 P2 179W 80 700 T1S 25,520 3 0 3 142 26,597 3 0 3 148 27,116 3 0 3 151 T2M 23,641 3 0 5 132 24,638 3 0 5 137 25,118 3 0 5 140 T3M 23,915 3 0 5 133 24,924 3 0 5 139 25,410 3 0 5 142 T3LG 21,363 3 0 3 119 22,264 3 0 3 124 22,698 3 0 3 127 T4M 24,272 3 0 5 135 25,296 3 0 5 141 25,789 3 0 5 144 T4LG 22,075 3 0 3 123 23,006 3 0 3 128 23,455 3 0 3 131 TFTM 24,440 3 0 5 136 25,471 3 0 5 142 25,967 3 0 5 145 T5M 24,972 5 0 3 139 26,026 5 0 3 145 26,533 5 0 4 148 T5W 25,377 5 0 4 142 26,448 5 0 4 148 26,963 5 0 4 150 T5LG 25,045 4 0 2 140 26,101 4 0 2 146 26,610 4 0 2 148 BLC3 17,395 0 0 4 97 18,129 0 0 4 101 18,482 0 0 4 103 BLC4 17,966 0 0 4 100 18,724 0 0 5 104 19,089 0 0 5 107 RCCO 17,552 1 0 4 98 18,293 1 0 4 102 18,649 1 0 4 104 LCCO 17,552 1 0 4 98 18,293 1 0 4 102 18,649 1 0 4 104 AFR 25,520 3 0 3 142 26,597 3 0 3 148 27,116 3 0 3 151 P3 219W 80 850 T1S 30,127 3 0 4 137 31,398 3 0 4 143 32,010 3 0 4 146 T2M 27,908 3 0 5 127 29,085 3 0 5 133 29,652 3 0 5 135 T3M 28,232 3 0 5 129 29,423 3 0 5 134 29,996 3 0 5 137 T3LG 25,218 3 0 3 115 26,282 3 0 3 120 26,794 3 0 3 122 T4M 28,652 3 0 5 131 29,861 3 0 5 136 30,443 3 0 5 139 T4LG 26,059 3 0 3 119 27,159 3 0 3 124 27,688 3 0 3 126 TFTM 28,851 3 0 5 132 30,068 3 0 5 137 30,654 3 0 5 140 T5M 29,479 5 0 4 134 30,723 5 0 4 140 31,322 5 0 4 143 T5W 29,957 5 0 4 137 31,221 5 0 4 142 31,830 5 0 4 145 T5LG 29,565 4 0 2 135 30,812 5 0 2 140 31,413 5 0 2 143 BLC3 20,535 0 0 4 94 21,401 0 0 4 98 21,818 0 0 4 99 BLC4 21,209 0 0 5 97 22,104 0 0 5 101 22,534 0 0 5 103 RCCO 20,720 1 0 4 94 21,594 1 0 4 98 22,015 1 0 4 100 LCCO 20,720 1 0 4 94 21,594 1 0 4 98 22,015 1 0 4 100 AFR 30,127 3 0 4 137 31,398 3 0 4 143 32,010 3 0 4 146 P4 273W 80 1050 T1S 35,879 3 0 4 132 37,392 3 0 4 137 38,121 3 0 4 140 T2M 33,236 3 0 5 122 34,638 3 0 5 127 35,313 3 0 5 130 T3M 33,622 3 0 5 123 35,040 3 0 5 129 35,723 3 0 5 131 T3LG 30,033 3 0 4 110 31,300 3 0 4 115 31,910 3 0 4 117 T4M 34,123 3 0 5 125 35,562 3 0 5 130 36,255 3 0 5 133 T4LG 31,035 3 0 4 114 32,344 3 0 4 119 32,974 3 0 4 121 TFTM 34,359 3 0 5 126 35,808 3 0 5 131 36,506 3 0 5 134 T5M 35,108 5 0 4 129 36,589 5 0 4 134 37,302 5 0 4 137 T5W 35,677 5 0 4 131 37,182 5 0 5 136 37,907 5 0 5 139 T5LG 35,209 5 0 3 129 36,695 5 0 3 135 37,410 5 0 3 137 BLC3 24,456 0 0 4 90 25,487 0 0 4 93 25,984 0 0 5 95 BLC4 25,258 0 0 5 93 26,324 0 0 5 97 26,837 0 0 5 98 RCCO 24,676 1 0 4 91 25,717 1 0 4 94 26,218 1 0 4 96 LCCO 24,676 1 0 4 91 25,717 1 0 4 94 26,218 1 0 4 96 AFR 35,879 3 0 4 132 37,392 3 0 4 137 38,121 3 0 4 140 Lumen Output 151 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 6 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Forward Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P5 327W 80 1250 T1S 41,149 3 0 4 126 42,885 3 0 4 131 43,721 3 0 4 134 T2M 38,118 4 0 5 117 39,727 4 0 5 122 40,501 4 0 5 124 T3M 38,561 3 0 5 118 40,187 3 0 5 123 40,971 3 0 5 125 T3LG 34,445 3 0 4 105 35,898 3 0 4 110 36,598 3 0 4 112 T4M 39,135 3 0 5 120 40,786 3 0 5 125 41,581 3 0 5 127 T4LG 35,594 3 0 4 109 37,095 3 0 4 114 37,818 3 0 4 116 TFTM 39,406 3 0 5 121 41,069 3 0 5 126 41,869 3 0 5 128 T5M 40,265 5 0 4 123 41,964 5 0 4 128 42,782 5 0 5 131 T5W 40,918 5 0 5 125 42,644 5 0 5 131 43,475 5 0 5 133 T5LG 40,382 5 0 3 124 42,085 5 0 3 129 42,906 5 0 3 131 BLC3 28,048 0 0 5 86 29,231 0 0 5 90 29,801 0 0 5 91 BLC4 28,969 0 0 5 89 30,191 0 0 5 92 30,779 0 0 5 94 RCCO 28,301 2 0 5 87 29,495 2 0 5 90 30,070 2 0 5 92 LCCO 28,301 2 0 5 87 29,495 2 0 5 90 30,070 2 0 5 92 AFR 41,149 3 0 4 126 42,885 3 0 4 131 43,721 3 0 4 134 P6 342W 100 1050 T1S 45,968 3 0 4 135 47,907 3 0 5 140 48,841 3 0 5 143 T2M 42,582 4 0 5 125 44,379 4 0 5 130 45,244 4 0 5 132 T3M 43,076 4 0 5 126 44,894 4 0 5 131 45,769 4 0 5 134 T3LG 38,479 3 0 4 113 40,102 3 0 4 117 40,884 3 0 4 120 T4M 43,719 4 0 5 128 45,563 4 0 5 133 46,451 4 0 5 136 T4LG 39,762 3 0 4 116 41,439 3 0 4 121 42,247 3 0 4 124 TFTM 44,021 3 0 5 129 45,878 4 0 5 134 46,772 4 0 5 137 T5M 44,980 5 0 5 132 46,878 5 0 5 137 47,792 5 0 5 140 T5W 45,710 5 0 5 134 47,638 5 0 5 139 48,566 5 0 5 142 T5LG 45,111 5 0 3 132 47,014 5 0 3 138 47,930 5 0 3 140 BLC3 31,333 0 0 5 92 32,655 0 0 5 96 33,291 0 0 5 97 BLC4 32,361 0 0 5 95 33,726 0 0 5 99 34,384 0 0 5 101 RCCO 31,615 2 0 5 93 32,949 2 0 5 96 33,591 2 0 5 98 LCCO 31,615 2 0 5 93 32,949 2 0 5 96 33,591 2 0 5 98 AFR 45,968 3 0 4 135 47,907 3 0 5 140 48,841 3 0 5 143 P7 409W 100 1250 T1S 52,692 3 0 5 129 54,915 3 0 5 134 55,986 3 0 5 137 T2M 48,811 4 0 5 119 50,871 4 0 5 124 51,862 4 0 5 127 T3M 49,378 4 0 5 121 51,461 4 0 5 126 52,464 4 0 5 128 T3LG 44,107 3 0 4 108 45,968 3 0 4 112 46,864 3 0 5 115 T4M 50,114 4 0 5 122 52,228 4 0 5 128 53,246 4 0 5 130 T4LG 45,579 3 0 4 111 47,501 3 0 4 116 48,427 3 0 4 118 TFTM 50,460 4 0 5 123 52,589 4 0 5 129 53,614 4 0 5 131 T5M 51,560 5 0 5 126 53,735 5 0 5 131 54,783 5 0 5 134 T5W 52,396 5 0 5 128 54,607 5 0 5 133 55,671 5 0 5 136 T5LG 51,710 5 0 4 126 53,891 5 0 4 132 54,941 5 0 4 134 BLC3 35,916 1 0 5 88 37,431 1 0 5 91 38,161 1 0 5 93 BLC4 37,095 0 0 5 91 38,660 0 0 5 94 39,413 0 0 5 96 RCCO 36,240 2 0 5 89 37,769 2 0 5 92 38,505 2 0 5 94 LCCO 36,240 2 0 5 89 37,769 2 0 5 92 38,505 2 0 5 94 AFR 52,692 3 0 5 129 54,915 3 0 5 134 55,986 3 0 5 137 P8 462W 100 1400 T1S 57,662 3 0 5 125 60,094 4 0 5 130 61,266 4 0 5 132 T2M 53,415 4 0 5 116 55,668 4 0 5 120 56,753 4 0 5 123 T3M 54,034 4 0 5 117 56,314 4 0 5 122 57,412 4 0 5 124 T3LG 48,267 3 0 5 104 50,304 3 0 5 109 51,284 4 0 5 111 T4M 54,840 4 0 5 119 57,154 4 0 5 124 58,268 4 0 5 126 T4LG 49,877 3 0 5 108 51,981 3 0 5 112 52,994 3 0 5 115 TFTM 55,219 4 0 5 119 57,549 4 0 5 124 58,671 4 0 5 127 T5M 56,423 5 0 5 122 58,803 5 0 5 127 59,949 5 0 5 130 T5W 57,338 5 0 5 124 59,757 5 0 5 129 60,921 5 0 5 132 T5LG 56,586 5 0 4 122 58,974 5 0 4 128 60,123 5 0 4 130 BLC3 39,303 1 0 5 85 40,962 1 0 5 89 41,760 1 0 5 90 BLC4 40,593 0 0 5 88 42,306 0 0 5 91 43,130 0 0 5 93 RCCO 39,658 2 0 5 86 41,331 2 0 5 89 42,137 2 0 5 91 LCCO 39,658 2 0 5 86 41,331 2 0 5 89 42,137 2 0 5 91 AFR 57,662 3 0 5 125 60,094 4 0 5 130 61,266 4 0 5 132 Lumen Output 152 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 7 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P10 152W 90 530 T1S 22,798 4 0 4 150 23,760 4 0 4 156 24,223 4 0 4 159 T2M 21,119 5 0 5 139 22,010 5 0 5 145 22,439 5 0 5 148 T3M 21,361 5 0 5 141 22,262 5 0 5 147 22,696 5 0 5 149 T3LG 19,084 4 0 4 126 19,889 4 0 4 131 20,277 4 0 4 133 T4M 21,679 5 0 5 143 22,594 5 0 5 149 23,034 5 0 5 152 T4LG 19,717 4 0 4 130 20,549 4 0 4 135 20,950 4 0 4 138 TFTM 21,833 5 0 5 144 22,754 5 0 5 150 23,197 5 0 5 153 T5M 22,305 5 0 3 147 23,246 5 0 3 153 23,699 5 0 3 156 T5W 22,667 5 0 3 149 23,623 5 0 4 155 24,084 5 0 4 158 T5LG 22,370 4 0 2 147 23,314 4 0 2 153 23,768 4 0 2 156 BLC3 15,539 4 0 4 102 16,194 4 0 4 107 16,510 4 0 4 109 BLC4 16,048 4 0 4 106 16,725 4 0 4 110 17,051 4 0 4 112 RCCO 15,679 1 0 3 103 16,340 1 0 3 108 16,659 1 0 3 110 LCCO 15,679 1 0 3 103 16,340 1 0 3 108 16,659 1 0 3 110 AFR 22,798 4 0 4 150 23,760 4 0 4 156 24,223 4 0 4 159 P11 203W 90 700 T1S 29,222 4 0 4 144 30,455 4 0 4 150 31,048 4 0 4 153 T2M 27,070 5 0 5 134 28,212 5 0 5 139 28,762 5 0 5 142 T3M 27,380 5 0 5 135 28,535 5 0 5 141 29,091 5 0 5 144 T3LG 24,462 4 0 4 121 25,493 4 0 4 126 25,990 4 0 4 128 T4M 27,788 5 0 5 137 28,960 5 0 5 143 29,525 5 0 5 146 T4LG 25,273 4 0 4 125 26,339 4 0 4 130 26,853 4 0 4 133 TFTM 27,985 5 0 5 138 29,165 5 0 5 144 29,734 5 0 5 147 T5M 28,591 5 0 4 141 29,797 5 0 4 147 30,377 5 0 4 150 T5W 29,054 5 0 4 143 30,280 5 0 4 149 30,870 5 0 4 152 T5LG 28,673 4 0 2 142 29,883 4 0 2 148 30,465 5 0 2 150 BLC3 19,917 4 0 4 98 20,757 4 0 4 102 21,162 4 0 4 104 BLC4 20,570 5 0 5 102 21,437 5 0 5 106 21,855 5 0 5 108 RCCO 20,097 1 0 4 99 20,945 1 0 4 103 21,353 1 0 4 105 LCCO 20,097 1 0 4 99 20,945 1 0 4 103 21,353 1 0 4 105 AFR 29,222 4 0 4 144 30,455 4 0 4 150 31,048 4 0 4 153 P12 248W 90 850 T1S 34,526 5 0 5 139 35,983 5 0 5 145 36,684 5 0 5 148 T2M 31,984 5 0 5 129 33,333 5 0 5 135 33,983 5 0 5 137 T3M 32,350 5 0 5 131 33,715 5 0 5 136 34,372 5 0 5 139 T3LG 28,902 4 0 4 117 30,121 4 0 4 122 30,708 4 0 4 124 T4M 32,832 5 0 5 133 34,217 5 0 5 138 34,884 5 0 5 141 T4LG 29,861 4 0 4 121 31,120 4 0 4 126 31,727 5 0 4 128 TFTM 33,064 5 0 5 134 34,459 5 0 5 139 35,131 5 0 5 142 T5M 33,780 5 0 4 136 35,205 5 0 4 142 35,891 5 0 4 145 T5W 34,327 5 0 4 139 35,776 5 0 4 145 36,473 5 0 4 147 T5LG 33,878 5 0 3 137 35,307 5 0 3 143 35,995 5 0 3 145 BLC3 23,532 5 0 5 95 24,525 5 0 5 99 25,003 5 0 5 101 BLC4 24,303 5 0 5 98 25,328 5 0 5 102 25,822 5 0 5 104 RCCO 23,745 1 0 4 96 24,747 1 0 4 100 25,229 1 0 4 102 LCCO 23,745 1 0 4 96 24,747 1 0 4 100 25,229 1 0 4 102 AFR 34,526 5 0 5 139 35,983 5 0 5 145 36,684 5 0 5 148 Lumen Output 153 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 8 of 10 COMMERCIAL OUTDOOR Performance Data Lumen values are from photometric tests performed in accordance with IESNA LM-79-08. Data is considered to be representative of configurations shown within the tolerances described within LM-79. Contact factory for performance data on any configurations not shown here. Rotated Optics Performance Package System Watts LED Count Drive Current (mA)Distribution Type 30K 40K 50K (3000K, 70 CRI)(4000K, 70 CRI)(5000K, 70 CRI) Lumens B U G LPW Lumens B U G LPW Lumens B U G LPW P13 354W 90 1200 T1S 45,748 5 0 5 129 47,678 5 0 5 135 48,608 5 0 5 137 T2M 42,380 5 0 5 120 44,168 5 0 5 125 45,029 5 0 5 127 T3M 42,865 5 0 5 121 44,673 5 0 5 126 45,544 5 0 5 129 T3LG 38,296 5 0 5 108 39,911 5 0 5 113 40,689 5 0 5 115 T4M 43,503 5 0 5 123 45,339 5 0 5 128 46,222 5 0 5 131 T4LG 39,566 5 0 5 112 41,235 5 0 5 117 42,039 5 0 5 119 TFTM 43,811 5 0 5 124 45,659 5 0 5 129 46,549 5 0 5 132 T5M 44,760 5 0 5 126 46,648 5 0 5 132 47,557 5 0 5 134 T5W 45,485 5 0 5 129 47,404 5 0 5 134 48,328 5 0 5 137 T5LG 44,889 5 0 3 127 46,783 5 0 3 132 47,695 5 0 3 135 BLC3 31,181 5 0 5 88 32,496 5 0 5 92 33,130 5 0 5 94 BLC4 32,202 5 0 5 91 33,561 5 0 5 95 34,215 5 0 5 97 RCCO 31,463 2 0 5 89 32,790 2 0 5 93 33,429 2 0 5 94 LCCO 31,463 2 0 5 89 32,790 2 0 5 93 33,429 2 0 5 94 AFR 45,748 5 0 5 129 47,678 5 0 5 135 48,608 5 0 5 137 P14 415W 90 1400 T1S 51,272 5 0 5 123 53,435 5 0 5 129 54,476 5 0 5 131 T2M 47,497 5 0 5 114 49,500 5 0 5 119 50,465 5 0 5 121 T3M 48,040 5 0 5 116 50,067 5 0 5 121 51,043 5 0 5 123 T3LG 42,919 5 0 5 103 44,730 5 0 5 108 45,602 5 0 5 110 T4M 48,756 5 0 5 117 50,813 5 0 5 122 51,803 5 0 5 125 T4LG 44,343 5 0 5 107 46,214 5 0 5 111 47,115 5 0 5 113 TFTM 49,101 5 0 5 118 51,172 5 0 5 123 52,169 5 0 5 126 T5M 50,164 5 0 5 121 52,280 5 0 5 126 53,299 5 0 5 128 T5W 50,977 5 0 5 123 53,127 5 0 5 128 54,163 5 0 5 130 T5LG 50,309 5 0 4 121 52,432 5 0 4 126 53,453 5 0 4 129 BLC3 34,945 5 0 5 84 36,420 5 0 5 88 37,130 5 0 5 89 BLC4 36,090 5 0 5 87 37,613 5 0 5 91 38,346 5 0 5 92 RCCO 35,261 2 0 5 85 36,749 2 0 5 88 37,465 2 0 5 90 LCCO 35,261 2 0 5 85 36,749 2 0 5 88 37,465 2 0 5 90 AFR 51,272 5 0 5 123 53,435 5 0 5 129 54,476 5 0 5 131 Lumen Output 154 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 9 of 10 COMMERCIAL OUTDOOR 42.11" 3.96" 16.76" 8.44" 42.41" 3.96" 16.75" 8.90" 46.59" 3.96" 16.76" 8.23" Dimensions DSX2 with RPA, RPA5, SPA5, SPA8N mount Weight: 48 lbs DSX2 with WBA mount Weight: 50 lbs DSX2 with MA mount Weight: 50 lbs 2.41" 3.16" SPA (STANDARD ARM) 2.41"3.16" RPA 2.41" 3.16" SPA8N 4.25" RPA5 4.25" SPA5 155 One Lithonia Way • Conyers, Georgia 30012 • Phone: 1-800-705-SERV (7378) • www.lithonia.com © 2011-2023 Acuity Brands Lighting, Inc. All rights reserved. DSX2-LED Rev. 10/30/23 Page 10 of 10 COMMERCIAL OUTDOOR FEATURES & SPECIFICATIONS INTENDED USE The sleek design of the D-Series Area Size 2 reflects the embedded high performance LED technology. It is ideal for applications like car dealerships and large parking lots adjacent to malls, transit stations, grocery stores, home centers, and other big-box retailers. CONSTRUCTION Single-piece die-cast aluminum housing has integral heat sink fins to optimize thermal management through conductive and convective cooling. Modular design allows for ease of maintenance and future light engine upgrades. The LED drivers are mounted in direct contact with the casting to promote low operating temperature and long life. Housing driver compartment is completely sealed against moisture and environmental contaminants (IP66). Vibration rated per ANSI C136.31 for 1.5G. 3G vibration rated available for (MA) mast arm mount when specifying option 3G. Low EPA (1.06 ft2) for optimized pole wind loading. FINISH Exterior parts are protected by a zinc-infused Super Durable TGIC thermoset powder coat finish that provides superior resistance to corrosion and weathering. A tightly controlled multi-stage process ensures a minimum 3 mils thickness for a finish that can withstand extreme climate changes without cracking or peeling. Available in both textured and non-textured finishes. Coastal Construction (CCE) Optional corrosion resistant construction is engineered with added corrosion protection in materials and/or pre-treatment of base material under super durable paint. Provides additional corrosion protection for applications near coastal areas. Finish is salt spray tested to over 5,000 hours per ASTM B117 with scribe rating of 10. Additional lead-times may apply. OPTICS Precision-molded proprietary silicone lenses are engineered for superior area lighting distribution, uniformity, and pole spacing. Light engines are available in 3000 K, 4000 K, or 5000 K (70 CRI) configurations. 80CRI configurations are also available. The D-Series Size 2 has zero uplight and qualifies as a Nighttime Friendly™ product, meaning it is consistent with the LEED® and Green Globes™ criteria for eliminating wasteful uplight. ELECTRICAL Light engine configurations consist of high-efficacy LEDs mounted to metal-core circuit boards to maximize heat dissipation and promote long life (up to L82/100,000 hrs at 25°C). Class 1 electronic drivers are designed to have a power factor >90%, THD <20%, and an expected life of 100,000 hours with <1% failure rate. Easily- serviceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). INSTALLATION Integral mounting arm allows for fast mounting using Lithonia standard #8 drilling and accommodates pole drilling’s from 2.41 to 3.12" on center. The standard “SPA” option for square poles and the “RPA” option for round poles use the #8 drilling. For #5 pole drillings, use SPA5 or RPA5. Additional mountings are available including a wall bracket (WBA) and mast arm (MA) option that allows luminaire attachment to a 2 3/8" horizontal mast arm. STANDARD CONTROLS The DSX2 LED area luminaire has a number of control options. DSX Size 2, comes standard with 0-10V dimming drivers. Dusk to dawn controls can be utilized via optional NEMA twist-lock photocell receptacles. Integrated motion sensor with on- board photocells feature field-adjustable programing and are suitable for mounting heights up to 40 feet. Control option BL features a bi-level device that allows a second control circuit to switch all light engines to either 30% or 50% light output. nLIGHT AIR CONTROLS The DSX2 LED area luminaire is also available with nLight® AIR for the ultimate in wireless control. This powerful controls platform provides out-of-the-box basic motion sensing and photocontrol functionality and is suitable for mounting heights up to 40 feet. Once commissioned using a smartphone and the easy-to-use CLAIRITY app, nLight AIR equipped luminaries can be grouped, resulting in motion sensor and photocell group response without the need for additional equipment. Scheduled dimming with motion sensor over-ride can be achieved when used with the nLight Eclypse. Additional information about nLight Air can be found here. LISTINGS UL listed to meet U.S. and Canadian standards. UL Listed for wet locations. Light engines are IP66 rated; luminaire is IP66 rated. Rated for -40°C minimum ambient. DesignLights Consortium® (DLC) Premium qualified product and DLC qualified product. Not all versions of this product may be DLC Premium qualified or DLC qualified. Please check the DLC Qualified Products List at www.designlights.org/ QPL to confirm which versions are qualified. International Dark-Sky Association (IDA) Fixture Seal of Approval (FSA) is available for all products on this page utilizing 3000K color temperature only. BUY AMERICAN ACT Product with the BAA option is assembled in the USA and meets the Buy America(n) government procurement requirements under FAR, DFARS and DOT regulations. Please refer to www.acuitybrands.com/buy-american for additional information. WARRANTY 5-year limited warranty. This is the only warranty provided and no other statements in this specification sheet create any warranty of any kind. All other express and implied warranties are disclaimed. Complete warranty terms located at: www.acuitybrands.com/support/warranty/terms-and-conditions Note: Actual performance may differ as a result of end-user environment and application. All values are design or typical values, measured under laboratory conditions at 25 °C. Specifications subject to change without notice. nLight Control - Sensor Coverage and Settings nLight Sensor Coverage Pattern NLTAIR2 PIRHN Top Side 156 FRAME SHED 90'FRAME BUILDING METAL SILO CONC. SILO METAL SHED METAL BARN FRAME BARN METAL SHED 31' 104' 94' 184' 184' #2016 STORM INLET RIM=597.90 IE 4" CPP N=593.67 IE 12" RCP W=592.67 #2041 STORM INLET RIM=597.47 IE 4" CPP N=592.87 IE 12" RCP S=591.87 BOTTOM=589.47 #2040 STORM INLET RIM=597.42 IE 4" CPP S=UNABLE TO MEASURE IE 12" RCP N,W=591.84 BOTTOM=589.42 #2055 STORM INLET RIM=597.78 IE 4" CPP N=594.33 IE 12" RCP W=591.83 #2110 STORM INLET RIM=597.65 IE 4" CPP N=591.65 IE 12" RCP E,W=590.75 BOTTOM=590.15 #2130 STORM INLET RIM=597.00 IE 4" CPP N=593.05 IE 12" RCP W=591.95 #1240 STORM INLET RIM=596.34 NO VISIBLE PIPES ON FIELD WORK DATED 08/15/2022 #2109 INLET RIM=592.82 IE 12" RCP W=591.37 BOTTOM=590.22 #1094#1108 #1142 STORM INLET RIM=596.26 IE 4" CPP N=592.06 IE 12" RCP E=590.66 IE 12" RCP W=590.36 BOTTOM=588.01 #1261 STORM INLET RIM=596.94 IE 12" RCP W=590.44 IE 12" RCP E=591.44 IE 4" RCP N=592.14 BOTTOM=589.24 #1293 STORM MH RIM=597.81 IE 36" RCP N,S=589.01 IE 12" RCP NE=589.66 #1292 STORM INLET RIM=597.62 IE 4" CPP N=594.17 IE 12" RCP E,SW=589.78 BOTTOM=588.92 #1391 STORM INLET RIM=597.72 IE 4" CPP S=591.92 IE 12" RCP E=590.52 IE 12" RCP W=590.22 BOTTOM=588.22 #1429 STORM MH RIM=597.40 IE 12" RCP NE=589.90 IE 36" RCP N,S=589.17 BOTTOM=590.15 #1422 STORM INLET RIM=597.49 IE 4" CPP W=591.69 IE 12" RCP N=590.09 IE 12" RCP E,SW=589.69 BOTTOM=588.69 #1449 STORM INLET RIM=597.52 IE 4" CPP N=592.42 IE 4" CPP E=592.12 IE 12" RCP S=591.17 BOTTOM=589.92 #1953 STORM INLET RIM=599.15 IE 4" CPP N=595.20 IE 12" RCP W=594.10 #1883 WATER VALVE VAULT RIM=601.15 UNABLE TO OPEN ON FIELD WORK DATED 08/15/2022 #1644 STORM INLET RIM=597.90 IE 4" CPP N=UNABLE TO MEASURE IE 12" RCP E=592.10 IE 12" RCP W=590.95 BOTTOM=589.25 #2225 INLET RIM=591.85 IE 8" PVC N=587.97 IE 12" RCP S=587.87 IE 6" PVC NW=587.97 #1934 STORM INLET RIM=599.83 IE 4" CPP N=595.63 IE 12" RCP W=594.59 #1882 STORM INLET RIM=601.11 IE 4" CPP N=597.31 IE 12" RCP W=595.98 #1415 STORM INLET RIM=597.96 IE 12" RCP E,W=590.78 BOTTOM=588.36 #2237 STORM INLET RIM=598.52 IE 12" RCP W=593.42 #1902 STORM INLET RIM=600.47 IE 4" CPP N=596.37 IE 12" RCP W=595.25 #1881 WATER VALVE VAULT RIM=599.75 TP 10" WM=594.77 #1754 STORM INLET RIM=601.09 IE 4" CPP N=594.39 IE 12" RCP E,W=593.80 BOTTOM=591.54 #1545 STORM INLET RIM=599.85 IE 4" CPP N=595.10 IE 12" RCP NW=593.22 IE 12" RCP E=593.45 BOTTOM=590.65 #1592 STORM INLET RIM=599.12 IE 4" CPP NW=593.42 IE 12" RCP E=592.37 IE 12" RCP SW=591.60 BOTTOM=590.12 #1788 STORM MH RIM=602.00 IE 24" RCP N,S=594.24 IE 12" RCP NE=596.35 #1512 STORM INLET RIM=600.51 IE 4" CPP N=594.16 IE 12" RCP E=593.91 IE 12" RCP W=592.86 BOTTOM=591.01 #1542 STORM MH RIM=600.16 IE 24" RCP N,S=591.46 IE 12" RCP SE=593.11 #1627 STORM INLET RIM=598.54 IE 4" CPP N=593.19 IE 12" RCP E=592.09 IE 12" RCP W=591.84 BOTTOM=588.54 #1789 STORM INLET RIM=601.77 IE 4" CPP N=598.37 IE 12" RCP SW=596.37 IE 12" RCP E=597.47 BOTTOM=594.04 #1555 INLET RIM=600.11 IE 12" RCP E=593.96 IE 12" RCP W=593.66 BOTTOM=591.41 #1594 STORM MH RIM=599.82 IE 24" RCP N=590.82 IE 12" RCP NE=591.62 IE 36" RCP S=590.82 15" FES IE=595.46 15" FES IE=595.82 24" FES IE=598.44 24" FES IE=598.35 12" FES IE=599.03 12" FES IE=599.39 #1540 STORM INLET RIM=597.30 APPROXIMATE LINE PER ATLASEXI S T I N G BUI L D I N G EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDINGEXIS TI N G BUIL DI N G POOL CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.CONC.GRAV E L 595600594596597598599 595595595595592592 592 592593 593593593 593593594594594 594594594594596 596597 597 595600596597598599601602 602602601600601600600600600 6 0 0 6 00599599599 5996016016016016016016026025955956006006006005965965965975975975975975975975975985985985985985985985985995995995995995995955965975985955955 9 5 595595595595595594594596596596597597597598598598599599599599595595595595594594596597597597597597598595 59559559 5 595595 595592 592 593593 593 593 594594594594EDGE OF TREESFIR 5/8 FCCFCC FIP FCC FCC FIR 5/8 BENT FIR 5/8 YLW CAP FIR 5/8 CAP.YLW FIR_CAP.2IN FIR_CAP.2IN_IDOT FIR_5/8_CAP.YLW FIR_5/8_CAP.YLW FIR_5/8 FIR_5/8 BENTFIP_1.5 FCC FIR_5/8 FIR_5/8 FCC FCC_TC FIR_5/8.CAP.YLW 10' P.U.E. N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9W. LINE OF THE NW 1/4 OF SEC. 27-36-9EXCEPT I O NEXCEPTIONP.O.B. EXCEPTION 69.30' (N88° 55' 06"E)(S01° 55' 33"E)(307.91')(N88° 04' 27"E)(S01° 55' 33"E)(S88°04'27"W)(S01°55'33"E)(258.88')70.99'N01°50'58"W 1313.63'(N01° 51' 07"W)(1313.81')HERETOFORE CONVEYED TO IDOT PER DOC. R20110317241.20' N & 0.18' E 0.43' SONLINEONLINE0.10' N0.91' N & 0.20' WHERETOFORE DEDICATED PER DOC. 463161AT CORNER AT CORNER 14.28' NE 14.75' SE 18.78' ELY 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'TEMPORARY CONSTRUCTION EASEMENT PER DOC. R2011-31724 21.93' SE IL RTE 59275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY AT CORNER S88°54'06"W 1248.03'N01°55'23"W 258.85'N88°04'37"E 5.00'N01°55'23"W 747.00'S88°04'37"W 5.00'N01°55'23"W 307.78'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 LOT 1 666.17' 666.17'SHEET 2SHEET 106-03-27-101-007-0000 SCHLUETER MARK W 23850 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-006-0000 SCHIMPF JAMES E KAY F 23860 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-005-0000 MOGUR CHRISTOPHER A IWONA 23910 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-004-0000 LOWE MICHAEL REV TRUST 23920 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-003-0000 OSTREGA JOSEPH MARY A 23930 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-002-0000 RAFACZ EDWARD A JR 23940 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-001-0000 BOBB ROBERT J LINDA S 23946 W PLAINSMAN CIR PLAINFIELD, IL 60586 ZONED R-1 ZONED A-1 (WILL COUNTY) 06-03-22-300-003-0000 MUNICIPAL LIMITS S01°55'23"E 1313.42'EXISTING IMPROVEMENTS TO BE DEMOLISHED EXISTING IMPROVEMENTS TO BE DEMOLISHED SHEET 2SHEET 1SCM 20' SIDE SETBACK LINE 60 FOOT TRANSITIONAL YARD30' FRONT SETBACK LINE30' REAR SETBACK LINE15' SIDE SETBACK LINE 30' FRONT SETBACK LINE30' FRONT SETBACK LINENORTHWEST CORNER OF PLAINSMAN TERRACE SUBDIVISION BLANKET SHARED ACCESS EASEMENT OVER ALL OF AREA 1 HEREBY GRANTED S89°58'36"W 128.15'N01°04'46"W 545.12'N88°55'14"E 64.00'S01°04'46"E 190.98'A=70.69' R=45.00'CB=S4 6 °0 4'51"E 58.08'STORMWATER MANAGEMENT EASEMENT HEREBY GRANTED BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANREVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4160' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 ASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. BENCHMARK SOURCE: NGS MONUMENT STATION DESIGNATION: DP5474 ESTABLISHED BY: PATRICK ENGINEERING DATE: 2013-12-13 ELEVATION: 595.99 (PUBLISHED AND HELD) DATUM: NAVD88 DESCRIPTION: TO REACH THE STATION FROM THE SOUTH JUNCTION OF US HIGHWAY 38 WITH STATE HIGHWAY 59 IN PLAINFIELD, IL, GO SOUTH ON STATE HIGHWAY 59 FOR 2.2 MI (3.5 KM)TO ROLF ROAD AND THE STATION ON THE RIGHT. THE STATION IS LOCATED 5 FT {1.5 M)WEST OF THE EDGE OF PAVEMENT OF STATE HIGHWAY 59, 298 FT (90.8 M)SOUTH OF A TELEPHONE PEDESTAL AND 215 FT (65.5 M)NORTH OF A 'SOUTH IL 59' SIGN. SITE: STATION DESIGNATION: SBM#1 ESTABLISHED BY: V3 COMPANIES DATE: 08-15-22 ELEVATION: 602.52 (MEASURED) DATUM: NAVD88 DESCRIPTION: NW TAG BOLT ON FIRE HYDRANT SOUTH OF COMED RIGHT OF WAY, NEAR NORTHWEST CORNER OF SITE. STATION DESIGNATION: SBM#2 ESTABLISHED BY: V3 COMPANIES DATE: 08-15-22 ELEVATION: 597.18 (MEASURED) DATUM: NAVD88 DESCRIPTION: FOUND CUT CROSS ON WATER VALVE VAULT LID SOUTH OF COMED ROW NEAR NORTHEAST CORNER OF SITE. THE ELEVATIONS ABOVE WERE KNOWN TO BE ACCURATE AT THE TIME THEY WERE ESTABLISHED. V3 DOES NOT CERTIFY TO THE ACCURACY THEREAFTER, NOR ASSUMES RESPONSIBILITY FOR THE MIS-USE OR MIS-INTERPRETATION OF THE INFORMATION SHOWN HEREON. IT IS ADVISED THAT ALL OF THE ABOVE ELEVATIONS BE CHECKED BETWEEN EACH OTHER AND VERIFY A MINIMUM OF 3 SURROUNDING UTILITY RIM ELEVATIONS AND ANY ADJACENT BUILDING FINISHED FLOOR OR TOP OF FOUNDATION ELEVATIONS SHOWN HEREON PRIOR TO USE OR COMMENCEMENT OF ANY CONSTRUCTION OR OTHER WORK. PERSONS USING THIS INFORMATION ARE TO CONTACT V3 IMMEDIATELY WITH ANY DISCREPANCIES FOUND PRIOR TO THE START OF ANY WORK. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; NOTES 1.THIS PROPERTY IS ZONED R-1, LOW DENSITY SINGLE-FAMILY RESIDENTIAL DISTRICT, PER 2022 VILLAGE OF PLAINFIELD ZONING MAP. 2.EXISTING IMPROVEMENTS AND TOPOGRAPHY (SHOWN IN GRAY) ARE PAR ALTA/NSPS LAND TITLE AND TOPOGRAPHY SURVEY PREPARED BY V3, DATED AUGUST 31, 2022 3.ONCE THE PLAT SHOWN HEREON IS RECORDED AND UPON COMPLETION OF CONSTRUCTION, 3/4" IRON PIPES WITH PLASTIC CAPS SHALL BE SET AT ALL LOT CORNERS AND CHANGES IN GEOMETRY, UNLESS SHOWN OTHERWISE. VICINITY MAP NOT TO SCALE SITE OWNER ENGINEER/SURVEYOR Montibus Land Partners LLC 640 Pasquinelli Dr Westmont, IL 60559 847-727-6700 V3 Companies, Ltd. 7325 Janes Avenue, Suite 100 Woodridge, Illinois 60517 630.724.9200 DEVELOPER Kelly Construction 245 E Sydney Ct Villa Park, IL 601811 sean@kelly.com c/o John Crane cranezoo@aol.com 630-833-5600 AREA LOT 1 871,200 SQ. FT. 20.0000 ACRES LOT 2 2,929,361 SQ. FT. 67.2489 ACRES TOTAL 3,800,561 SQ. FT.87.2489 ACRES 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 157 #1422 WATER VALVE VAULT RIM=595.33 TP E, W WM=589.63 UNABLE TO MEASURE SIZE ON FIELD WORK DATED 08/15/2022 18" FES IE=588.60 15" CPP IE=588.10 EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING E X I S T I N G B U I L D I N G EXISTINGBUILDINGEXISTINGBUILDINGEXISTING BUILDING POOL595 5 9 5593593594 594594592 593 594 595 59559 5 5 9 5 595595592592 593 593593593 593 594594594594 59 4 59 4 594 5 94 59459559559459559359359459459 4 595 591592592 592 593 593 593 594 594 594 590591 592 593 5905905915 9 1 591 591591591592 592 5 9 2 593593593594594591 592 592 592 593 594 594FIR_5/8 FIP_3/4 FIP_3/4 FIR_5/8 FIR_5/8 FIP_1 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8.BENT 35' DRAINAGE EASEMENT 10' UTILITY EASEMENT 20' DRAINAGE EASEMENTN. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE 1/4 OF THE NW 1/4 OF SEC. 27-36-9 EXCEPT I O N 0.35' S AT CORNERAT CORNERAT CORNERAT CORNER AT CORNER 0.13' W 0.12' N 0.06' EON LINE0.11' N0.30' S 0.11' EN01°54'18"W 328.07'N88°55'12"E 2569.29'10' UTILITY EASEMENTLOT 2 581.86' 1903.12'SHEET 2SHEET 1SHEET 3SHEET 220' DRAINAGE EASEMENT STORMWATER MANAGEMENT EASEMENT HEREBY GRANTED 06-03-27-101-017-0000 OWNER: WALDRON GARY L JANET M 16963 S PLAINSMAN CT PLAINFIELD, IL 60544 06-03-27-101-018-0000 OWNER: RICKMON LAURIE B 23648 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-019-0000 OWNER: KOZAK DONALD A CATHY L 23754 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-020-0000 OWNER: MCLAUGHLIN MICHAEL R 23744 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-021-0000 OWNER: PIRC RAYMOND LOIS 23734 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-014-0000 OWNER: SAXEN ADAM 16943 S PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-013-0000 OWNER: PANTKE DAVID 16933 S PLAINSMAN CT PLAINFIELD, IL 60586 06-03-27-101-012-0000 OWNER: GASIENCIA MARCIN K 16923 S PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-011-0000 OWNER: OKREY TIMOTHY W SHERRIL 23810W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-010-0000 OWNER: HAMBURG FREDERIC S 23830 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-009-0000 MCNAMARA THOMAS J MCNAMARA CHRISTINE 23834 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-008-0000 WINTER CHARLES R JR 23840 W PLAINSMAN CIR PLAINFIELD, IL 60586 06-03-27-101-007-0000 SCHLUETER MARK W 23850 W PLAINSMAN CIR PLAINFIELD, IL 60586 ZONED R-1 SHEET 2SHEET 1275' COMMONWEALTH EDISON COMPANY RIGHT OF WAYZONED A-1 (WILL COUNTY) 06-03-22-300-004-0000 06-03-22-300-003-0000 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 MUNICIPAL LIMITS SHEET 3SHEET 2N. LINE OF THE SOUTH 1/2 OF THE NW 1/4 OF SEC. 27-36-9 ZONED R-1 15' SIDE SETBACK LINE 20' SIDE SETBACK LINE 20' SIDE SETBACK LINEA NORTHEAST CORNER OF PLAINSMAN TERRACE SUBDIVISION PROPOSED DETENTION BASIN HWL 595.3 NWL 590.3 AREA 6.72 ACRES VOLUME 30.08 AC-FT N88°56'29"E 1041.49'S00°02'46"E59.05'S62°4 7' 0 6 " W 5 9 2. 7 4' S89°58'36"W 489.25' REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4260' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 158 597.18 FCC WVV EDGE OF TREES#1024 WATER VALVE VAULT RIM=597.18 TP 12" WM=591.53 EXISTINGBUILDING590590590595595589591591591592592592593593593594594594 596596596 596590590590590595595595588588588588589589589589591591591591592592 5 9 2 592 592592592593593 593593593593593 594 594594594 5945945945 9 6 596590 590589589589589591592593594590590 590590595595591591592592593593594594596596596596590 590 591592597 597591591 592593594590589589591592593594590595591592593594596FIR_5/8.CAP.ORG 27NQX FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 FIR_5/8 STORMWATER RETENTION & DRAINAGE EASEMENT DRAINAGE EASEMENT E. LINE OF THE NW 1/4 OF SEC. 27-36-9AT CORNER 0.18' W 2.98' W AT CORNER AT CORNER AT CORNER AT CORNERLIMITS OF "ZONE A" AS SCALED FROMFIRM MAP PANEL NO. 17197C0130GLIMITS OF 0.2% ANNUAL CHANCE FLOOD HAZARD N. LINE OF THE SOUTH 1/2 OF THE NORTH 1/2 OF THE SE 1/4 OF THE NW 1/4 OF SEC. 27-36-9 20' UTILITY EASEMENT PER DOC. R2003-105598 30' TEMPORARY EASEMENT PER DOC. R2003-10559820'30'275' COMMONWEALTH EDISON COMPANY RIGHT OF WAY S88°52'50"W 1318.30'S01°49'00"E 1640.35'N. LINE OF THE NW 1/4 OF SEC. 27-36-9 LOT 2SHEET 3SHEET 2 06-03-27-200-014-0010OWNER: PLAINFIELD TWP PRK DIST 23729 W OTTAWA ST PLAINFIELD, IL 60544 06-03-27-200-015-0000OWNER: LOKE WAI LENG VANCINA GUY 16850 S LILY CACHE RD PLAINFIELD, IL 60586 06-03-27-200-013-0000 OWNER: HAYES BERNARD ROSEMARY 14501 MERCURY DR GRAND HAVEN, MI 49417 768.41' 06-03-27-101-024-0000 OWNER: NARINE SUKHRAM DEBORAH 23630 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-023-0000 OWNER: RIOLA DALE J 23644 W ROLF RD PLAINFIELD, IL 60586 06-03-27-101-033-0000 OWNER: BOISDORF DAVID JUDITH 23710 ROLF RD PLAINFIELD, IL 60586 06-03-27-101-032-0000 OWNER: RIOLA DALE J 23644 W ROLF RD PLAINFIELD, IL 60586 ZONED R-1 ZONED R-1 ZONED A-1 (WILL COUNTY) 06-03-22-300-004-0000 MUNICIPAL LIMITS SHEET 3SHEET 2EXCEPT I O N SCM 15' SIDE SETBACK LINE 20' SIDE SETBACK LINE 30' REAR SETBACK LINENORTHEAST CORNER OF PLAINSMAN TERRACE SUBDIVISION REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 4360' HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2 BASIS OF BEARINGS 0 GRAPHIC SCALE 1" = 60 30 60 120 240 60'STATE PLANE MERIDIANASPHALT PAVING OR WATER (LABELED) EXISTING CONTOUR LINE EXISTING FENCELINE (CHAIN LINK) EXISTING FENCELINE (WOOD) EXISTING FENCELINE (WIRE) UNDERGROUND CABLE TV UNDERGROUND ELECTRIC UNDERGROUND TELEPHONE CURB EXISTING BUILDING MARSH AREA WETLANDS DEPRESSED CURB UNPAVED ROAD CONCRETE WATER MAIN EDGE OF WATER OVERHEAD WIRES SANITARY SEWER STORM SEWER RAILROAD TRACKS GAS MAIN GUARDRAIL EXISTING SPOT ELEVATION CMP CORRUGATED METAL PIPE RCP REINFORCED CONCRETE PIPE FES FLARED END SECTION EXISTING EDGE OF PAVEMENT ELEVATION EXISTING TOP OF CURB ELEVATION CONC. CONCRETE DUCTILE IRON PIPE STORM DRAIN SANITARY SEWERSAN DIP SD INV INVERT BW BOTTOM OF WALL BIT. BITUMINOUS MH MANHOLE CW CONCRETE WALK TW TOP OF WALL TP TOP OF PIPE BW BACK OF WALK 782.6 2 782.62 782.12 VCP VITRIFIED CLAY PIPE EP EDGE OF PAVEMENT TC TOP OF CURB GUT GUTTER F.L. FLOW LINE DEP DEPRESSED CURB FRM. FRAME BRK. BRICK A.P. ACCESSIBLE PARKING T.F. TOP OF FOUNDATION F.F. FINISHED FLOOR ABBREVIATIONS LEGEND CB CHORD BEARING N NORTH S SOUTH E EAST W WEST R RADIUS A ARC LENGTH P.U.E. PUBLIC UTILITY EASEMENT U.E. UTILITY EASEMENT D.E. DRAINAGE EASEMENT PT POINT OF TANGENCY PC POINT OF CURVATURE PRC POINT OF REVERSE CURVATURE PCC POINT OF COMPOUND CURVATURE INFORMATION TAKEN FROM DEED EXCEPTION TO BLANKET EASEMENT M.U.E. MUNICIPAL UTILITY EASEMENT I.E. INGRESS & EGRESS EASEMENT <DEED> [CALC]CALCULATED DATUM MEASURED DATUM (REC)RECORD DATUM MEAS. ETBE GUY POLE UTILITY POLE TRAFFIC LIGHT FIBER OPTIC CABLE LINE WATER METER PUBLIC PAY TELEPHONE PARKING METER GAS METER HEADWALL TELEPHONE PEDESTAL MAILBOX CABLE TV PEDESTAL TRAFFIC LIGHT POLE LIGHT STANDARD ELECTRIC MANHOLE TELEPHONE MANHOLE ELECTRIC METER TRAFFIC CONTROL VAULT TRANSFORMER PAD PAINTED TELEPHONE LINE PAINTED ELECTRIC LINE TRAFFIC CONTROL BOX ELECTRIC PEDESTAL ELECTRIC VAULT ELECTRICAL JUNCTION BOX ELECTRIC SERVICE OUTLET BOX HANDHOLE POWER POLE ANCHOR BASKETBALL HOOP W/ TRUNK SIZE W/ TRUNK SIZE DECIDUOUS TREE PIPELINE MARKER PAINTED GAS LINE GAS VALVE VAULT NON-DECIDUOUS TREE GAS VALVE GAS METER WATER VALVE WATER VALVE VAULT PAINTED WATER LINE IRRIGATION HEAD WETLAND MARKER MONITORING WELL POST INDICATOR VALVE WELL HEAD HOSE BIB POST B-BOX SIGN HYDRANT STORM INLET SANITARY MANHOLE STORM MANHOLE CURB INLET FLARED END SECTION FLAGPOLE CLEANOUT QUARTER SECTION CORNERSECTION CORNER AIR CONDITIONER PAD/UNIT ELECTRIC TRANSFORMER PAD BUSH SOIL BORING HOLE W/ NUMBER UNDERGROUND CABLE TV(ATLAS INFO.) UNDERGROUND FIBER OPTIC CABLE(ATLAS) UNDERGROUND ELECTRIC(ATLAS INFO.) UNDERGROUND TELEPHONE(ATLAS INFO.) GAS MAIN(ATLAS INFO.) WATER MAIN (ATLAS INFO.) SANITARY SEWER(ATLAS INFO.) STORM SEWER(ATLAS INFO.) FOUND IRON ROD FOUND PK NAIL SET TRAVERSE POINT FOUND DISK IN CONCRETE FOUND ROW MARKER FOUND RAILROAD SPIKE SET PK NAIL SET IRON PIPE FOUND IRON BAR FOUND BRASS DISC SET CONCRETE MONUMENT WITH BRASS DISC FOUND IRON PIPEFIP SIP SBM FIB SPK FBD FIR FPK FRS TP SET CONCRETE MONUMENTSCM FOUND CUT CROSSFCC FOUND MAG NAILFMG SET MAG NAILSMG PROPERTY LINE EXISTING LOT LINE PROPOSED EASEMENT LINE EX. & PRO. BUILDING SETBACK LINE EXISTING EASEMENT LINE SECTION LINE PROPOSED LOT LINE EX. & PRO. CENTERLINE EXISTING RIGHT-OF-WAY LINE PROPOSED RIGHT-OF-WAY LINE IRRIGATION CONTROL VALVE SB# THE BASIS OF BEARINGS IS THE STATE PLANE COORDINATE SYSTEM (SPCS) NAD 83 (2011) ZONE 1201 (ILLINOIS EAST) WITH PROJECT ORIGIN AT LATITUDE: 41° 34' 27.67797" N LONGITUDE: 88° 12' 03.42436" W ELLIPSOIDAL HEIGHT: 494.176 SFT GROUND SCALE FACTOR: 1.0000470827 ALL MEASUREMENTS ARE ON THE GROUND. PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN,, IN WILL COUNTY, ILLINOIS; 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT 159 CHRIS T O PHER D. BA R T OSZWOODR I DGE , I L L INOIS#3189 PROFESSIONAL LAND SURVEYOR STATE OF ILLINOIS CERTIFICATE AS TO SPECIAL ASSESSMENTS STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) , ______________________________, TREASURER OF THE VILLAGE OF PLAINFIELD DO HEREBY CERTIFY THAT THERE ARE NO DELINQUENT OR UNPAID CURRENT OR FORFEITED SPECIAL ASSESSMENTS OR ANY DEFERRED INSTALLMENTS THEREOF THAT HAVE BEEN APPORTIONED AGAINST THE TRACT OF LAND INCLUDED IN THE PLAT. DATED IN PLAINFIELD, WILL COUNTY, ILLINOIS, THIS _____ DAY OF _________________, 20____. ______________________________ (TREASURER) PLANNING COMMISSION CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) I, _____________________________, CHAIRMAN OF THE VILLAGE OF PLAINFIELD PLAN COMMISSION DO HEREBY CERTIFY THAT ON THIS ____ DAY OF _________________A.D., _______, THIS PLAT OF SUBDIVISION WAS DULY APPROVED BY THE PLAN COMMISSION OF THE VILLAGE OF PLAINFIELD. ______________________________ (CHAIRMAN) BOARD OF TRUSTEES CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTIES OF WILL ) AND KENDALL ) APPROVED AND ACCEPTED BY THE BOARD OF TRUSTEES OF THE VILLAGE OF PLAINFIELD, WILL COUNTY, ILLINOIS. THIS ____ DAY OF ________________ A.D., ________. ATTEST: ______________________ BY: ________________________ (VILLAGE PRESIDENT) WILL COUNTY RECORDER'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) THIS INSTRUMENT ________________________________, WAS FILED FOR RECORD IN THE RECORDER'S OFFICE OF WILL COUNTY, ILLINOIS, ON THE _____ DAY OF _______________ A.D., _______________, AT ________ O'CLOCK __.M., AND WAS RECORDED IN BOOK ______ OF PLATS ON PAGE _______. ________________________________ (RECORDER OF DEEDS) WILL COUNTY CLERK'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) I, ___________________________________, COUNTY CLERK OF WILL COUNTY, ILLINOIS, DO HEREBY CERTIFY THAT THERE ARE NO DELINQUENT GENERAL TAXES, NO UNPAID CURRENT TAXES, NO UNPAID FORFEITED TAXES, AND NO REDEEMABLE TAX SALES AGAINST ANY OF THE LAND INCLUDED IN THE ANNEXED PLAT. I FURTHER CERTIFY THAT I HAVE RECEIVED ALL STATUTORY FEES IN CONNECTION WITH THE ANNEXED PLAT. THIS _____ DAY OF ______________ A.D., ________, _________________________________ (COUNTY CLERK) WILL COUNTY TAX MAPPING CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) I, _______________________________, DIRECTOR OF TAX MAPPING AND PLATTING OFFICE DO HEREBY CERTIFY THAT I HAVE CHECKED THE PROPERTY DESCRIPTION ON THIS PLAT AGAINST AVAILABLE COUNTY RECORDS AND FIND SAID DESCRIPTION TO BE TRUE AND CORRECT. THERE PROPERTY HEREIN DESCRIBED IS LOCATED ON TAX MAP # ________________ AND IS IDENTIFIED AS PERMANENT REAL ESTATES TAX INDEX NUMBER (PIN): _______________ DATED THIS _____ DAY OF _____________ A.D., _________. _________________________________ (DIRECTOR) SURVEYOR'S CERTIFICATE CERTIFICATE OF COUNTY HIGHWAY STATE OF ILLINOIS ) ) SS COUNTY OF WILL ) APPROVED THIS _______ DAY OF ___________________ A.D., 20____ AS TO ROADWAY ACCESS TO COUNTY HIGHWAY _________________________________ ALSO KNOWN AS _________________________________. ____________________________________ WILL COUNTY ENGINEER PART OF SECTION 9, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, NORTH OF THE INDIAN BOUNDARY LINE, IN WILL COUNTY, ILLINOIS. STATE OF ILLINOIS ) ) SS COUNTY OF DUPAGE ) THIS IS TO CERTIFY THAT I, CHRISTOPHER D. BARTOSZ, ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 3188, HAVE SURVEYED AND SUBDIVIDED THE FOLLOWING DESCRIBED PROPERTY: THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, EXCEPTING THEREFROM THAT PART FALLING SOUTH OF THE NORTH LINE OF LOTS 14 THROUGH 24, AND SAID LINE EXTENDED WEST TO THE SECTION LINE, AND LYING SOUTH OF THE NORTH LINE OF LOTS 8 THROUGH 1, AND SAID LINE EXTENDED EAST TO THE QUARTER SECTION LINE, SAID LOTS FALLING IN PLAINSMAN TERRACE, A SUBDIVISION IN PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED NOVEMBER 26, 1975 AS DOCUMENT NO. R75-32760 AND ALSO EXCEPT THAT PART OF ILLINOIS ROUTE 59 DEDICATED AND CONVEYED PER DOCUMENT NO. 463161, BOOK 776, PAGE 343, IN WILL COUNTY, ILLINOIS; EXCEPT THAT PART CONVEYED TO THE DEPARTMENT OF TRANSPORTATION OF THE STATE OF ILLINOIS, FOR AND ON BEHALF OF THE PEOPLE OF THE STATE OF ILLINOIS, BY AGREED FINAL JUDGMENT ORDER FILED UNDER CASE NO. 06ED38, RECORDED MARCH 28, 2011 AS DOCUMENT NO. R2011031724, DESCRIBED AS FOLLOWS: THAT PART OF THE NORTHWEST QUARTER OF SECTION 27, TOWNSHIP 36 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, IN WILL COUNTY, ILLINOIS, DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHWEST CORNER OF THE NORTHWEST QUARTER OF SAID SECTION 27; THENCE ON AN ASSUMED BEARING OF NORTH 88 DEGREES 55 MINUTES 06 SECONDS EAST ALONG THE NORTH LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27, A DISTANCE OF 69.30 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 307.91 FEET; THENCE NORTH 88 DEGREES 04 MINUTES 27 SECONDS EAST, A DISTANCE OF 5.00 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 747.00 FEET; THENCE SOUTH 88 DEGREES 04 MINUTES 27 SECONDS WEST, A DISTANCE OF 5.00 FEET; THENCE SOUTH 1 DEGREE 55 MINUTES 33 SECONDS EAST, A DISTANCE OF 258.88 FEET TO THE NORTH LINE OF LOT 24 IN PLAINSMAN TERRACE, BEING A SUBDIVISION OF PART OF THE NORTHWEST QUARTER OF SAID SECTION 27, ACCORDING TO THE PLAT THEREOF RECORDED NOVEMBER 26, 1975 AS DOCUMENT NUMBER R75-32760; THENCE SOUTH 88 DEGREES 53 MINUTES 19 SECONDS WEST ALONG THE NORTH LINE OF LOT 24 IN SAID PLAINSMAN TERRACE AND THE WESTERLY EXTENSION THEREOF, A DISTANCE OF 70.99 FEET TO THE WEST LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27; THENCE NORTH 1 DEGREE 51 MINUTES 07 SECONDS WEST ALONG THE WEST LINE OF THE NORTHWEST QUARTER OF SAID SECTION 27, A DISTANCE OF 1313.81 FEET TO THE POINT OF BEGINNING. I FURTHER CERTIFY THAT THIS LAND IS WITHIN THE CORPORATE LIMITS OF A MUNICIPALITY WHICH HAS AUTHORIZED A COMPREHENSIVE PLAN AND IS EXERCISING THE SPECIAL POWERS AUTHORIZED BY DIVISION 12 OF ARTICLE 11 OF THE ILLINOIS MUNICIPAL CODE, AS NOW OR HEREAFTER AMENDED. I FURTHER CERTIFY THAT THE ANNEXED PLAT IS A CORRECT REPRESENTATION OF SAID SURVEY AND SUBDIVISION. ALL DISTANCES ARE SHOWN IN FEET AND DECIMALS THEREOF. PERMANENT MONUMENTS WILL BE SET AT ALL LOT CORNERS, EXCEPT WHERE CONCRETE MONUMENTS ARE INDICATED. I FURTHER CERTIFY THAT PART OF THIS PROPERTY IS IN AN AREA OF MINIMAL FLOODING (ZONE X), PART IS IN SPECIAL FLOOD HAZARD (ZONE A) AND PART IS IN 0.2% ANNUAL CHANCE FLOOD HAZARD (ZONE X) AS DEFINED BY AS DEFINED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY'S FLOOD INSURANCE RATE MAP OF WILL COUNTY, ILLINOIS COMMUNITY PANEL NO. 17197C0130G, EFFECTIVE DATE 02/15/2019. DATED THIS 27TH DAY OF FEBRUARY , A.D., 2023 . ________________________________________________ CHRISTOPHER D. BARTOSZ ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 35-3189 MY LICENSE EXPIRES ON NOVEMBER 30, 2024. V3 COMPANIES OF ILLINOIS, LTD. PROFESSIONAL DESIGN FIRM NO. 184000902 THIS DESIGN FIRM NUMBER EXPIRES APRIL 30, 2025. cdbartosz@v3co.com DESIGNATION TO RECORD STATE OF ILLINOIS ) ) SS COUNTY OF DUPAGE ) I, CHRISTOPHER D. BARTOSZ, AN ILLINOIS PROFESSION LAND SURVEYOR, IN ACCORDANCE WITH THE PLAT ACT (765ICLS205/2) DO HEREBY DESIGNATE THE VILLAGE CLERK OF THE VILLAGE OF PLAINFIELD TO RECORD THIS PLAT. THE REPRESENTATIVE SHALL PROVIDE THE SURVEYOR WITH A RECORDED COPY OF THIS PLAT. THIS 27TH DAY OF FEBRUARY , A.D., 2023 . ______________________________________ CHRISTOPHER D. BARTOSZ ILLINOIS PROFESSIONAL LAND SURVEYOR NO. 035-003188 MY LICENSE EXPIRES ON NOVEMBER 30, 2024. OWNER'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF ________ ) THIS IS TO CERTIFY THAT THE UNDERSIGNED IS THE OWNER OF THE LAND DESCRIBED IN THE ANNEXED PLAT, AND HAS CAUSED THE SAME TO BE SURVEYED AND SUBDIVIDED, AS INDICATED THEREON, FOR THE USES AND PURPOSES THEREIN SET FORTH, AND DOES HEREBY ACKNOWLEDGE AND ADOPT THE SAME UNDER THE STYLE AND TITLE THEREON INDICATED. DATED THIS _____ DAY OF ______________, 20____. ___________________________________ ___________________________________ (TITLE) __________________________________ (ADDRESS) NOTARY CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________) I, _________________________, A NOTARY PUBLIC IN AND FOR SAID COUNTY, IN THE STATE AFORESAID, DO HEREBY CERTIFY THAT ________________________________, IS PERSONALLY KNOWN TO ME TO BE THE SAME PERSONS WHOSE NAMES ARE SUBSCRIBED TO THE FOREGOING INSTRUMENT AS SUCH OWNERS, APPEARED BEFORE ME THIS DAY IN PERSON AND ACKNOWLEDGED THAT THEY SIGN THE ANNEXED PLAT AS THEIR OWN FREE AND VOLUNTARY ACT FOR USES AND PURPOSES THEREIN SET FORTH. GIVEN UNDER MY HAND AND NOTARIAL SEAL THIS _____ DAY OF _____________, 20____. _______________________________________ (NOTARY PUBLIC) MY COMMISSION EXPIRES _______________ I.D.O.T. CERTIFICATE THIS PLAT HAS BEEN APPROVED BY THE ILLINOIS DEPARTMENT OF TRANSPORTATION WITH RESPECT TO ROADWAY ACCESS PURSUANT TO SECTION 2 OF "AN ACT TO REVISE THE LAW IN RELATION TO PLATS," AS AMENDED. A PLAN THAT MEETS THE REQUIREMENTS CONTAINED IN THE DEPARTMENT'S "POLICY ON PERMITS FOR ACCESS DRIVEWAYS TO STATE HIGHWAYS" WILL BE REQUIRED BY THE DEPARTMENT. ________________________________________________________________ DISTRICT ENGINEER DATE REVISIONS DATENO.DESCRIPTION7325 Janes Avenue, Suite 100Engineers Scientists Surveyors v3co.com 630.724.0384 fax 630.724.9200 voice Woodridge, IL 60517 PREPARED FOR: of1" =SCALE: PROJECT MANAGER:DRAFTING COMPLETED: CHECKED BY:FIELD WORK COMPLETED: DRAWN BY:SHEET NO. Project No: Group No: HAWK AUTO GROUP 640 PASQUINELLI DRIVE WESTMONT, IL 60559 331-481-5902 CDB 44N/A HAWK AUTO, PLAINFIELD, IL PRELIMINARY / FINAL PLAT OF SUBDIVISION MLP CDB HAWK AUTO PRELIMINARY / FINAL PLAT OF SUBDIVISION OF 220957 N/A 02-27-23 VP04.2CHRISTOPHER D. BA R T OSZWOODRIDGE , I L LINOIS#3189 PROFESSIONAL LAND SURVEYOR STATE OF ILLINOIS STORMWATER MANAGEMENT EASEMENT PROVISIONS A NON-EXCLUSIVE EASEMENT IS HEREBY RESERVED FOR AND GRANTED WITHIN THE AREAS SO DESIGNATED ON THE PLAT AND MARKED STORMWATER MANAGEMENT EASEMENT (SME) FOR THE COLLECTION CONVEYANCE AND STORAGE OF STORMWATER IN AREAS TO BE MAINTAINED BY THE OWNER OF THE LOT(S) OR OUTLOT(S) ON WHICH THE FACILITIES EXIST IN ACCORDANCE WITH MUNICIPAL ORDINANCES AND THE APPROVED FINAL ENGINEERING IMPROVEMENT PLANS. TOGETHER WITH THE RIGHT OF ACCESS THERETO FOR THE PERSONNEL AND EQUIPMENT NECESSARY AND REQUIRED FOR SUCH USES AND PURPOSES, AND TOGETHER WITH THE RIGHT TO CUT, TRIM, OR REMOVE TREES, BUSHES AND ROOTS AS MAY BE REASONABLY REQUIRED INCIDENTAL TO THE RIGHTS HEREIN GIVEN, AND THE RIGHT TO ENTER UPON THE HOME FOR ALL SUCH PURPOSES. ENCROACHMENT OF ANY KIND INCLUDING LANDSCAPING, FENCES, SHEDS OR ACCESSORY STRUCTURES WITHIN SAID EASEMENT IS PROHIBITED UNLESS THE MUNICIPAL ENGINEER HAS DETERMINED SAID ENCROACHMENT WILL NOT INTERFERE WITH THE PROPER FUNCTION OF SAID FACILITIES. THE VILLAGE SHALL HAVE THE RIGHT, BUT NOT THE OBLIGATION, TO ENTER WITH PERSONNEL AND EQUIPMENT UPON SAID EASEMENT AT ANY TIME FOR THE PURPOSES OF ACCESS TO AND INSPECTION OF THE STORMWATER MANAGEMENT FACILITIES LOCATED WITHIN SAID EASEMENT. IF THE OWNER FAILS TO MAINTAIN SAID FACILITIES AND, AFTER RECEIPT OF NOTICE FROM THE VILLAGE OF SAID FAILURE, THE OWNER FAILS TO MAKE REQUIRED REPAIRS IN A REASONABLE PERIOD OF TIME, THE VILLAGE MAY MAKE THE REQUIRED REPAIRS AND SEEK REIMBURSEMENT FROM THE OWNER FOR THE COSTS INCURRED BY THE VILLAGE TO MAKE THE REPAIR AND/OR FILE A LIEN ON THE HOME. SURFACE WATER STATEMENT STATE OF ILLINOIS ) ) SS COUNTY OF _________) TO THE BEST OF OUR KNOWLEDGE AND BELIEF THE DRAINAGE OF SURFACE WATERS WILL NOT BE CHANGED BY THE CONSTRUCTION OF SUCH SUBDIVISION OR ANY PART THEREOF, OR, THAT IF SUCH SURFACE WATER DRAINAGE WILL BE CHANGED, ADEQUATE PROVISION HAS BEEN MADE FOR COLLECTION AND DIVERSION OF SUCH SURFACE WATERS INTO PUBLIC AREAS, OR DRAINS WHICH THE SUBDIVISION HAS A RIGHT TO USE, AND THAT SUCH SURFACE WATERS WILL NOT BE DEPOSITED ON THE PROPERTY OF ADJOINING LAND OWNERS IN SUCH CONCENTRATIONS AS MAY CAUSE DAMAGE TO THE ADJOINING PROPERTY BECAUSE OF THE CONSTRUCTION OF THE SUBDIVISION. DATED THIS ______ DAY OF _______________, 20___. ______________________________________ _______________________________________ IL REGISTERED PROFESSIONAL ENGINEER OWNER BY: ____________________________________ ITS: ____________________________________ MORTGAGEE'S CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________ ) ________________________________________________________________ AS MORTGAGEE OF THE ABOVE DESCRIBED PROPERTY, HEREBY CERTIFIES THAT IT GRANTS APPROVAL FOR SAID PROPERTY TO BE SURVEYED AND SUBDIVIDED AS SHOWN HEREON. DATED THIS ________ DAY OF ____________________ A.D., 20____. ATTEST: ______________________________BY: ______________________________ NOTARY CERTIFICATE STATE OF ILLINOIS ) ) SS COUNTY OF _________ ) I, _________________________, A NOTARY PUBLIC IN AND FOR SAID COUNTY, IN THE STATE AFORESAID, DO HEREBY CERTIFY THAT ____________________ AND ____________________ OF SAID CORPORATION, PERSONALLY KNOWN TO ME TO BE THE SAME PERSONS WHOSE NAMES ARE SUBSCRIBED TO THE FOREGOING INSTRUMENT, APPEARED BEFORE ME THIS DAY IN PERSON AND ACKNOWLEDGED THAT THEY SIGNED AND DELIVERED THIS INSTRUMENT AS THEIR OWN FREE AND VOLUNTARY ACT AND AS THE FREE AND VOLUNTARY ACT OF SAID CORPORATION, AS GIVEN UNDER MY HAND AND NOTARIAL SEAL, THIS ________ DAY OF ____________________ A.D., 20____. MY COMMISSION EXPIRES. ________________ ________________________________________ NOTARY EASEMENT PROVISION AN EASEMENT FOR SERVING THE SUBDIVISION AND OTHER PROPERTY WITH ELECTRIC AND COMMUNICATIONS SERVICE IS HEREBY RESERVED FOR AND GRANTED TO COMMONWEALTH EDISON COMPANY AND ILLINOIS BELL TELEPHONE COMPANY (AT&T), GRANTEES, THEIR RESPECTIVE SUCCESSORS AND ASSIGNS, JOINTLY AND SEVERALLY, TO INSTALL, OPERATE, MAINTAIN AND REMOVE, FROM TIME TO TIME, FACILITIES USED IN CONNECTION WITH OVERHEAD AND UNDERGROUND TRANSMISSION AND DISTRIBUTION OF ELECTRICITY AND SOUNDS AND SIGNALS IN, OVER, UNDER, ACROSS, ALONG AND UPON THE SURFACE OF THE PROPERTY SHOWN WITHIN THE DOTTED LINES ON THE PLAT AND MARKED "EASEMENT". THE PROPERTY DESIGNATED IN THE DECLARATION OF CONDOMINIUM AND/OR ON THIS PLAT AS "COMMON ELEMENTS," AND THE PROPERTY DESIGNATED ON THE PLAT AS A "COMMON AREA OR AREAS," AND THE PROPERTY DESIGNATED ON THE PLAT FOR STREETS AND ALLEYS, WHETHER PUBLIC OR PRIVATE, TOGETHER WITH THE RIGHT TO INSTALL REQUIRED SERVICE CONNECTIONS OVER OR UNDER THE SURFACE OF EACH LOT AND COMMON AREA OR AREAS TO SERVE IMPROVEMENTS THEREON, OR ON ADJACENT LOTS, AND COMMON AREA OR AREAS, THE RIGHT TO CUT, TRIM OR REMOVE TREES, BUSHES AND ROOTS AS MAY BE REASONABLE REQUIRED INCIDENT TO THE RIGHTS HEREIN GIVE, AND THE RIGHT TO ENTER UPON THE SUBDIVIDED PROPERTY FOR ALL SUCH PURPOSES. OBSTRUCTIONS SHALL NOT BE PLACED OVER GRANTEES' FACILITIES OR IN, UPON OR OVER THE PROPERTY WITHIN THE DOTTED LINES MARKED "EASEMENT" WITHOUT THE PRIOR WRITTEN CONSENT OF GRANTEES. AFTER INSTALLATION OF ANY SUCH FACILITIES, THE GRADE OF THE SUBDIVIDED PROPERTY SHALL NOT BE ALTERED IN A MANNER SO AS TO INTERFERE WITH THE PROPER OPERATION AND MAINTENANCE THEREOF. THE TERM "COMMON ELEMENTS" SHALL HAVE THE MEANING SET FORTH FOR SUCH TERM IN THE "CONDOMINIUM PROPERTY", CHAPTER 765 ILCS 605/2(E), AS AMENDED FROM TIME TO TIME. THE TERM "COMMON AREA OR AREAS" IS DEFINED AS A LOT, PARCEL OR AREA OF REAL PROPERTY, THE BENEFICIAL USE AND ENJOYMENT OF WHICH IS RESERVED IN WHOLE AS AN APPURTENANCE TO THE SEPARATELY OWNED LOTS, PARCELS OR AREAS WITHIN THE PLANNED DEVELOPMENT, EVEN THOUGH SUCH BE OTHERWISE DESIGNATED ON THE LOT BY TERMS SUCH AS, "OUTLOTS", "COMMON ELEMENTS", "OPEN SPACE", "OPEN AREA," "COMMON GROUND," "PARKING AND COMMON AREA". THE TERMS "COMMON AREA OR AREAS" AND "COMMON ELEMENTS" INCLUDES REAL PROPERTY SURFACED WITH INTERIOR DRIVEWAYS AND WALKWAYS, BUT EXCLUDES REAL PROPERTY PHYSICALLY OCCUPIED BY A BUILDING, SERVICE BUSINESS DISTRICT OR STRUCTURES SUCH AS A POOL OR RETENTION POND, OR MECHANICAL EQUIPMENT.RELOCATION OF FACILITIES WILL BE DONE BY GRANTEES AT COST OF GRANTOR/LOT OWNER, UPON WRITTEN REQUEST. AN EASEMENT IS HEREBY RESERVED FOR AND GRANTED TO THE NORTHERN ILLINOIS GAS COMPANY, ITS SUCCESSORS AND ASSIGNS ("NI-GAS") TO INSTALL, OPERATE, MAINTAIN, REPAIR, REPLACE AND REMOVE, FACILITIES USED IN CONNECTION WITH THE TRANSMISSION AND DISTRIBUTION OF NATURAL GAS IN, OVER, UNDER, ACROSS, ALONG AND UPON THE SURFACE OF THE PROPERTY SHOWN ON THIS PLAT MARKED "EASEMENT", "COMMON AREA OR AREAS" AND STREETS AND ALLEYS, WHETHER PUBLIC OR PRIVATE, AND THE PROPERTY DESIGNATED IN THE DECLARATION OF CONDOMINIUM AND/OR ON THIS PLAT AS "COMMON ELEMENTS", TOGETHER WITH THE RIGHT TO INSTALL REQUIRED SERVICE CONNECTIONS OVER OR UNDER THE SURFACE OF EACH LOT AND COMMON AREA OR AREAS TO SERVE IMPROVEMENTS THEREON, OR ON ADJACENT LOTS, AND COMMON AREA OR AREAS, AND TO SERVE OTHER PROPERTY, ADJACENT OR OTHERWISE, AND THE RIGHT TO REMOVE OBSTRUCTIONS, INCLUDING BUT NOT LIMITED TO, TREES, BUSHES, ROOTS AND FENCES, AS MAY BE REASONABLY REQUIRED INCIDENT TO THE RIGHTS HEREIN GIVEN, AND THE RIGHT TO ENTER UPON THE PROPERTY FOR ALL SUCH PURPOSES. OBSTRUCTIONS SHALL NOT BE PLACED OVER NI-GAS' FACILITIES OR IN, UPON OR OVER THE PROPERTY IDENTIFIED ON THIS PLAT FOR UTILITY PURPOSES WITHOUT THE PRIOR WRITTEN CONSENT OF NI-GAS. AFTER INSTALLATION OF ANY SUCH FACILITIES, THE GRADE OF THE PROPERTY SHALL NOT BE ALTERED IN A MANNER SO AS TO INTERFERE WITH THE PROPER OPERATION AND MAINTENANCE THEREOF. THE TERM "COMMON ELEMENTS" SHALL HAVE THAT MEANING SET FORTH FOR SUCH TERM IN SECTION 605/2(E) OF THE "CONDOMINIUM PROPERTY ACT" (ILLINOIS COMPILED STATUTES, CH. 765, SEC. 605/2(E)), AS AMENDED FROM TIME TO TIME. THE TERM "COMMON AREA OR AREAS" IS DEFINED AS A LOT, PARCEL OR AREA OF REAL PROPERTY, INCLUDING REAL PROPERTY SURFACED WITH INTERIOR DRIVEWAYS AND WALKWAYS, THE BENEFICIAL USE AND ENJOYMENT OF WHICH IS RESERVED IN WHOLE AS AN APPURTENANCE TO THE SEPARATELY OWNED LOTS, PARCELS OR AREAS WITHIN THE PROPERTY, EVEN THOUGH SUCH AREAS MAY BE DESIGNATED ON THIS PLAT BY OTHER TERMS. A PERMANENT NONEXCLUSIVE EASEMENT IS HEREBY RESERVED FOR AND GRANTED TO THE VILLAGE OF PLAINFIELD, ILLINOIS AND TO ITS SUCCESSORS AND ASSIGNS, IN, UPON, ACROSS, OVER, UNDER, AND THROUGH THE AREAS SHOWN BY DASHED LINES AND LABELED "EASEMENTS" ON THE ATTACHED PLAT OF SUBDIVISION FOR THE PURPOSE OF INSTALLING, CONSTRUCTING, INSPECTING, OPERATING, REPLACING, RENEWING, ALTERING, ENLARGING, REMOVING, REPAIRING, CLEANING AND MAINTAINING STORM AND FLOOD WATER CHANNELS, BASINS, SEWERS, STORM SEWERS AND SANITARY SEWERS, WATER TRANSMISSION MAINS AND LINES, VALVE VAULTS AND HYDRANTS, AND ANY AND ALL MANHOLES, HYDRANTS, PIPES, CONNECTIONS, CATCH BASINS, BUFFALO BOXES AND WITHOUT LIMITATION, SUCH OTHER STRUCTURES AND APPURTENANCES AS MAY BE NECESSARY FOR CONVENIENT FOR THE FURNISHING OF PUBLIC UTILITY SERVICES, TOGETHER WITH THE RIGHT OF INGRESS AND EGRESS ACROSS AND THROUGH THE EASEMENTS FOR PERSONS AND EQUIPMENT TO DO ANY OR ALL OF THE ABOVE WORK. THE RIGHT IS ALSO HEREBY GRANTED TO THE VILLAGE TO CUT DOWN, TRIM OR REMOVE ANY TREES, SHRUBS OR OTHER PLANTS ON THE EASEMENTS AS WELL AS REMOVE ANY OTHER FENCE OR STRUCTURE THAT INTERFERE WITH THE OPERATION OF THE ABOVE OR WITH THE EXERCISE OF ANY RIGHTS UNDER THIS PARAGRAPH. ALL THE EASEMENTS INDICATED SHALL BE PERPETUAL, EXCEPT THOSE IDENTIFIED AS "TEMPORARY." THE EASEMENT AREAS SHOWN AS DETENTION OR RETENTION EASEMENTS SHALL INCLUDE, IN ADDITION TO THE ABOVE RIGHTS, THE RIGHT TO FLOOD SUCH AREA WITH STORM WATERS, AND SHALL ALSO INCLUDE THE RIGHT TO INSTALL AND MAINTAIN STORM WATER DETENTION AND RETENTION STRUCTURES. NO FENCES, STRUCTURES OR TREES SHALL BE PLACED IN EASEMENTS LABELED "EMERGENCY OVERLAND RELEASE ROUTES." SCHOOL DISTRICT BOUNDARY STATEMENT BEING DULY SWORN, UPON HIS/HER OATH DEPOSES AND STATES AS FOLLOWS: 1. THE OWNER OF THE PROPERTY LEGALLY DESCRIBED ON THIS PLAT OF SUBDIVISION, WHICH HAS BEEN SUBMITTED TO THE VILLAGE OF PLAINFIELD FOR APPROVAL, WHICH LEGAL DESCRIPTION IS INCORPORATED HEREIN BY REFERENCE AND 2. TO THE BEST OF THE OWNER'S KNOWLEDGE, THE SCHOOL DISTRICT IN WHICH TRACT, PARCEL, LOT OR BLOCK OF THE PROPOSED SUBDIVISION LIES IS LOCATED IN: PLAINFIELD COMMUNITY CONSOLIDATED SCHOOL DISTRICT 202 500 W. FORT BEGGS DRIVE PLAINFIELD, ILLINOIS 60544 DATED THIS ______ DAY OF _______________ A.D., 20____. BY: ______________________________ATTEST: ___________________________ (SIGNATURE)(SIGNATURE} TITLE: ____________________________TITLE: ______________________________ PRINT TITLE PRINT TITLE SUBSCRIBED AND SWORN BEFORE ME THIS ______ DAY OF ________________ A.D., 20____. _________________________________ NOTARY PUBLIC 1. 03-15-23 REVISED PER VILLAGE COMMENTS DATED MARCH 3, 2023 2. 03-24-23 REVISED PER CLIENT COMMENT TRANSITIONAL YARD PROVISION -NO BUILDINGS OR STRCUTURES ARE PERMITTED. -SHALL NOT BE USED FOR PARKING, LOADING, SERVICING, OR STORAGE. -SHALL BE LANDSCAPED AND INCLUDE A MINIMUM 4' IN HEIGHT OPAQUE FENCE. BERMING SHOULD BE CONSIDERED FOR ADDITIONAL SCREENING. 3. 12-05-23 REVISED STORMWATER MANAGEMENT EASEMENT SHALL BE LANDSCAPED AND INCLUDE A MINIMUM 4' IN HEIGHT BERM FOR ADDITIONAL SCREENING. 160